CLUSTAL format seed alignment for MF_00126

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYQ_DEIRA       MGAFGWEQDRGAPFSGRSPRILTRMTDAPRPTAGADAP---------ARPPAAPLVAPNF
SYQ_CLOK5       ---------------------------------MGDNN----------NS-------SNF
SYQ_PEPD6       ---------------------------------MSNET----------NS-------SNF
SYQ_CLOPS       ---------------------------------MSNAE----------HS-------SNF
SYQ_CLOPE       ---------------------------------MSNAE----------HS-------SNF
SYQ_CLOP1       ---------------------------------MSNAE----------HS-------SNF
SYQ_RHOBA       MARANRGEHSTLSTFWQSRHNAASFDPLYRRIDVNAPE-----PSDSATPEKTPS--KHF
SYQ_XYLFA       ----------------------------MSEITSTDAR---------AQPEK-----KDF
SYQ_XYLFM       ----------------------------MSEITTTDAQ---------AQPEK-----KDF
SYQ_XYLFT       ----------------------------MSEITTTDAQ---------AQPEK-----KDF
SYQ_XANCP       --------------------------MSEIPATDATAP---------AEK-------KDF
SYQ_XANC8       --------------------------MSEIPATDATAP---------AEK-------KDF
SYQ_XANOR       --------------------------MSETLATDATTP---------AEK-------KDF
SYQ_XANOM       --------------------------MSETLATDATTP---------AEK-------KDF
SYQ_XANAC       --------------------------MSETLATDATAP---------AEK-------KDF
SYQ_XANC5       --------------------------MSETLATDATAP---------AEK-------KDF
SYQ_NITEU       ----------------------------------MNTP---------SSP-------AHF
SYQ_BORA1       ---------------------------------MTQTT----------AP----HAASNY
SYQ_BORBR       ---------------------------------MTHAP----------TP----PAASNF
SYQ_BORPA       ---------------------------------MTHAP----------TP----PAASNF
SYQ_BORPE       ---------------------------------MTHAP----------TP----PAASNF
SYQ_POLNS       -----------------------MSQDSKPSKANAGAV---------VEP-------SNF
SYQ_POLAQ       -----------------------MSQDSKPTKSAAGAI---------AEP-------SNF
SYQ_RALPJ       -------------------------------MSQDNAT---------APT-------SNF
SYQ_RALSO       ---------------------------MSQDNATGAAA---------AST-------SNF
SYQ_CUPMC       ------------------------------MSHDTKPN---------DTPAA-----SNF
SYQ_CUPTR       -----------------------------MSHDNKPTD---------SNPAA-----SNF
SYQ_CUPNH       ---------------------------------MSHDN----------KPTDSTPAASNF
SYQ_BRADU       -------------------------------MTEPVAA---------EVG-------RDF
SYQ_NITHX       -------------------------------MTDESTA---------DAG-------RDF
SYQ_NITWN       ----------------------------MTDESTAEAG-------------------RDF
SYQ_CHRVO       ---------------------------------MSTEN---------NAPVV-----NNF
SYQ_NEIG1       --------------------------------MLNKDQ---------FAD-------NHF
SYQ_NEIMA       --------------------------------MLNKDQ---------FAD-------NHF
SYQ_NEIMB       --------------------------------MLNKDQ---------FAD-------NHF
SYQ_PSEPK       --------------------MSKPTADNAPNAAAKGAP---------AVP-------ANF
SYQ_PSESM       --------------------------MSKDPMSKPTPEPAAHSKAGPAVP-------TNF
SYQ_PSEAE       ---------------------------------MSKPE-------TTAAP--------NF
SYQ_PSEA8       ---------------------------------MSKPE-------TTAAP--------NF
SYQ_PSEAB       ---------------------------------MSKPE-------TTAAP--------NF
SYQ_PSEMY       -------------------------------MSKPTVE----------KA-------ANF
SYQ_AZOVD       ---------------------------------MSKPE----------TPAA-----ANF
SYQ_PSEU5       ---------------------------------MSKPE----------TPAA-----SNF
SYQ_PSYIN       ---------------------------------MTQVD---------TAP-------SNF
SYQ_COLP3       ---------------------------------MSDTE---------NRP-------TNF
SYQ_SHEON       -------------------------------MSHVDTE---------VRP-------SNF
SYQ_IDILO       ---------------------------------MADTD---------SRP-------SNF
SYQ_HAMD5       ---------------------------------MNEAS---------ERP-------NHF
SYQ_ALTMD       ---------------------------------MAETE---------HRP-------TNF
SYQ_PSEA6       ---------------------------------MAETE---------SRP-------TNF
SYQ_HAEDU       ---------------------------MSEETLTTEVE---------TR--------TNF
SYQ_ACTSZ       -----------------------MATANIELQSAAEHE---------AHP-------TNF
SYQ_PASMU       -----------------------MSHPVENVVAAENTE---------KRP-------TNF
SYQ_HAEIN       -------------------------MMSHTETSLGAEN---------TRT-------HNF
SYQ_HAEI8       -------------------------MMSHTETSLGAEN---------TRT-------HNF
SYQ_PSEHT       ---------------------------------MAEIE---------NRP-------SNF
SYQ_PHOPR       --------------------------------MMSESE---------ARP-------TNF
SYQ_ALISL       ---------------------------------MSETE---------TRP-------TNF
SYQ_VIBF1       ---------------------------------MSETE---------TRP-------TNF
SYQ_VIBFM       ---------------------------------MSETE---------TRP-------TNF
SYQ_VIBCH       ---------------------------------MSEAE---------ARP-------SNF
SYQ_VIBCM       ---------------------------------MSEAE---------ARP-------SNF
SYQ_VIBC3       ---------------------------------MSEAE---------ARP-------SNF
SYQ_VIBTL       ---------------------------------MSEAE---------ARP-------SNF
SYQ_VIBVY       ---------------------------------MSEAD---------ARP-------SNF
SYQ_VIBCB       ---------------------------------MSEAD---------ARP-------SNF
SYQ_VIBPA       ---------------------------------MSEAD---------ARP-------SNF
SYQ_TOLAT       ---------------------------------MTQAE---------HRP-------TNF
SYQ_SODGM       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ERWT9       ---------------------------------MSEAE---------ARP-------TNF
SYQ_PHOLL       ---------------------------------MSEAD---------ARP-------TNF
SYQ_PROMH       ---------------------------------MNEAD---------ARP-------TNF
SYQ_YERE8       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPE       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPP       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPG       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPA       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPN       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPS       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPB       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERP3       ---------------------------------MSEAE---------ARP-------SNF
SYQ_YERPY       ---------------------------------MSEAE---------ARP-------SNF
SYQ_CROS8       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ENT38       ---------------------------------MSEAE---------ARP-------SNF
SYQ_KLEP3       ---------------------------------MSEAE---------ARP-------TNF
SYQ_KLEP7       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SHIDS       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SHIBS       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SHIFL       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SHIF8       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SHIB3       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO7I       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO57       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO5E       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOUT       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO27       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOK1       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO45       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOL6       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOL5       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO81       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO55       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOLC       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOBW       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECODH       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOLI       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOSE       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO24       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECO8A       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOHS       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SHISS       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOSM       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ECOLU       ---------------------------------MSEAE---------ARP-------TNF
SYQ_ESCF3       ---------------------------------MSEAE---------ARP-------TNF
SYQ_CITK8       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALAR       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALCH       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALTI       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALSV       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALNS       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALPB       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALA4       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALDC       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALEP       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALG2       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALHS       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALPA       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALPK       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALPC       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SALTY       ---------------------------------MSEAE---------ARP-------TNF
SYQ_PECAS       ---------------------------------MSEAE---------ARP-------TNF
SYQ_PECCP       ---------------------------------MSEAE---------ARP-------TNF
SYQ_EDWI9       ---------------------------------MSEAE---------ARP-------TNF
SYQ_SERP5       ---------------------------------MSEAE---------ARP-------TNF
SYQ_BUCBP       ---------------------------------MKKQH---------SKI-------SNF
SYQ_BUCAP       --------------------------------MNNKIE---------KND-------NNF
SYQ_BUCAI       --------------------------------MDTKKE---------IKN-------NNF
SYQ_BUCA5       --------------------------------MDTKKE---------IKN-------NNF
SYQ_BUCAT       --------------------------------MDTKKE---------IKN-------NNF
                                                                           :

SYQ_DEIRA       ITEIIERDLEAGKY----------------------PRVVTRFPPDPSGYAHLGHVFASL
SYQ_CLOK5       IKNIIIEDLKSGEY----------------------EKVVTRFPPEPNGYLHIGHAKSIV
SYQ_PEPD6       IKNIIINDLETGKH----------------------DSIITRFPPEPNGYLHIGHAKSIC
SYQ_CLOPS       IRNIIIDDLDSKKH----------------------DTIITRFPPEPNGYLHIGHAKSIV
SYQ_CLOPE       IRNIIIDDLDSKKH----------------------DTIITRFPPEPNGYLHIGHAKSIV
SYQ_CLOP1       IRNIIIDDLDSKKH----------------------DTIITRFPPEPNGYLHIGHAKSIV
SYQ_RHOBA       IRQAIDADLASGRF----------------------DGVATRFPPEPNGYLHIGHAKSIC
SYQ_XYLFA       IRQIIREDLAHGTH----------------------THIRTRFPPEPNGYLHIGHAKAIC
SYQ_XYLFM       IRQIIREDLAHGTH----------------------THIHTRFPPEPNGYLHIGHAKAIC
SYQ_XYLFT       IRQIIREDLAHGTH----------------------THIHTRFPPEPNGYLHIGHAKAIC
SYQ_XANCP       IRQIVREDLASGKH----------------------TAIRTRFPPEPNGYLHIGHAKAIC
SYQ_XANC8       IRQIVREDLASGKH----------------------TAIRTRFPPEPNGYLHIGHAKAIC
SYQ_XANOR       IRQIVREDLASGKH----------------------TVIRTRFPPEPNGYLHIGHAKAIC
SYQ_XANOM       IRQIVREDLASGKH----------------------TVIRTRFPPEPNGYLHIGHAKAIC
SYQ_XANAC       IRQIVREDLASGKH----------------------TVIRTRFPPEPNGYLHIGHAKAIC
SYQ_XANC5       IRQIVREDLASGKH----------------------TVIRTRFPPEPNGYLHIGHAKAIC
SYQ_NITEU       IRNIIEEDNRTGKW---------------------NGRVETRFPPEPNGYLHIGHAKSIC
SYQ_BORA1       LRNIIEDDLAANRFQGKRWAGKPGPASMQASGLPDPARIRTRFPPEPNGYLHIGHAKSIC
SYQ_BORBR       LRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSIC
SYQ_BORPA       LRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSIC
SYQ_BORPE       LRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSIC
SYQ_POLNS       LRQIIDHDLASGAF-----------SQRTNLAGEAIPSIITRFPPEPNGYLHIGHAKSIC
SYQ_POLAQ       LRQIIDHDLASGAF-----------AQRTNLAGEAIPSIITRFPPEPNGYLHIGHAKSIC
SYQ_RALPJ       LRQIIDADLAQGTY-----------ADRKDATGQPIPPVVTRFPPEPNGYLHIGHAKSIW
SYQ_RALSO       LRQIIDTDLEQGTY-----------AGRQDTAGHALPPIITRFPPEPNGYLHIGHAKSIW
SYQ_CUPMC       LRSIIDQDLATGTY-----------AGRADKQGDPLPTVITRFPPEPNGYLHIGHAKSIC
SYQ_CUPTR       LRSIIDQDLAAGTY-----------AGRQDKQGEPLPTVITRFPPEPNGYLHIGHAKSIC
SYQ_CUPNH       LRSIIDQDLAASTY-----------AGRQDKAGEPLPTVITRFPPEPNGYLHIGHAKSIC
SYQ_BRADU       IRDIIQADLDQAKY----------------------REIVTRFPPEPNGYLHIGHAKSIA
SYQ_NITHX       IRDIVAADLASGKH----------------------KSVVTRFPPEPNGYLHLGHAKSIC
SYQ_NITWN       IRDIVAADLASGRH----------------------KSIVTRFPPEPNGYLHLGHAKSIC
SYQ_CHRVO       IRSIIDEDLATGRR----------------------SSVVTRFPPEPNGFAHIGHAKAIC
SYQ_NEIG1       IRTIIEDDLKSGKH----------------------EAVQTRFPPEPNGYLHIGHAKSIC
SYQ_NEIMA       IRTIIEDDLKSGKH----------------------EAVQTRFPPEPNGYLHIGHAKSIC
SYQ_NEIMB       IRTIIEEDLESGKH----------------------TAVQTRFPPEPNGYLHIGHAKSIC
SYQ_PSEPK       LRPIIQADLDSGKH----------------------SSIVTRFPPEPNGYLHIGHAKSIC
SYQ_PSESM       LRPIVQADLDSGKH----------------------SKIITRFPPEPNGYLHIGHAKSIC
SYQ_PSEAE       LRQIVQADLDAGKH----------------------AKIVTRFPPEPNGYLHIGHAKSIC
SYQ_PSEA8       LRQIVQADLDAGKH----------------------AKIVTRFPPEPNGYLHIGHAKSIC
SYQ_PSEAB       LRQIVQADLDAGKH----------------------AKIVTRFPPEPNGYLHIGHAKSIC
SYQ_PSEMY       LRPIVQADLDSGKH----------------------AKIVTRFPPEPNGYLHIGHAKSIC
SYQ_AZOVD       LRPIVQADLESGKH----------------------AKIVTRFPPEPNGYLHIGHAKSIC
SYQ_PSEU5       LRPIVQADLDSGKH----------------------AKIITRFPPEPNGYLHIGHAKSIC
SYQ_PSYIN       IRNIIDSDLQSGKH----------------------QVIHTRFPPEPNGYLHIGHAKSIC
SYQ_COLP3       IRNIIDADLDSGKH----------------------TGVQTRFPPEPNGFLHIGHAKAIC
SYQ_SHEON       IRNIIDEDLKSGKH----------------------TNVQTRFPPEPNGYLHIGHAKSIC
SYQ_IDILO       IRQIIDKDLASGKH----------------------ATVHTRFPPEPNGYLHIGHAKSIV
SYQ_HAMD5       IRHIIEEDLAQGKH----------------------SFIRTRFPPEPNGYLHIGHAKSIC
SYQ_ALTMD       IRQIIDKDLSNGLH----------------------DAIKTRFPPEPNGFLHIGHAKSIC
SYQ_PSEA6       IRQIIDKDLQSGLH----------------------KQIHTRFPPEPNGYLHIGHAKSIC
SYQ_HAEDU       ITHIIDEDLASGKH----------------------NNVYTRFPPEPNGYLHIGHAKSIC
SYQ_ACTSZ       IRQIIDEDLATGKH----------------------HNVYTRFPPEPNGYLHIGHAKSIC
SYQ_PASMU       IRQIIDEDLASGKH----------------------TGVQTRFPPEPNGYLHIGHAKSIC
SYQ_HAEIN       ITQIIDEDLASGKH----------------------KSVHTRFPPEPNGYLHIGHAKSIC
SYQ_HAEI8       ITQIIDEDLASGKH----------------------KSVHTRFPPEPNGYLHIGHAKSIC
SYQ_PSEHT       IRTRIDQDLASGKH----------------------ASTHTRFPPEPNGFLHIGHAKSIC
SYQ_PHOPR       IRQIIDADLDSGKH----------------------KSVHTRFPPEPNGYLHIGHAKSIC
SYQ_ALISL       IRQIIDEDLKSGKH----------------------SSVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBF1       IRQIIDEDLKSGKH----------------------SSVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBFM       IRQIIDEDLKSGKH----------------------SSVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBCH       IRQIIDKDLADGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBCM       IRQIIDKDLADGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBC3       IRQIIDKDLADGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBTL       IRQIIDKDLADGTH----------------------SSVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBVY       IRQIIDKDLADGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBCB       IRQIIDKDLADGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_VIBPA       IRQIIDKDLADGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_TOLAT       IRQIIDEDLASGKH----------------------SSVATRFPPEPNGYLHIGHAKSIC
SYQ_SODGM       IRQIIDDDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIY
SYQ_ERWT9       IRQIIDEDLENGKH----------------------SMVHTRFPPEPNGYLHIGHAKSIC
SYQ_PHOLL       IRQIIDEDLATGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_PROMH       IRQIIDEDLATGKH----------------------NSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERE8       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPE       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPP       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPG       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPA       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPN       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPS       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPB       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERP3       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_YERPY       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_CROS8       IRQIIDEDLASGKH----------------------TTICTRFPPEPNGYLHIGHAKSIC
SYQ_ENT38       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_KLEP3       IRQIIDEDLATGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_KLEP7       IRQIIDEDLATGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SHIDS       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SHIBS       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SHIFL       IRQIIDEDLASGKH----------------------ITVHTRFPPEPNGYLHIGHAKSIC
SYQ_SHIF8       IRQIIDEDLASGKH----------------------ITVHTRFPPEPNGYLHIGHAKSIC
SYQ_SHIB3       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO7I       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO57       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO5E       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOUT       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO27       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOK1       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO45       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOL6       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOL5       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO81       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO55       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOLC       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOBW       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECODH       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOLI       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOSE       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO24       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECO8A       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOHS       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SHISS       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOSM       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ECOLU       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_ESCF3       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_CITK8       IRQIIDEDLASGKH----------------------TTIHTRFPPEPNGYLHIGHAKSIC
SYQ_SALAR       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALCH       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALTI       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALSV       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALNS       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALPB       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALA4       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALDC       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALEP       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALG2       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALHS       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALPA       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALPK       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALPC       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_SALTY       IRQIIDEDLASGKH----------------------TTVHTRFPPEPNGYLHIGHAKSIC
SYQ_PECAS       IRQIIDEDLASGKH----------------------DHIQTRFPPEPNGYLHIGHAKSIC
SYQ_PECCP       IRQIIDEDLASGKH----------------------DHIQTRFPPEPNGYLHIGHAKSIC
SYQ_EDWI9       IRQIIDEDLASGKH----------------------TSVHTRFPPEPNGYLHIGHAKSIC
SYQ_SERP5       IRQIVDEDLASGKH----------------------KSVHTRFPPEPNGYLHIGHAKSIC
SYQ_BUCBP       IQKIISEDIQNKKI----------------------THVKTRFPPEPNGYLHLGHAKSIC
SYQ_BUCAP       IYKIINEDFKKNKN----------------------LLLHTRFPPEPNGYLHIGHAKSIC
SYQ_BUCAI       ICQIINKDLNENKN----------------------LSFYTRFPPEPNGYLHIGHAKSIC
SYQ_BUCA5       ICQIINKDLNENKN----------------------LSFYTRFPPEPNGYLHIGHAKSIC
SYQ_BUCAT       ICQIINKDLNENKN----------------------LSFYTRFPPEPNGYLHIGHAKSIC
                :   :  *                                *****:*.*: *:**. :  

SYQ_DEIRA       LDFNTARQY-----GGQFNLRMDDTNPELARQEYVDSIADDLKWLGLDW---------GE
SYQ_CLOK5       LNFSLADEF-----EGKVNLRFDDTNPSKEDVEYVESIKEDVKWLGYNW----------D
SYQ_PEPD6       LNFGLAKEF-----NGKANLRFDDTNPLKEDVEYVESIKEDVKWLGFDW----------N
SYQ_CLOPS       LNFELGKEF-----NGRTNLRFDDTNPIKEDTEYVESIKEDVHWLGYNW----------S
SYQ_CLOPE       LNFELGKEF-----NGRTNLRFDDTNPTKEDTEYVESIKEDVHWLGYNW----------S
SYQ_CLOP1       LNFELGKEF-----NGRTNLRFDDTNPTKEDTEYVESIKEDVHWLGYNW----------S
SYQ_RHOBA       LNFGLAKDM-----GGTCNLRFDDTNPIKEDTEYVDSIQEDVRWLGFEW----------D
SYQ_XYLFA       LDFGVAAEF-----GGHCTLRMDDTNPSKEDPAFAAAIQDDVSWLGFHW----------N
SYQ_XYLFM       LDFGVAAEF-----GGHCTLRMDDTNPSKEDPAFAAAIQEDVSWLGFHW----------N
SYQ_XYLFT       LDFGVAAEF-----GGHCTLRMDDTNPSKEDPAFAAAIQEDVSWLGFHW----------N
SYQ_XANCP       LDFGLAAEF-----GGLCNLRLDDTNPAKEDPEFVVAIQDDVRWLGFEW----------A
SYQ_XANC8       LDFGLAAEF-----GGLCNLRLDDTNPAKEDPEFVVAIQDDVRWLGFEW----------A
SYQ_XANOR       LDFGLAAEF-----GGLCNLRLDDTNPAKEDPEFAAAIQDDVRWLGYDW----------A
SYQ_XANOM       LDFGLAAEF-----GGLCNLRLDDTNPAKEDPEFAAAIQDDVRWLGYDW----------A
SYQ_XANAC       LDFGLAAEF-----GGLCNLRLDDTNPAKEDPEFVVAIQDDVRWLGYDW----------A
SYQ_XANC5       LDFGLAAEF-----GGLCNLRLDDTNPAKEDPEFVVAIQDDVRWLGYEW----------A
SYQ_NITEU       LNFGLALEY-----GGVCHLRFDDTNPEKEAQEYVDAIIESVRWLGFDW---------KE
SYQ_BORA1       VNFGIAKEF-----GGVCHLRFDDTNPEKEDQEYVDAIIEAVRWLGFDW-----NTDGNN
SYQ_BORBR       VNFGLARDY-----GGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDW-----QADGND
SYQ_BORPA       VNFGLARDY-----GGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDW-----QADGND
SYQ_BORPE       VNFGLARDY-----GGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDW-----QADGND
SYQ_POLNS       LNFGLASDYNNQPGGARCNMRLDDTNPVKEDVEYADSILDAVKWLGFDW---------GT
SYQ_POLAQ       LNFGLAADYNNQSGGARCNMRLDDTNPVKEDVEYADSILDAVKWLGFDW---------GT
SYQ_RALPJ       VNFGMARDY-----NGRCHLRFDDTNPVKEDTEYVDSIIDAVHWLGYSW-----SDAGGE
SYQ_RALSO       VNFGLAKEY-----GGRCHLRFDDTNPVKEDTEYVDSIIDAVHWLGYSW-----QNGTGE
SYQ_CUPMC       VNFGLARDY-----AGRCHLRFDDTNPVKEDTEYVDSIIDAVHWLGFSW--DSAQAGSTP
SYQ_CUPTR       LNFGLARDY-----GGRCHLRFDDTNPVKEDTEYVESIIDAVHWLGFSWDSEGKDGQKQP
SYQ_CUPNH       LNFGLARDY-----GGRCHLRFDDTNPVKEDTEYVDSIIDAVHWLGFSWDSEGKDGTRQP
SYQ_BRADU       LNFGIAQEF-----PGRCHLRFDDTNPVKEEQEYIDSIQADVHWLGFDW---------GK
SYQ_NITHX       LNFGIAEEF-----GGCCHLRFDDTNPTKEEQEYIDAIQRDVRWLGFDW---------GK
SYQ_NITWN       LNFGIAEDF-----GGRCHLRFDDTNPAKEEQEFIDAIQRDVRWLGFDW---------GE
SYQ_CHRVO       INFGLAEDY-----NGQCNLRMDDTNPEKESDEFVEAFKQDISWLGFKW---------NG
SYQ_NEIG1       LNFGLAYIY-----DGLCNLRFDDTNPEKENDEYVNAIKEDVEWLGFHW---------AG
SYQ_NEIMA       LNFGLAYIY-----DGLCNLRFDDTNPEKENDEYVNAIKEDVEWLGFHW---------AG
SYQ_NEIMB       LNFGLAYIY-----DGLCNLRFDDTNPEKENDEYVNAIKEDVEWLGFHW---------AG
SYQ_PSEPK       VNFGLAKEF-----GGVCHLRFDDTNPAKEDQEYIDAIQSDVKWLGFEW---------GG
SYQ_PSESM       VNFGLAKEF-----GGDTHLRFDDTNPAKEDQEYIDAIMNDVKWLGFEW---------AG
SYQ_PSEAE       LNFGLAQEF-----AGDCHLRFDDTNPAKEDQEYIDAIEADIKWLGFQW---------SG
SYQ_PSEA8       LNFGLAQEF-----AGDCHLRFDDTNPAKEDQEYIDAIEADIKWLGFQW---------SG
SYQ_PSEAB       LNFGLAQEF-----AGDCHLRFDDTNPAKEDQEYIDAIEADIKWLGFQW---------SG
SYQ_PSEMY       LNFGLAEEF-----GGQCNLRFDDTNPAKEDQEYIDAIKADVEWLGFKW---------AG
SYQ_AZOVD       LNFGLAQEF-----GGECNLRFDDTNPAKEDQEYIDAIKSDVRWLGFQW---------AG
SYQ_PSEU5       LNFGLAKEF-----GGECNLRFDDTNPAKEDQEYIDAIKSDVQWLGFQW---------AG
SYQ_PSYIN       LNFGLAEDY----PNALCNLRFDDTNPVKEDADYVAAIEKDVRWLGFKW---------AG
SYQ_COLP3       LNFGIAQDY-----NGLCNLRFDDTNPEKEDIDYVHAIQKDVKWLGFEW---------AG
SYQ_SHEON       LNFGIARDY-----QGLCNLRFDDTNPEKEDIDYVNSIQADVRWLGFQW---------DG
SYQ_IDILO       LNFGIAEDY-----NGTCNLRFDDTNPLKEKVDYVNSIKKDVEWLGYHW---------EG
SYQ_HAMD5       LNFGLAQDY-----QGECHLRFDDTNPEKEEQEYIESIKRDVQWLGFAW---------SG
SYQ_ALTMD       LNFGIAEDY-----TGSCNLRFDDTNPAKEDITFVNSIKEDVTWLGFTW---------DG
SYQ_PSEA6       LNFGIAQDY-----QGQCNLRFDDTNPDKEDIDYVNAIKNDVIWLGFEW---------HG
SYQ_HAEDU       LNFGIAQEY-----HGKCNLRFDDTNPVKEDIEYVASIKQDVEWLGFKW---------QG
SYQ_ACTSZ       LNFGIAQDY-----HGKCNLRFDDTNPVKEDVEYVDSIKQDVEWLGFNW---------EG
SYQ_PASMU       LNFGIAEDY-----QGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLGFKW---------EG
SYQ_HAEIN       LNFGLAKEY-----QGLCNLRFDDTNPVKEDVEYVDSIKADVEWLGFKW---------EG
SYQ_HAEI8       LNFGLAKEY-----QGLCNLRFDDTNPVKEDVEYVDSIKADVEWLGFKW---------EG
SYQ_PSEHT       LNFGIAKDY-----NGLCNLRFDDTNPEKEDINYVNSIKEDVQWLGFNW---------DG
SYQ_PHOPR       LNFGIAQDY-----QGQCNLRFDDTNPEKEDIEYVESIKNDVNWLGFDW---------SG
SYQ_ALISL       LNFGIAQDY-----QGQCNLRFDDTNPEKEDIEYVESIKNDVKWLGFDW---------SG
SYQ_VIBF1       LNFGIAQDY-----QGQCNLRFDDTNPEKEDIEYVESIKNDVNWLGFQW---------SG
SYQ_VIBFM       LNFGIAQDY-----QGQCNLRFDDTNPEKEDIEYVESIKNDVNWLGFQW---------SG
SYQ_VIBCH       LNFGIAQDY-----QGQCNLRFDDTNPEKENLEYVESIKKDVTWLGFDW---------SG
SYQ_VIBCM       LNFGIAQDY-----QGQCNLRFDDTNPEKENLEYVESIKKDVTWLGFDW---------SG
SYQ_VIBC3       LNFGIAQDY-----QGQCNLRFDDTNPEKENLEYVESIKKDVTWLGFDW---------SG
SYQ_VIBTL       LNFGIAQDY-----QGQCNLRFDDTNPEKEDVEYVESIKNDVSWLGFEW---------SG
SYQ_VIBVY       LNFGIAQDY-----QGKCNLRFDDTNPEKEDIEYVESIKNDVSWLGFEW---------DD
SYQ_VIBCB       LNFGIAQDY-----QGQCNLRFDDTNPEKEDIEYVESIKKDVNWLGFEW---------DG
SYQ_VIBPA       LNFGIAQDY-----QGQCNLRFDDTNPEKEDIEYVESIKKDVNWLGFEW---------DG
SYQ_TOLAT       LNFGIARDY-----QGTCNLRFDDTNPVKEDVEYVESIQRDVQWLGFEW---------NG
SYQ_SODGM       LNFGIAQDY-----QGQCNLRFDDTNPVKEDMEYVDSIKHDVQWLGFNW---------SG
SYQ_ERWT9       LNFGIAQDY-----KGQCNLRFDDTNPVKEDLEFVESIKRDVQWLGFQW---------SG
SYQ_PHOLL       LNFGVAKDY-----QGQCNLRFDDTNPVKEDVEYVDSIKNDVQWLGFEW---------SG
SYQ_PROMH       LNFGIAQDY-----QGKCNLRFDDTNPVKEDVEYINSIQKDVQWLGFQW---------DG
SYQ_YERE8       LNFGIAQDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPE       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPP       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPG       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPA       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPN       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPS       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPB       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERP3       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_YERPY       LNFGIAEDY-----QGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTW---------SG
SYQ_CROS8       LNFGIAQDY-----HGQCNLRFDDTNPVKEDLEFVESIKNDVQWLGFHW---------SG
SYQ_ENT38       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVESIKNDVQWLGFNW---------SG
SYQ_KLEP3       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVESIKNDVQWLGFHW---------SG
SYQ_KLEP7       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVESIKNDVQWLGFHW---------SG
SYQ_SHIDS       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SHIBS       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_SHIFL       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SHIF8       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SHIB3       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECO7I       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECO57       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECO5E       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECOUT       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECO27       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECOK1       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECO45       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECOL6       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECOL5       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECO81       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_ECO55       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECOLC       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECOBW       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECODH       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECOLI       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECOSE       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECO24       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECO8A       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECOHS       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_SHISS       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECOSM       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ECOLU       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_ESCF3       LNFGIAQDY-----KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHW---------SG
SYQ_CITK8       LNFGIAQDY-----QGLCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------AG
SYQ_SALAR       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALCH       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALTI       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALSV       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALNS       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALPB       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALA4       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALDC       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALEP       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALG2       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALHS       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALPA       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALPK       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALPC       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_SALTY       LNFGIAQDY-----QGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHW---------SG
SYQ_PECAS       LNFGIARDY-----QGQCNLRFDDTNPVKEDIEYVESIKRDVEWLGFSW---------SG
SYQ_PECCP       LNFGIARDY-----QGQCNLRFDDTNPVKEDIEYVESIKRDVEWLGFSW---------SG
SYQ_EDWI9       LNFGIARDY-----QGLCNLRFDDTNPVKEDIEYVESIKRDVQWLGFEW---------SG
SYQ_SERP5       LNFGIARDY-----QGQCNLRFDDTNPVKEDIEFVESIKHDVEWLGFEW---------SG
SYQ_BUCBP       LNFDLAQEF-----KGTCNLRFDDTNPKNEDTCYINSIIQDIKWLEYKW---------HN
SYQ_BUCAP       LNFELANVY-----NGYCNLRFDDTNPVKENIKYINSIKNDIKWLGYQW---------HK
SYQ_BUCAI       LNFELASLY-----KGRCNLRFDDTNPLKENIKYIESIKHDINWLGYKW---------HG
SYQ_BUCA5       LNFELASLY-----KGRCNLRFDDTNPLKENIKYIKSIKYDINWLGYKW---------HG
SYQ_BUCAT       LNFELASLY-----KGRCNLRFDDTNPLKENIKYIKSIKHDINWLGYKW---------HG
                ::*  .         .   :*:*****      :  ::   : **   *           

SYQ_DEIRA       HFYYASDYFDRYYAYAEQLIRQGDAYVESVSPEELSRLRGNATTPGTPSPYRDRSVEENL
SYQ_CLOK5       NLCFASSYFERMYEYAVFLIKKGKAYVCDLTADEIREYRGTLTKPGKESPYRNRDVEENF
SYQ_PEPD6       ELNFASNYFDEMYKRALILIKKGKAYVCDLTQEEMREYRGTLTEPGKESPHRNRTIEENL
SYQ_CLOPS       ELHFASNYFDEMYKRALLLIKKGKAYVCDLTPEEIKEYRGTLTEPGKESPYRNRSVEENL
SYQ_CLOPE       ELHFASNYFDEMYKRALLLIKKGKAYVCDLTPEEIKEYRGTLTEPGKESPYRNRSIEENL
SYQ_CLOP1       ELHFASNYFDEMYKRALLLIKKGKAYVCDLTPEEIKEYRGTLTEPGKESPYRNRSVEENL
SYQ_RHOBA       NLHFASDYFDQLYDWAEQLVKDGKAYVCDLTAEETREYRGTLTEPGKNSPHRDRTPEKNL
SYQ_XYLFA       ALRHTSDYFEVLYLAAEKLITDGKAYVCDLNSEQVREYRGTLTEAGRPSPWRERSPDENL
SYQ_XYLFM       ALRHTSDYFEVLYLAAEKLIADGKAYVCDLNSEQVREYRGTLTEAGRPSPWRERSPDENL
SYQ_XYLFT       ALRHTSDYFEVLYLAAEKLIADGKAYVCDLNSQQVREYRGTLTEAGRPSPWRERSPDENL
SYQ_XANCP       QLRHASDYFEVYYLAAEKLIRDGHAFVCDLSAEQVRQYRGTLTEPGRNSPFRERSVDENL
SYQ_XANC8       QLRHASDYFEVYYLAAEKLIRDGHAFVCDLSAEQVRQYRGTLTEPGRNSPFRERSVDENL
SYQ_XANOR       QLRHASDYFEVYYLAAQKLIRDGHAFVCDLSAEQVRQYRGTLTEPGRHSPFRERSVEENL
SYQ_XANOM       QLRHASDYFEVYYLAAQKLIRDGHAFVCDLSAEQVRQYRGTLTEPGRHSPFRERSVEENL
SYQ_XANAC       QLRHASDYFQVYYLAAQKLIRDGHAFVCDLSAEQVRQYRGTLTEPGRNSPFRERSVEENL
SYQ_XANC5       QLRHASDYFQVYYLAAQKLIRDGHAFVCDLSAEQVRQYRGTLTEPGRNSPFRERSVEENL
SYQ_NITEU       HLYYASDYFDQLYEFAEYLITQGKAYVDSLSADEIRRLRGTLTEAGTNSPYRDRSAEENL
SYQ_BORA1       NLYFASDYFEFMYEFAEALIEAGHAFVDEQSADDIRAQRGTLTEPGRNSPFRDRPAAESL
SYQ_BORBR       NLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESL
SYQ_BORPA       NLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESL
SYQ_BORPE       NLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESL
SYQ_POLNS       HLYHASDYFDRLYEFAEILIQSGKAYVDSQSADDIHTNRGNFGQAGKNSPFRDRTPEENL
SYQ_POLAQ       HLYHASDYFDRLYEFAEILIQNSKAYVDSQSADDIHTNRGNFGQVGKNSPYRERTPDENL
SYQ_RALPJ       HLYYASDYFEQLYGFAEVLIQRGVAYVDSQSAEQIAANRGDFTRPGTLSPFRDRSVDENL
SYQ_RALSO       HLYYASDYFEQLYGFAEVLIQRGAAYIDSQSAEQIAANRGDFTRPGTPSPFRDRSVEENL
SYQ_CUPMC       HLYFASDYFDQLYKFAETLIERGVAYVDSQSAEQIAAMRGNFSEPGKPSPFRDRSVEENL
SYQ_CUPTR       HLYYASDYFDQLYAFAETLIERGAAYVDSQSAEQIAASRGNFSEPGKPSPFRDRSVEENL
SYQ_CUPNH       HLYYASDYFDQLYAFAETLIERGAAYIDSQTAEQIAASRGNFSEPGKPSPYRERSVEENL
SYQ_BRADU       NLFFASDYFDRLYEWAETLIRDGLAYVDDQTQEEIRTSRGTLTEPGKNSPFRDRSVDENL
SYQ_NITHX       NLHYASDYFEQLYAWAQHLVRAGKAYVDDQSQEDIRLARGTLTEPGRDSPFRDRPVDENL
SYQ_NITWN       HLYYASDYFEQLYAWAQHLIREGKAYVDDQTQEEIRLARGTLTEPGRNSPFRDRPADENL
SYQ_CHRVO       EVRYASDYFDRLYDYAVELIQAGKAYVDDLSAEEMRQYRGNLTEPGKNSPYRDRTPEENL
SYQ_NEIG1       EPRFASDYFDRLYDYAVGLIKDGKAYVDDLTPEEMREYRGTLTEAGKNSPYRDRSIEENL
SYQ_NEIMA       EPRFASNYFDQLYDYAVGLIKDGKAYVDDLTPEEMREYRGTLTEAGKNSPYRDRSVEENL
SYQ_NEIMB       EPRFASNYFDQLYDYAVGLIKDGKAYVDDLTPEEMREYRGTLTEAGKNSPYRDRSVEENL
SYQ_PSEPK       DVRYASDYFDQLHDWAVELIKRGKAYVCDLTPEQAKEYRGNLKEPGKNSPFRERSVEENL
SYQ_PSESM       EVRYASQYFDQLHDWAVELIKAGKAYVDDLTPEQAREYRGTLTEPGKNSPFRERSVEENI
SYQ_PSEAE       EVCYASNYFDQLHAWAVELIKAGKAFVCDLGPEEMREYRGTLTEPGRNSPYRDRSVEENL
SYQ_PSEA8       EVCYASNYFDQLHAWAIELIKAGKAFVCDLGPEEMREYRGTLTEPGRNSPYRDRSVEENL
SYQ_PSEAB       EVCYASNYFDQLHAWAIELIKAGKAFVCDLGPEEMREYRGTLTEPGRNSPYRDRSVEENL
SYQ_PSEMY       EERYASDYFDQLHAWAVELIKAGKAFVCDLNAEEMRTYRGSLTEPGKNSPFRDRSVEENL
SYQ_AZOVD       EERYASSYFDQLYDWAIHLIEAGKAYVCDLSPDEAREYRGSLTEPGRNSPYRERSVEENL
SYQ_PSEU5       EERYASDYFDQLHDWAVHLIKAGKAYVCDLTPEQAREYRGSLTEPGTNSPFRERSVEENL
SYQ_PSYIN       DIHYSSDYFEQLYDFAIELIKKDKAYVCALDAQQTREYRGSLMTVGKDSPFRNRPISESL
SYQ_COLP3       EIHYSSNYFDQLHGFAVELIEKGLAYVCFLNAEETREYRGTLNKPGKNSPYRDTSVEENL
SYQ_SHEON       EVRYSSNYFDQLHQYAVELINKGLAYVCFLNADETREYRGTLKEPGKNSPYRDTPVEENL
SYQ_IDILO       EPRYSSNYFDQLHGFAVELIEKGLAYVDFSSQDKMREMRGTLKEPGVNSPYRDTSVEENL
SYQ_HAMD5       AVRYSSDYFESLYGYAIELIQKELAYVDELNAEQMREYRGTLTAPGKNSPFRDRTVEDNI
SYQ_ALTMD       EARYSSNYFDQLHAYAVELIEKGLAYVDFSAQDVMREMRGTLKEPGQNSPYRDTDVETNL
SYQ_PSEA6       EARYSSNYFDQLHAYAVELIEKGLAYVDFSNQEQVREMRGTLTTPGTNSPYRDTSIEENI
SYQ_HAEDU       EPRYASDYFDQLHGYAIELIEKGLAYVDELSPEEMREYRGTLTEAGKNSPYRDRSIAENL
SYQ_ACTSZ       EPRYASDYFDQLYGYAVELIEKGLAYVDELSPEEMREYRGTLTEAGKNSPYRERSVAENL
SYQ_PASMU       EPRYASDYFDQLYGYAIELIEKGLAYVDELSPEEMREYRGTLTEPGKNSPYRDRSIEENL
SYQ_HAEIN       EPRYASDYFDALYGYAVELIKKGLAYVDELSPDEMREYRGTLTEPGKNSPYRDRTIEENL
SYQ_HAEI8       EPRYASDYFDALYGYAAELIKKGLAYVDELSPDEMREYRGTLTEPGKNSPYRDRTIEENL
SYQ_PSEHT       EIKYSSNYFDILYDYAVELINKGLAYVCFLTADQAREYRGTLKEPGKNSPYRDTASDENL
SYQ_PHOPR       EICYSSNYFDKLYGFAVELINKGLAYVDELSPEQMREYRGNLTEPGKPSPYRDRSVAENL
SYQ_ALISL       DIHYSSNYFDKLYDYAVELIEKGLAYVDELTSDQIREYRGSLKEPGKNSPYRDRSVEENL
SYQ_VIBF1       DIQYSSNYFDKLYGYAVELIEKGLAYVDELTPEQMREYRGSLKEPGKNSPYRDRSVEENL
SYQ_VIBFM       DIQYSSNYFDKLYGYAVELIEKGLAYVDELTPEQMREYRGSLKEPGKNSPYRDRSVEENL
SYQ_VIBCH       EVCYSSDYFDKLYEYAIELIQKGLAYVDELTPEQIREYRGTLTEPGKHSPYRDRSVEENL
SYQ_VIBCM       EVCYSSDYFDKLYEYAIELIQKGLAYVDELTPEQIREYRGTLTEPGKHSPYRDRSVEENL
SYQ_VIBC3       EVCYSSDYFDKLYEYAIELIQKGLAYVDELTPEQIREYRGTLTEPGKHSPYRDRSVEENL
SYQ_VIBTL       DICYSSNYFDTLYAYAVELINKGLAYVDELSPDQIREYRGTLKEPGKASPYRDRSPEENL
SYQ_VIBVY       EICYSSNYFDKLYEYAVELINKGLAYVDELSPEQIREYRGTLTAPGKPSPYRDRSAEENL
SYQ_VIBCB       EVCYSSNYFDKLYEYAIELINKGLAYVDELSPEQIREYRGTLTAPGKPSPYRDRPIEENL
SYQ_VIBPA       EVCYSSNYFDKLYEYAIELINKGLAYVDELSPEQIREYRGTLKEPGKPSPYRDRSVEENL
SYQ_TOLAT       AVRYSSDYFDQLHAYAIELINKGLAYVEELTAEQIREYRGTLTQAGKNSPFRDRSVEENL
SYQ_SODGM       DIHYSSDYFDKLHDYALELIDKGLAYVDQLSPDQIRDYRGTLTRPGKNSPYRDRSVEENR
SYQ_ERWT9       EVRYSSDYFEQLHNYAVELIGKGLAYVDELSPEQIREYRGSLTSAGKNSPYRDRSVAENL
SYQ_PHOLL       DIRYSSNYFDTLYQYAIELINKGLAYVDQLSPEEIREYRGTLKEPGKNSPYRDRTIEENL
SYQ_PROMH       NVHYSSDYFDQLYQYAIELINKGLAYVDELSAEEIREYRGTLKEPGKNSPYRSRSVEENL
SYQ_YERE8       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPE       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPP       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPG       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPA       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPN       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPS       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPB       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERP3       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_YERPY       DVRYSSDYFDQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENL
SYQ_CROS8       DVRYSSDYFDQLYNYAVELINKGLAYVDELSPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_ENT38       DICYSSDYFDQLFAYAVELINKGLAYVDELSADEIREYRGSLTAPGKNSPYRDRSVEENL
SYQ_KLEP3       DVCYSSDYFDQLHQYAVELINKGLAYVDELSPDEIREYRGTLKAPGKNSPYRDRSVEENL
SYQ_KLEP7       DVCYSSDYFDQLHQYAVELINKGLAYVDELSPDEIREYRGTLKAPGKNSPYRDRSVEENL
SYQ_SHIDS       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTKPGKNSPYRDRSVEENL
SYQ_SHIBS       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_SHIFL       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_SHIF8       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_SHIB3       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO7I       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO57       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO5E       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOUT       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO27       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOK1       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO45       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOL6       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOL5       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO81       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO55       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOLC       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOBW       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECODH       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOLI       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOSE       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO24       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECO8A       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOHS       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_SHISS       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOSM       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ECOLU       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_ESCF3       NVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENL
SYQ_CITK8       NVCYSSDYFDQLHAYAVELITKGLAYVDELTPDQIREYRGTLKEPGKNSPFRDRSVEENL
SYQ_SALAR       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALCH       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALTI       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALSV       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALNS       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALPB       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALA4       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALDC       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALEP       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALG2       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALHS       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALPA       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALPK       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALPC       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_SALTY       DIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENL
SYQ_PECAS       DVRYSSDYFDQLHAYAVELIGKGLAYVDELTPEQIREYRGTLTAPGKNSPYRDRTVQENL
SYQ_PECCP       DVRYSSDYFDQLHAYAVELIGKGLAYVDELTPEQIREYRGTLTAPGKNSPYRDRTVQENL
SYQ_EDWI9       AVRYSSDYFDQLHQYALELIGKGLAYVDELSAEQIREYRGTLTSPGKNSPFRDRSVEENL
SYQ_SERP5       NVRYSSDYFDQLHNYAVELINKGLAYVDELSPEQIREYRGSLTAPGKDSPYRGRSVEENL
SYQ_BUCBP       KIRYASLYFNKIYQYAIKLIKKGLAYVDQLSPEEIRTFRGTLTTSGIDSPYRTQSIEKNL
SYQ_BUCAP       KVRYSSEYFPILYEYAKELIQKGLAYVDELTKEEIREYRGTLSTVGKNSPYRNRSITENL
SYQ_BUCAI       NVRYASEYFLKLYQYAQELIKKGLAYVDHLTKEQIREYRGTLNTPGKNSPYRNRTIQENI
SYQ_BUCA5       NVRYASEYFLKLYQYAQELIKKGLAYVDHLTKEQIREYRGTLNTPGKNSPYRNRTIQENI
SYQ_BUCAT       NVRYASEYFLKLYQYAQELIKKGLAYVDHLTKEQIREYRGTLNTPGKNSPYRNRTIQENI
                   .:* **   .  *  *:    *::     :     **     *  ** *      . 

SYQ_DEIRA       DLLRRMKAGEFADGEHVLRAKIDLTAPNMKLRDPVLYRIVNKPHFRTSDEWHIYPAYDFE
SYQ_CLOK5       KLFEGMKNGEFKDGEKVLRAKIDMASPNINMRDPVLYRIAHASHHNTGDRWCIYPMYDFA
SYQ_PEPD6       DLFERMKNGEFKDGEKTLRAKIDMSSPNINLRDPIIYRISHSTHHNTGDKWCIYPMYAFA
SYQ_CLOPS       DLFERMRKGEFEDGSKVLRAKIDMSSPNINFRDPIIYRIAHASHHNTGDKWCIYPMYDFA
SYQ_CLOPE       DLFERMRKGEFEDGSKVLRAKIDMSSPNINFRDPIIYRIAHASHHNTGDKWCIYPMYDFA
SYQ_CLOP1       DLFERMRKGEFEDGSKVLRAKIDMSSPNINFRDPIIYRIAHASHHNTGDKWCIYPMYDFA
SYQ_RHOBA       ELLRAMKAGKFKDGEKTLRAKIDMASPNINLRDPVMYRIAHVPHHRTGDKWCIYPMYDWA
SYQ_XYLFA       ELFRQMRAGTFPDGTRTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNTWPIYPMYDFA
SYQ_XYLFM       ELFRQMRAGTFPDGTRTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNTWPIYPMYDFA
SYQ_XYLFT       ELFRQMRAGTFPDGTRTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNTWPIYPMYDFA
SYQ_XANCP       DLFRRMRAGEFPDGARTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNAWPIYPMYDFA
SYQ_XANC8       DLFRRMRAGEFPDGARTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNAWPIYPMYDFA
SYQ_XANOR       DLFQRMRAGEFPDGARTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNAWPIYPMYDFA
SYQ_XANOM       DLFQRMRAGEFPDGARTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNAWPIYPMYDFA
SYQ_XANAC       DLFARMRAGEFPDGARTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNAWPIYPMYDFA
SYQ_XANC5       ELFARMRAGEFPDGARTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNAWPIYPMYDFA
SYQ_NITEU       DLFRRMRAGEFPDGVHVLRARIDMASPNINLRDPVIYRIRHIHHQRTGDKWCIYPMYDYT
SYQ_BORA1       TRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHAAHHRTGDKWCIYPMYSWA
SYQ_BORBR       LRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWA
SYQ_BORPA       LRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWA
SYQ_BORPE       LRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWA
SYQ_POLNS       QLFRDMRDGKFKDGEHVLRLKIDMAHPNIVMRDPVVYRIRHTDHHRTGSKWCIYPLYDFT
SYQ_POLAQ       QLFREMRDGKFKDGEHVLRLKIDMAHPNIVMRDPVVYRIRHTDHHRTGSKWCIYPLYDFT
SYQ_RALPJ       ALFRDMRAGKYKDGEHVLRAKIDMAAPNIVMRDPVLYRIRHAHHHRTGDAWCIYPMYDFT
SYQ_RALSO       ALFRDMRAGKYQDGQHVLRARIDMAAPNIVMRDPVLYRIRHAHHHRTGDAWCIYPMYDFT
SYQ_CUPMC       KLFREMRDGKYADGEHVLRAKIDMTAPNIVMRDPVLYRIRHAHHHRTGDKWCIYPMYDFT
SYQ_CUPTR       QLFRDMRAGKYADGEHVLRAKIDMAAPNIVMRDPVLYRIRHAHHHRTGDKWCIYPMYDFT
SYQ_CUPNH       QLFRDMRAGKYADGEHVLRAKIDMTAPNIVMRDPVLYRIRHAHHHRTGDKWCIYPMYDFT
SYQ_BRADU       DLFRRMKAGEFPNGARVLRAKIDMAAGNINLRDPVLYRILHAHHPRTGNAWCIYPSYDYA
SYQ_NITHX       DLFARMRAGEFPNGARVLRARIDMASGNINLRDPVLYRILHAPHPRTGTAWNIYPSYDFA
SYQ_NITWN       DLFARMRAGEFPNGARVLRAKIDMAAGNINLRDPVLYRILHATHPRTGNVWSIYPSYDFA
SYQ_CHRVO       DLFTRMKNGEFPDGSKTLRLKIDMASGNINLRDPAIYRIRRVHHHRTGDKWCIYPMYDYT
SYQ_NEIG1       DLFTRMKNGEFPDGSKTLRLKIDMAAGNINMRDPVIYRIRRAHHHNTGDKWCIYPMYDYT
SYQ_NEIMA       DLFTRMKNGEFPDGSKTLRLKIDMASGNINMRDPVIYRIRRAHHHNTGDKWCIYPMYDYT
SYQ_NEIMB       DLFTRMKNGEFPDGSKTLRLKIDMASGNINMRDPVIYRIRRAHHHNTGDKWCIYPMYDYT
SYQ_PSEPK       DLFARMKAGEFKDGERVLRAKIDMASPNMNLRDPILYRIRHAHHHQTGDKWCIYPNYDFT
SYQ_PSESM       DLFARMKAGEFEDGARVLRAKIDMASPNMNLRDPILYRIRHAHHHQTGDKWCIYPIYDFT
SYQ_PSEAE       DLFARMKAGEFPDGARSLRAKIDMGSPNMNLRDPILYRIRHAHHHQTGDKWCIYPSYDFT
SYQ_PSEA8       DLFARMKAGEFPDGARSLRAKIDMGSPNMNLRDPILYRIRHAHHHQTGDKWCIYPSYDFT
SYQ_PSEAB       DLFARMKAGEFPDGARSLRAKIDMGSPNMNLRDPILYRIRHAHHHQTGDKWCIYPSYDFT
SYQ_PSEMY       DLFARMKAGEFPDGARSLRAKIDMASPNINLRDPILYRIRHAHHHQTGDKWCIYPSYDFT
SYQ_AZOVD       DLFARMRAGEFPDGARALRAKIDMAAPNMNLRDPILYRIRHAHHHQTGDKWCIYPSYDFT
SYQ_PSEU5       DLFARMKAGEFPDGARALRAKIDMASPNMNLRDPILYRIRHAHHHQTGDKWCIYPSYDFT
SYQ_PSYIN       DLFARMRAGEFAEGSMMLRAKIDMASPNMKMRDPVLYRIRFAHHHQTGDKWCIYPMYDFT
SYQ_COLP3       ALFAKMKNGEFEEGICALRAKIDMTSSFMCLRDPIIYRVRFAHHHQTGDKWCIYPMYDFT
SYQ_SHEON       RLFGKMRLGEFKEGECALRAKIDMASPFMCMRDPVIYRIRFAHHHQTGDKWCIYPMYDFT
SYQ_IDILO       KHFADMTAGKHEEGTAALRAKIDMSSPFMCMRDPVIYRVRFVHHHQTGDKWCVYPMYDFT
SYQ_HAMD5       ELFKKMRAGGFAEGAACLRAKIDMASPFMIMRDPVLYRIKFAEHHQLGDQWCIYPMYDFT
SYQ_ALTMD       KEFAKMTAGDYKEGECSLRAKIDMTSPFMCMRDPVIYRVKHAHHHQTGDKWCVYPMYDFT
SYQ_PSEA6       AQFAKMRNGEYKEGECLLRAKIDMSSPFMCMRDPALYRVKFAHHHQTGDKWCIYPMYDFT
SYQ_HAEDU       ALFEKMKNGEFKEGTACLRAKIDMASPFIVMRDPVLYRVKFAHHHQTGDKWCIYPMYDFT
SYQ_ACTSZ       ALFEKMRNGEFAEGKACLRAKIDMASPFMVMRDPVIYRVKFASHHQTGDKWCIYPMYDFT
SYQ_PASMU       ALFEKMKNGEIAEGKACLRAKIDMASPFIVMRDPVIYRIKFATHHQTGDKWCIYPMYDFT
SYQ_HAEIN       ALFEKMKNGEFAEGKASLRAKIDMASPFMVMREPVIYRIKFSSHHQTGDKWCIYPMYDFT
SYQ_HAEI8       ALFEKMKNGEFAEGKASLRAKIDMASPFMVMRDPVIYRIKFASHHQTGDKWCIYPMYDFT
SYQ_PSEHT       ALFEKMRNGEFKEGECVLRAKIDMASSFMVLRDPIIYRVRFAHHHQTADKWCIYPMYDFT
SYQ_PHOPR       ELFEKMKNGEVEEGIMSLRAKIDMASSFMVLRDPVIYRVRFATHHQTGDKWCIYPMYDFT
SYQ_ALISL       ALFEQMRDGKFKEGTICLRAKIDMASSFIVMRDPVIYRIRFATHHQTGDKWCIYPMYDFT
SYQ_VIBF1       ALFEQMRDGKFKEGTICLRAKIDMASSFIVLRDPVIYRVRFATHHQTGDKWCIYPMYDFT
SYQ_VIBFM       ALFEQMRDGKFKEGTICLRAKIDMASSFIVLRDPVIYRVRFATHHQTGDKWCIYPMYDFT
SYQ_VIBCH       ALFEKMRAGEFAEGQACLRAKIDMASSFIVMRDPVLYRVRFAEHHQTGDKWCIYPMYDFT
SYQ_VIBCM       ALFEKMRAGEFAEGQACLRAKIDMASSFIVMRDPVLYRVRFAEHHQTGDKWCIYPMYDFT
SYQ_VIBC3       ALFEKMRAGEFAEGQACLRAKIDMASSFIVMRDPVLYRVRFAEHHQTGDKWCIYPMYDFT
SYQ_VIBTL       ALFEKMRDGGFEEGKACLRAKIDMSSSFMVMRDPVIYRVRFAHHHQTADKWCIYPMYDFT
SYQ_VIBVY       ALFEKMRDGGFEEGKACLRAKIDMASSFMVMRDPVLYRVRFASHHQTGDKWCIYPMYDFT
SYQ_VIBCB       ALFEKMRAGEFEEGKACLRAKIDMGSSFMVMRDPVIYRVRFATHHQTGDKWCIYPMYDFT
SYQ_VIBPA       ALFEKMRAGEFEEGKACLRAKIDMGSSFMVMRDPVLYRVRFATHHQTGDKWCIYPMYDFT
SYQ_TOLAT       ALFEKMKDGGFKEGEACLRAKIDMASSFMVMRDPVIYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SODGM       ALFASMRQGEFAEGSACLRAKIDMASPFMVMRDPVLYRIKFADHHQTGSKWCIYPMYDFT
SYQ_ERWT9       ELFAKMRNGEFAEGTACLRAKIDMASNFIVLRDPVIYRIKFADHHQTGNRWCIYPMYDFT
SYQ_PHOLL       VLFEKMRAGEFDEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQCGNKWCIYPMYDFT
SYQ_PROMH       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_YERE8       ALFEKMRAGGFAEGTACLRAKIDMASPFMVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPE       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPP       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPG       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPA       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPN       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPS       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPB       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERP3       ALFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_YERPY       VLFEKMRAGGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFT
SYQ_CROS8       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ENT38       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_KLEP3       ALFEKMRSGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_KLEP7       ALFEKMRSGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SHIDS       PLFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SHIBS       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SHIFL       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SHIF8       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SHIB3       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO7I       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO57       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO5E       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOUT       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO27       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOK1       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO45       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOL6       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOL5       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO81       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO55       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOLC       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOBW       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECODH       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOLI       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOSE       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO24       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECO8A       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOHS       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SHISS       ALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOSM       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ECOLU       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_ESCF3       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_CITK8       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALAR       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGTKWCIYPMYDFT
SYQ_SALCH       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALTI       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGTKWCIYPMYDFT
SYQ_SALSV       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGTKWCIYPMYDFT
SYQ_SALNS       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALPB       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALA4       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALDC       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALEP       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALG2       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALHS       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALPA       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALPK       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALPC       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SALTY       ALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_PECAS       ALFEKMRNGGFAEGTACLRAKIDMASSFIVMRDPVLYRIKFADHHQTGNKWCIYPMYDFT
SYQ_PECCP       ALFEKMRNGGFAEGTACLRAKIDMASSFIVMRDPVLYRIKFADHHQTGNKWCIYPMYDFT
SYQ_EDWI9       ALFEKMRLGEFAEGSACLRARIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_SERP5       ALFEKMRNGEFAEGTACLRAKIDMASSFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFT
SYQ_BUCBP       NLFKKMKQGKMLEGTACLRAKIDMASNCITMRDPVLYRIIFSKHHQTNKKWCIYPTYDFT
SYQ_BUCAP       KLFEKMKKGEFKEGEACLRAKINMSSSFIVMRDPVLYRIIFSTHHQTKKKWCIYPTYDFA
SYQ_BUCAI       ELFEKMKKGDFSEGEACLRAKINMSSSSIIMRDPVLYRIIFIKHHQTQNKWCIYPMYDFA
SYQ_BUCA5       ELFEKMKKGDFSEGEACLRAKINMSSSSIIMRDPVLYRIIFIKHHQTQNKWCIYPMYDFA
SYQ_BUCAT       ELFEKMKKGDFSEGEACLRAKINMSSSSIIMRDPVLYRIIFIKHHQTQNKWCIYPMYDFA
                  :  *  *   :*   ** .*::    : :*:* :**:    * .    * :** * : 

SYQ_DEIRA       HPLQDAIEGVTHSMCSLEFVDNRAIYDWLMEKL------NF--DP--R--------PHQY
SYQ_CLOK5       HPLEDAIEGVTHSICTLEFEDHRPLYDWIIQEC------EI--EN----------RPKQI
SYQ_PEPD6       HPIEDAIEGITHSICTLEFEDQRPLYDWFVKEC------EM--EN----------IPRQI
SYQ_CLOPS       HPLEDAIEGITHSICTLEFADHRPLYDWFVKEC------EM--EN----------IPRQI
SYQ_CLOPE       HPLEDAIEGITHSICTLEFADHRPLYDWFVKEC------EM--ES----------VPRQI
SYQ_CLOP1       HPLEDAIEGITHSICTLEFADHRPLYDWFVKEC------EM--ES----------VPRQI
SYQ_RHOBA       HGQSDSLEKITFSICTLEFEHHRPLYNWYCENL------GI-------------HHPRQI
SYQ_XYLFA       HALSDAIEGITHSLCTLEFEDHRPLYDWCVNHVDLPNNSHLLKPLLDKGFPQEPSQPRQI
SYQ_XYLFM       HALSDAIEGITHSLCTLEFEDHRPLYDWCINHVDLPNNSHLLKPLLDKGFPQEPSQPRQI
SYQ_XYLFT       HALSDAIEGITHSLCTLEFEDHRPLYDWCINHVDLPNNSHLLKPLLDKGFPQEPSQPRQI
SYQ_XANCP       HSLGDAVEGITHSLCTLEFEDHRPLYDWCVDKVDLSGHPELLAPLLGKGYPKEAAKPRQI
SYQ_XANC8       HSLGDAVEGITHSLCTLEFEDHRPLYDWCVDKVDLSGHPELLAPLLGKGYPKEAAKPRQI
SYQ_XANOR       HSLGDAVEGITHSLCTLEFEDHRPLYDWCVDKVDLVGHPELLQPLLDKGLPREAAKPRQI
SYQ_XANOM       HSLGDAVEGITHSLCTLEFEDHRPLYDWCVDKVDLVGHPELLQPLLDKGLPREAAKPRQI
SYQ_XANAC       HSLGDAVEGITHSLCTLEFEDHRPLYDWCVDKVDLVGHPELLQPLLDKGLPREAAKPRQI
SYQ_XANC5       HSLGDAVEGITHSLCTLEFEDHRPLYDWCVDKVDLAGHPELLQPLLDKGLPREAAKPRQI
SYQ_NITEU       HCISDALERITHSLCTLEFEDHRPLYDWVLDQL------AEKIPC----------HPQQI
SYQ_BORA1       HPVEDALEGITHSICTLEFEDQRPFYDWILARLADLGKLAR--PL-----------PRQY
SYQ_BORBR       HPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLAR--PL-----------PHQY
SYQ_BORPA       HPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLAR--PL-----------PHQY
SYQ_BORPE       HPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLAR--PL-----------PHQY
SYQ_POLNS       HCISDALENISHSICTLEFENNRPLYDWIVNSLKELGVFKD--PV-----------PHQH
SYQ_POLAQ       HCISDALENVSHSICTLEFENNRPLYDWIVNSLKELGVFKD--PV-----------PHQY
SYQ_RALPJ       HCISDALENITHSLCTLEFENNRPLYDWVLDHLRDAGVLAA--PL-----------PHQY
SYQ_RALSO       HCISDALENITHSLCTLEFENNRPLYDWVLDHLRDAGALPA--PL-----------PHQY
SYQ_CUPMC       HCISDAIENITHSLCTLEFENNRPLYDWVLEHLRDAGVFAN--PL-----------PHQY
SYQ_CUPTR       HCISDALENITHSLCTLEFENNRPLYDWVLEHLRDSGVFRD--PL-----------PHQY
SYQ_CUPNH       HCISDALENITHSLCTLEFENNRPLYDWVLEHLRDSGVFRD--PL-----------PHQY
SYQ_BRADU       HGQSDAIEGITHSICTLEFEDHRPLYDWFIEKL------PV--PS----------KPHQY
SYQ_NITHX       HGQSDSIEHITHSICTLEFEDHRPLYDWFLDNL------PV--PS----------RPHQY
SYQ_NITWN       HGQSDSIEHITHSVCTLEFEDHRPLYDWFLDNL------PV--PS----------RPRQY
SYQ_CHRVO       HCISDAIEGITHSLCSLEFEDHRPLYDWVLDNI------SI--EH----------HPQQI
SYQ_NEIG1       HCISDAIEGITHSLCTLEFEAHRPLYDWVLDNI-----PAL--HA--T-------RPRQY
SYQ_NEIMA       HCISDAIEGITHSLCTLEFEAHRPLYDWVLDNI------HA--PHATR--------PRQY
SYQ_NEIMB       HCISDAIEGITHSLCTLEFEAHRPLYDCVLDNI------PA--PHATR--------PRQY
SYQ_PSEPK       HGQSDAIEGITHSICTLEFEGHRPLYDWFLDNL------PV--PA----------HPRQY
SYQ_PSESM       HGQSDAIEGITHSICTLEFESHRPLYDWFLDNL------PV--PC----------KPRQY
SYQ_PSEAE       HGQSDAIEGITHSICTLEFEDHRPLYEWFLANL------PV--PA----------QPRQY
SYQ_PSEA8       HGQSDAIEGITHSICTLEFEDHRPLYEWFLANL------PV--PA----------QPRQY
SYQ_PSEAB       HGQSDAIEGITHSICTLEFEDHRPLYEWFLANL------PV--PA----------QPRQY
SYQ_PSEMY       HGQSDAIEGITHSICTLEFEDHRPLYEWFLENL------PV--PA----------QPRQY
SYQ_AZOVD       HGQSDAIEGITHSICTLEFEDHRPLYEWFLDNL------PV--PC----------RPRQY
SYQ_PSEU5       HGQSDAIEGITHSICTLEFEDHRPLYEWFLANL------PV--PA----------QPRQY
SYQ_PSYIN       HCISDALEGITHSLCTLEFEDHRPLYDWVLANI------SI--AC----------KPRQI
SYQ_COLP3       HCLSDALEGITHSICTLEFQDNRRLYDWVIEQV------SV--PS----------TPHQY
SYQ_SHEON       HCISDALEHITHSLCTLEFQDNRRLYDWVLDNL---DDFQA--PN----------RTRQY
SYQ_IDILO       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPQQI
SYQ_HAMD5       HCISDALEGITHSLCTLEFQDNRRLYDWVLENI------SI--DC----------HPRQY
SYQ_ALTMD       HCISDAIEGITHSLCTLEFQDNRRLYDWVIENI------SI--DC----------TPRQY
SYQ_PSEA6       HCISDAIEGITHSLCTLEFQDNRRLYDWVLENV------TI--DV----------VPRQY
SYQ_HAEDU       HCISDAIERITHSLCTLEFQDNRRLYDWVLENI------SIERPL-----------PHQY
SYQ_ACTSZ       HCISDAIERITHSLCTLEFQDNRRLYDWVLEHI------SIERPL-----------PHQY
SYQ_PASMU       HCISDAIERITHSLCTLEFQDNRRLYDWVLENI------SIARPL-----------PHQY
SYQ_HAEIN       HCISDAIERITHSICTLEFQDNRRLYDWVLENI------SIERPL-----------PHQY
SYQ_HAEI8       HCISDAIERITHSICTLEFQDNRRLYDWVLENI------SIERPL-----------PHQY
SYQ_PSEHT       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SL--EC----------HPQQI
SYQ_PHOPR       HCISDALEGITHSICTLEFQDNRRLYDWVLDNI------TI--DC----------QPRQY
SYQ_ALISL       HCISDALEGITHSICTLEFQDNRRLYDWVLENI------TI--DC----------QPHQY
SYQ_VIBF1       HCISDALEGITHSICTLEFQDNRRLYDWVLENI------TI--DC----------QPRQY
SYQ_VIBFM       HCISDALEGITHSICTLEFQDNRRLYDWVLENI------TI--DC----------QPRQY
SYQ_VIBCH       HCISDALEGITHSICTLEFQDNRRLYDWVLDNI------TI--PC----------HPRQY
SYQ_VIBCM       HCISDALEGITHSICTLEFQDNRRLYDWVLDNI------TI--PC----------HPRQY
SYQ_VIBC3       HCISDALEGITHSICTLEFQDNRRLYDWVLDNI------TI--PC----------HPRQY
SYQ_VIBTL       HCISDALEGITHSICTLEFQDNRRLYDWVLDNI------TI--DC----------QPRQY
SYQ_VIBVY       HCISDALEGITHSICTLEFMDNRRLYDWVLDNI------TI--DC----------RPHQY
SYQ_VIBCB       HCISDALEGITHSICTLEFMDNRRLYDWVLDNI------TI--DC----------RPHQY
SYQ_VIBPA       HCISDALEGITHSICTLEFMDNRRLYDWVLDNI------TI--DC----------RPHQY
SYQ_TOLAT       HCISDALEGITHSICTLEFQDNRRLYDWVLDNI------SI--PC----------HPRQY
SYQ_SODGM       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--NV----------HPRQY
SYQ_ERWT9       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_PHOLL       HCISDALEGITHSLCTLEFQDNRRLYDWVLENI------TI--DC----------RPRQY
SYQ_PROMH       HCISDALENITHSLCTLEFQDNRRLYDWVLDNI------TI--PC----------HPRQY
SYQ_YERE8       HCISDAIEGITHSLCTLEFQDNRRLYDWVLDNI------SI--EC----------HPRQY
SYQ_YERPE       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERPP       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERPG       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERPA       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERPN       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERPS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERPB       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERP3       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_YERPY       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--DC----------HPRQY
SYQ_CROS8       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ENT38       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_KLEP3       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--PV----------HPRQY
SYQ_KLEP7       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--PV----------HPRQY
SYQ_SHIDS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SHIBS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SHIFL       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SHIF8       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SHIB3       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--SV----------HPRQY
SYQ_ECO7I       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO57       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO5E       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOUT       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO27       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOK1       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO45       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOL6       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOL5       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO81       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO55       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOLC       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOBW       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECODH       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOLI       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOSE       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO24       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECO8A       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOHS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SHISS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOSM       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ECOLU       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_ESCF3       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_CITK8       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALAR       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALCH       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALTI       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALSV       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALNS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALPB       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALA4       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALDC       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALEP       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALG2       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALHS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALPA       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALPK       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALPC       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_SALTY       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PV----------HPRQY
SYQ_PECAS       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--PC----------HPRQY
SYQ_PECCP       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PC----------HPRQY
SYQ_EDWI9       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------SI--PC----------HPRQY
SYQ_SERP5       HCISDALEGITHSLCTLEFQDNRRLYDWVLDNI------TI--PC----------HPRQY
SYQ_BUCBP       HCISDALEKITHSLCTLEFQDHRKLYEWILKKI------DI--SC----------NTHQY
SYQ_BUCAP       HCLSDSIEGITHSFCTLEFQDNKNLYNWILKNT------SI--KH----------YSKQY
SYQ_BUCAI       HCLSDSIEGITHSLCTLEFQDNKFLYNWILKNT------SV--KH----------YPKQY
SYQ_BUCA5       HCLSDSIEGITHSLCTLEFQDNKFLYNWILKNT------SV--KH----------YPKQY
SYQ_BUCAT       HCLSDSIEGITHSLCTLEFQDNKFLYNWILKNT------SV--KH----------YPKQY
                *   *::* ::.*.*:***  :. :*:                             ..* 

SYQ_DEIRA       EFGRRGLEYTITSKRKLRELVQAGRVSGWDDPRMPTLRAQRRLGVTPEAVRAFAAQIGVS
SYQ_CLOK5       EFARLNMTNTVMSKRKLKQLVDENFVDGWDDPRMPTIAGLRRRGFTPESIRNFCRAIGVS
SYQ_PEPD6       EFARLNINNTVMSKRKLKQLVDEGIVDGWDDPRVPTISGIRRKGYTAEALRNFCSEIGVS
SYQ_CLOPS       EFARLNITNTVMSKRKLKQLVDEGIVDGWDDPRMPTVAGLRRRGYTPKSIRNFCKAIGVA
SYQ_CLOPE       EFARLNITNTVMSKRKLKQLVDEGIVDGWDDPRMPTVAGLRRRGYTPKSIRNFCKAIGVA
SYQ_CLOP1       EFARLNITNTVMSKRKLKQLVDEGIVDGWDDPRMPTVAGLRRRGYTPKSIRNFCKAIGVA
SYQ_RHOBA       EFARLNMTFTVMSKRKLLQLVKENHVTGWDDPRMPTLVGLRRRGYTPESIRSFCADIGVA
SYQ_XYLFA       EFSRLNINYTVMSKRKLTALVDEKLVEGWDDPRMYTLQGLRRRGYTPAAMRLFVERIGIS
SYQ_XYLFM       EFSRLNINYTVMSKRKLTALVDEKLVEGWDDPRMYTLQGLRRRGYTPAAMRLFVERIGIS
SYQ_XYLFT       EFSRLNINYTVMSKRKLTALVDEKLVEGWDDPRMYTLQGLRRRGYTPAAMRLFVERIGIS
SYQ_XANCP       EFSRLNINYTVMSKRKLTALVEEQLVDGWDDPRMYTLQGLRRRGYTPAAMRLFVDRVGIS
SYQ_XANC8       EFSRLNINYTVMSKRKLTALVEEQLVDGWDDPRMYTLQGLRRRGYTPAAMRLFVDRVGIS
SYQ_XANOR       EFSRLNINYTVMSKRKLTALVEEQLVDGWDDPRMYTLQGLRRRGYTPAAMRLFVERVGIS
SYQ_XANOM       EFSRLNINYTVMSKRKLTALVEEQLVDGWDDPRMYTLQGLRRRGYTPAAMRLFVERVGIS
SYQ_XANAC       EFSRLNINYTVMSKRKLTALVEEQLVDGWDDPRMYTLQGLRRRGYTPAAMRLFVDRVGIS
SYQ_XANC5       EFSRLNINYTVMSKRKLTALVEEQLVDGWDDPRMYTLQGLRRRGYTPAAMRLFVDRVGIS
SYQ_NITEU       EFARLNLTYSVMSKRKLIDLVENKLVDGWNDPRMNTLAGLRRRGYTPESIRLFAERIGIS
SYQ_BORA1       EFSRLNMSYIVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTASAIRLFCDRTAVS
SYQ_BORBR       EFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVS
SYQ_BORPA       EFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVS
SYQ_BORPE       EFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVS
SYQ_POLNS       EFARLNLTYTITSKRKLLQLVEEKHVEGWDDPRMPTIVGIRRRGYTPESIRLFCERIGVS
SYQ_POLAQ       EFARLNLTYTITSKRKLLQLVEEQHVEGWDDPRMPTIVGIRRRGYTPESIRLFCERIGVS
SYQ_RALPJ       EFARLHLTYAITSKRKLLQLVTEKRVDGWDDPRMPTLVGIRRRGYTPESIQLFCERVGVS
SYQ_RALSO       EFARLHLTYAITSKRKLLQLVNEKRVDGWDDPRMPTLVGIRRRGYTPESIQLFCERVGVS
SYQ_CUPMC       EFARLNLTYAITSKRRLKQLVDEQRVTGWDDPRMPTIVGIRRRGYTPESIQLFCDRVGVS
SYQ_CUPTR       EFARLNLTYAITSKRKLKQLVDEQRVDGWDDPRMPTLVGVRRRGYTPESIQLFCDRVGVA
SYQ_CUPNH       EFARLNLTYAITSKRKLKQLVDEQRVDGWDDPRMPTLVGVRRRGYTPESIQLFCDRVGVA
SYQ_BRADU       EFARLNLTYTLLSKRVLTQLVREGHVAGWDDPRMPTMAGMRRRGVPPAALREFVKRIGVA
SYQ_NITHX       EFARLNVTHTLLSKRILTELVRGGHVAGWDDPRMPTLAGLQRRGVPAEALREFIKRIGVA
SYQ_NITWN       EFARLNVTHTLLSKRVLTELVRGGHVAGWDDPRMPTLAGLQRRGVPAEALREFVKRIGVA
SYQ_CHRVO       EFSRLELLYALTSKRKLQALVNDGAVTGWDDPRMPTIAGMRRRGYSPAGIKLFAQRIGVS
SYQ_NEIG1       EFSRLELLYTITSKRKLNQLVVEKHVSGWDDPRMPTISGMRRRGYTPEGVRLFAKRAGIS
SYQ_NEIMA       EFSRLELLYTITSKRKLNQLVVEKHVSGWDDPRMPTISGMRRRGYTPEGLRLFAKRAGIS
SYQ_NEIMB       EFSRLELLYTITSKRKLNQLVVEKHVSGWDDPRMPTISGMRRRGYTPEGLRLFAKRAGIS
SYQ_PSEPK       EFSRLNLNYTITSKRKLKQLVDEKHVDAWDDPRMSTLSGFRRRGYTPASIRNFCEMIGTN
SYQ_PSESM       EFSRLNLNYTITSKRKLKQLVDEKHVNGWDDPRMSTLSGFRRRGYTPKSIRNFCEMIGTN
SYQ_PSEAE       EFSRLNLNYTVTSKRKLKQLVDEGHVSGWDDPRMSTLSGYRRRGYTPESIRNFCEMIGVN
SYQ_PSEA8       EFSRLNLNYTVTSKRKLKQLVDEGHVSGWDDPRMSTLSGYRRRGYTPESIRNFCEMIGVN
SYQ_PSEAB       EFSRLNLNYTVTSKRKLKQLVDEGHVSGWDDPRMSTLSGYRRRGYTPESIRNFCEMIGVN
SYQ_PSEMY       EFARLNLNYTITSKRKLKQLVDEGHVQGWDDPRMSTLSGYRRRGYTPASIRAFCDMIGVN
SYQ_AZOVD       EFARLNLNYTITSKRKLKQLVDEGHVGGWDDPRMSTLSGYRRRGYTPASIRAFCDMIGVN
SYQ_PSEU5       EFARLNLNYTITSKRKLKQLVDEKHVSGWDDPRMSTLSGFRRRGYTPASIRNFCDMIGVN
SYQ_PSYIN       EFSRLNLQYTLTSKRKLHTLIEEKIISAWDDPRMPTISGMRRRGYPAASIREFCKRIGVT
SYQ_COLP3       EFSRLNLEYTLMSKRKLNTLVEEKLVDSWDDPRMPTIAAFRRRGYTPASMREFAKRIGVT
SYQ_SHEON       EFSRLNLEYTLMSKRKLNDLVTRKLVTGWDDPRMPTIAGLRRRGYTPASIREFCQRIGIT
SYQ_IDILO       EFSRLNLQYTVMSKRIINTLVDENKVSGWDDPRIASIAGLRRRGYTPDSVREFCRRIGVT
SYQ_HAMD5       EFSRLNLEHTLMSKRKLHLLVKEKKVTGWDDPRMPTLSGLKRRGYTPASIREFCHRIGVT
SYQ_ALTMD       EFSRLNLEYTVLSKRRLIQLVEENHVSGWDDPRMPTIAGLRRRGYTPGSIVEFCKRIGVT
SYQ_PSEA6       EFSRLNLEYTVLSKRKLIQLVDEEFVSGWDDPRMPTIAGLRRRGFTAASIREFCKRIGVT
SYQ_HAEDU       EFSRLNLEGTLTSKRKLLQLVTDGIVDGWNDPRMPTISGLRRRGYTPASLREFCRRIGVT
SYQ_ACTSZ       EFSRLNLEGTLTSKRKLLKLVEEGAVDGWDDPRMPTISGLRRRGYTPASLREFCRRIGVT
SYQ_PASMU       EFSRLNLESTLTSKRKLLQLVNEGIVDGWNDPRMPTISGLRRRGYTPASLREFCRRIGVT
SYQ_HAEIN       EFSRLNLEGTLTSKRKLLKLVNDEIVDGWNDPRMPTISGLRRRGYTPASLREFCRRIGVT
SYQ_HAEI8       EFSRLNLEGTLTSKRKLLKLVNDEIVDGWNDPRMPTISGLRRRGYTPASLREFCRRIGVT
SYQ_PSEHT       EFSRLNLEYTIMSKRKLSDLVVNNHVEGWDDPRMPTIAGLRRRGYTPASIREFCLRIGVT
SYQ_PHOPR       EFSRLNLEYTVMSKRKLNQLVTDNLVSGWDDPRMPTVSGLRRRGFTSASIREFCKRIGVT
SYQ_ALISL       EFSRLNLEYTIMSKRKLNELVTEKLVNGWDDPRMPTVSGLRRRGFTAGSIREFCKRIGVT
SYQ_VIBF1       EFSRLNLEYTVMSKRKLNQLVTEKLVNGWDDPRMPTVSGLRRRGFTSASIREFCKRIGVT
SYQ_VIBFM       EFSRLNLEYTVMSKRKLNQLVTEKLVNGWDDPRMPTVSGLRRRGFTSASIREFCKRIGVT
SYQ_VIBCH       EFSRLNLEYTVMSKRKLNQLVTEKLVTGWDDPRMPTISGLRRRGFTPSAIREFCKRIGVT
SYQ_VIBCM       EFSRLNLEYTVMSKRKLNQLVTEKLVTGWDDPRMPTISGLRRRGFTPSAIREFCKRIGVT
SYQ_VIBC3       EFSRLNLEYTVMSKRKLNQLVTEKLVTGWDDPRMPTISGLRRRGFTPSAIREFCKRIGVT
SYQ_VIBTL       EFSRLNLEYTVMSKRKLNQLVVENLVEGWDDPRMPTISGLRRRGFTSSSIREFCKRIGVT
SYQ_VIBVY       EFSRLNLEYTVMSKRKLNQLVTEKLVNGWDDPRMPTISGLRRRGFTPASIREFCKRIGVT
SYQ_VIBCB       EFSRLNLEYTVMSKRKLNQLVTEKLVDGWDDPRMPTVSGLRRRGFTSASIREFCKRIGVT
SYQ_VIBPA       EFSRLNLEYTVMSKRKLNQLVTEKLVNGWDDPRMPTVSGLRRRGFTPASIREFCKRIGVT
SYQ_TOLAT       EFSRLNLEYAIMSKRKLNQLVTEGVVEGWDDPRMPTVSGLRRRGYTPEAVREFCNRIGVT
SYQ_SODGM       EFSRLNLEYAIMSKRKLNLLVTEKIVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_ERWT9       EFSRLNLEYAIMSKRKLNLLVTEKVVEGWDDPRMLTVSGLRRRGYSAGSIREFCRRIGVT
SYQ_PHOLL       EFSRLNLEYTVMSKRKLNLLVADKIVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_PROMH       EFSRLNLEYTVMSKRKLNQLVTENIVDGWDDPRMPTISGLRRRGYTAESIREFCQRIGVT
SYQ_YERE8       EFSRLNLEYSIMSKRKLNLLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPE       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPP       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPG       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPA       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPN       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPS       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPB       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERP3       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_YERPY       EFSRLNLEYTIMSKRKLNQLVTEKVVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVT
SYQ_CROS8       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ENT38       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYSASSIREFIKRIGVT
SYQ_KLEP3       EFSRLNLEYTVMSKRKLNQLVTEKHVEGWDDPRMPTISGLRRRGYTAESIREFCKRIGVT
SYQ_KLEP7       EFSRLNLEYTVMSKRKLNQLVTEKHVEGWDDPRMPTISGLRRRGYTAESIREFCKRIGVT
SYQ_SHIDS       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SHIBS       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SHIFL       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SHIF8       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SHIB3       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO7I       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO57       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO5E       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOUT       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO27       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOK1       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO45       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOL6       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOL5       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO81       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO55       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOLC       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOBW       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECODH       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOLI       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOSE       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO24       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECO8A       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOHS       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SHISS       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOSM       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ECOLU       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_ESCF3       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_CITK8       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALAR       EFSRLNLEYTVMSKRKLNLLVTDNHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALCH       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALTI       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALSV       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALNS       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALPB       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALA4       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALDC       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALEP       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALG2       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALHS       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALPA       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALPK       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALPC       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_SALTY       EFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVT
SYQ_PECAS       EFSRLNLEYAIMSKRKLNQLVVENVVEGWDDPRMPTISGLRRRGYSASSIREFCVRIGVT
SYQ_PECCP       EFSRLNLEYAIMSKRKLNQLVVENVVEGWDDPRMPTISGLRRRGYSASSIREFCVRIGVT
SYQ_EDWI9       EFSRLNLEYAIMSKRKLNLLVSEKIVEGWDDPRMPTISGLRRRGYSAAAVREFCRRIGVT
SYQ_SERP5       EFSRLNLEYAIMSKRKLNLLVTEKIVEGWDDPRMPTVSGLRRRGYTAASIREFCQRIGVT
SYQ_BUCBP       EFSRLKLEYSVLSKRKLNLLVNNKVVNGWDDPRMPTLSGLRNRGYTPSSIKLFCKKIGIT
SYQ_BUCAP       EFSRLNLEYSILSKRKISILIEKKIVNGWDDPRILTISGLRKKGYTASSIRDFCHRIGIT
SYQ_BUCAI       EFSRLNLEFSILSKRKIKILIDKNIIEGWDDPRIPTLSALRRKGYTPSSIKNFCQKIGVT
SYQ_BUCA5       EFSRLNLEFSILSKRKIKILIDKNIIEGWDDPRIPTLSALRRKGYTPSSIKNFCQKIGVT
SYQ_BUCAT       EFSRLNLEFSILSKRKIKILIDKNIIEGWDDPRIPTLSALRRKGYTPSSIKNFCQKIGVT
                **.*  :   : *** :  *:    : .*:***: :: . .. * .. .:  *    .  

SYQ_DEIRA       RTNRTVDIAVYENAVRDDLNHRAPRVMAVLDPVKVTLTNL-DGE-KTLSLPYWPHDVVRD
SYQ_CLOK5       KASSIVDSQMLDYFLRDDLEKEAPRTMAILNPLKVVITNYPEGKTETFKIENNPDD----
SYQ_PEPD6       KVNSTVDSQMLDYFLRENLQPKAPLTMGVLRPLKLIITNYPEDKIEMLEIENNAKD----
SYQ_CLOPS       KADSTVDYQMLEHFIREDLQETAPRAMAVINPLKLVITNYPEGKSEILEIENNPKD----
SYQ_CLOPE       KADSTVDSQMLEHFIREDLQETAPRAMAVINPLKLVITNYPEGESEILEIENNPKD----
SYQ_CLOP1       KADSTVDSQMLEHFIREDLQETAPRAMAVINPLKLVITNYPEGESEILEIENNPKD----
SYQ_RHOBA       KFNSTIDVIRLENSVREHLNSVAPRRMAVLDPIKLTITNWPEGKVEMMNAINNPED----
SYQ_XYLFA       KQNSIIDFSVLENCLRENLDTIAPRRMATIAPLKLVLTNLPEDHEEQLIFPNHPKD----
SYQ_XYLFM       KQNSIIDFSVLENCLRENLDTIAPRRMATIAPMKLVLTNLPEDHEEQLIFPNHPKD----
SYQ_XYLFT       KQNSIIDFSVLENCLRENLDTIAPRRMATIAPMKLVLTNLAEDHEEQLIFPNHPKD----
SYQ_XANCP       KQNSVIDFSVLEGCLREDLDAAAARRMAVIDPLKLVLTNLPEGHTETLQFSNHPKD----
SYQ_XANC8       KQNSVIDFSVLEGCLREDLDAAAARRMAVIDPLKLVLTNLPEGHTETLQFSNHPKD----
SYQ_XANOR       KQNSLIDFSVLEGCLREDLDAAAARRMAVIDPLKLVLTNLPEGHTETLQFSNHPKD----
SYQ_XANOM       KQNSLIDFSVLEGCLREDLDAAAARRMAVIDPLKLVLTNLPEGHTETLQFSNHPKD----
SYQ_XANAC       KQNSLIDFSVLEGCLREDLDAAAPRRMAVIDPLKLVLTNLPEGHTETLQFSNHPKD----
SYQ_XANC5       KQNSLIDFSVLEGCLREDLDAAAPRRMAVIDPLKLVLTNLPEGHTETLQFSNHPKD----
SYQ_NITEU       KADSWIDMTILEDCLREDLNERALRRIAVLDPVSLIIDNFPDGHEETCYAPNHPQK----
SYQ_BORA1       KSDSRIDYSLLEQAVRDDLDPGTTRSVAVLDPLKLVITNYPKDQTEVCKAPRNPHD----
SYQ_BORBR       KSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHD----
SYQ_BORPA       KSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNHPEGRSETCSAPRNPHD----
SYQ_BORPE       KSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHD----
SYQ_POLNS       KADSWIDMSTLDQALRDDLEVRAPRATAVLKPLKLVVENFDAPTKEACSAPRHPNY----
SYQ_POLAQ       KADSWIDMSTLDQALRDDLEARAPRATAVLKPLKLVVENFDAAHSEACSAPRHPHH----
SYQ_RALPJ       KADSWIDMSILEGAVRDDLDARAPRSVAVLDPVKLVLDNVPADFNEPCSAPVHPKQ----
SYQ_RALSO       KADSWIDMSILEAAVRDDLDARAPRSVAVLDPVKLILDNVPADFNEPCSAPVHPKQ----
SYQ_CUPMC       KADSWIDMSTLEGAVRDDLDARAPRSVAVLDPLKLILDNYPEGQSEECSAPVHPKQ----
SYQ_CUPTR       KADSWIDMSTLEGSVRDDLDGRAARGVAVLDPLKLIIDNYPEGQSEECSAPVHPKK----
SYQ_CUPNH       KADSWIDMSTLEGAVRDDLDGRAARGVAVLDPLKLIIDNYPEGQSEECSAPVHPKK----
SYQ_BRADU       KANSVVDVGMLEFCIREELNRTAQRRMAVLKPLKVVIENYPEGQTEELEAINHPDD----
SYQ_NITHX       KANSTVDVGMLDFAIRETLNKSAPRRMAVLRPLKIVIENYPEGESEELEAVNHPDD----
SYQ_NITWN       KANSTVDVGMLDFAIREALNRSASRRMAVLRPLKVVIENYPEGQSEELEAVNHPDD----
SYQ_CHRVO       KSENIIDMAILEGAVRETLENDSPRVMAVVNPLKVTLTNYDAAVTASRSAPFHPHH----
SYQ_NEIG1       KSENIVDMSVLEGAIREELENSAPRLMAVLNPLKVTLTNFQAGKTQSRRAAFHPNH----
SYQ_NEIMA       KSENIVDMSVLEGAIREELENSAPRLMAVLNPLKVTLTNFEAGRTQSRRAAFHPNH----
SYQ_NEIMB       KSENIVDMSVLEGAIREELENSAPRLMAVLNPLKVTLTNFETGRTQSRRAAFHPNH----
SYQ_PSEPK       RSDGVVDMSMLEFSIRDDLDRTAPRAMCVLRPLKVVITNYPEGQVEQLELPRHPKE----
SYQ_PSESM       RSDGVVDFGMLEFSIRDDLDHSAPRAMCVLRPLKVVITNYPEGQVEKLELPRHPKE----
SYQ_PSEAE       RASGVVDIGMLEFSIRDHLDATAPRAMCVLKPLKVVITNYPEGQVENLELPRHPKE----
SYQ_PSEA8       RASGVVDIGMLEFSIRDHLDATAPRAMCVLKPLKVVITNYPEGQVENLELPRHPKE----
SYQ_PSEAB       RASGVVDIGMLEFSIRDHLDATAPRAMCVLKPLKVVITNYPEGQVENLELPRHPKE----
SYQ_PSEMY       RAGGVVDIGMLEFAIREDLDANAARAMCVLKPLKVVITNYPEGKVENLELPRHPKQ----
SYQ_AZOVD       RAGGVVDIGMLEFAIREDLDANAARAMCVLKPLKVVITNYPQGRVESLELPRHPKQ----
SYQ_PSEU5       RAGGVVDIGMLEFAIREDLDANAARAMCVLKPLKVVITNYPQDQVENLELPRHPKQ----
SYQ_PSYIN       KQENTVELASLEACVRENLEANAPRAMAVIDPVKVIISNYDENKTEKLIAAIHPKD----
SYQ_COLP3       KMENTIEMSVLEACIREDLNDNAPRAMAVLDPIKLVIENYPEDKNEDLIVKNHPSD----
SYQ_SHEON       KQENMIEAAMLDACIREELNEHAPRAMAVLRPLKVVIENYPEGQIETIQAASHPSD----
SYQ_IDILO       KMDNQVEMSMLEACIRDDLNVNAPRAMAVMDPVKIVIENYPEGEQELLDAPNHPND----
SYQ_HAMD5       KQDNQVEMSALEACIREDLNQNAPRALAVLDPVQLIIDNR-SDEKEWLTVPNHPNN----
SYQ_ALTMD       KMDNMVEMSMLEACIRDDLNANAPRAMAVLDPIKLVIENYEEGKTETLVAPNHPND----
SYQ_PSEA6       KMDNMVEMSMLEAPLRDELNENAPRAMAVLEPVKIVIENYPQDGVELLAAPNHPNR----
SYQ_HAEDU       KQDNVVEYAALEACIREDLNENAPRAMAVINPVRVVIENV--AEPEILKAPNHPNR----
SYQ_ACTSZ       KQDNVVEFSALESCIRDDLNINAPRAMAVINPLKVIIENF--ETPETLTMPNHPNR----
SYQ_PASMU       KQDNMVEFSALEACIREDLNENAPRAMAVINPLKIVIENF-SGK-EMLTAPNHPNR----
SYQ_HAEIN       KQDNVVEYSALEACIREDLNENAPRAMAVIDPVRVVIENF--ESEAVLTAPNHPNR----
SYQ_HAEI8       KQDNVVEYSALEACIREDLNENAPRAMAVIDPVRVVIENF-ESE-AVLTAPNHPNR----
SYQ_PSEHT       KQENMVEMGMLEACIREDLNENAPRAMAVLDPVKIVIENYDADKVETLSVANHPNK----
SYQ_PHOPR       KQENTIEMSSLESCIRDDLNENAPRAMAVLDPVKIVIENF-TGDTEVLTVSNHPNN----
SYQ_ALISL       KQENMIEFGSLESCIRDDLNENAPRAMAVLEPVKVVIENYEEGKVETLNVANHPNK----
SYQ_VIBF1       KQENMIEFSSLESCIRDDLNESAPRAMAVLEPVKLVIENYEEGKVETLNIANHPNK----
SYQ_VIBFM       KQENMIEFSSLESCIRDDLNESAPRAMAVLEPVKLVIENYEEGKVETLNIANHPNK----
SYQ_VIBCH       KQENMIEYSALESCIRDDLNENAPRAMAVLDPVKLVIENFAAGTVETLTLANHPNK----
SYQ_VIBCM       KQENMIEYSALESCIRDDLNENAPRAMAVLDPVKLVIENFAAGTVETLTLANHPNK----
SYQ_VIBC3       KQENMIEYSALESCIRDDLNENAPRAMAVLDPVKLVIENFAAGTVETLTLANHPNK----
SYQ_VIBTL       KQENMIEFGSLESCIRDDLNENAPRAMAVLDPIKVVIENYDADTVETLTVANHPNK----
SYQ_VIBVY       KQENMIEFSSLESCIRDDLNENAPRAMAVLDPVKLVIENFPAGEVENLTVANHPNK----
SYQ_VIBCB       KQENMIEFGSLESCIRDDLNENAPRAMAVLDPVKIVIENFEEGAVETLTVANHPNK----
SYQ_VIBPA       KQENMIEFSSLESCIRDDLNENAPRAMAVLDPVKVVIENFEVGAVENLTLANHPNK----
SYQ_TOLAT       KQDNTVEMSALESCIREDLNERAPRAMAVLDPLRVVLENYPEDLVEELNIPNHPNI----
SYQ_SODGM       KQDNNVEMAALEACIREDLNDRAPRAMAVIDPVRVVIESLPMGYEQDIAMPNHPNR----
SYQ_ERWT9       KQDNIVEMAALESCIRDDLNENAPRAMAVLDAVKVVIENLPAHHEQTICMPNHPNR----
SYQ_PHOLL       KQDNNVEMAALESCIRDDLNENAPRAMAVLDPVRLVIENMPEGE-QILSMPNHPNK----
SYQ_PROMH       KQDNNVEMASLEACIRDDLNENAPRAMAVIDPVRLVIENMPEGE-EILTAPNHPNK----
SYQ_YERE8       KQDNNVEMMALESCIRDDLNENAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPE       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPP       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPG       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPA       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPN       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPS       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPB       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERP3       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_YERPY       KQDNNVEMMSLESCIRDDLNEHAPRAMAVLDPIKVVIENRAAGE-EWLTMPNHPNN----
SYQ_CROS8       KQDNTVEMAALEACIREDLNENAPRAMAVIDPVKLVIENYPQGHSEMVSMPNHPNK----
SYQ_ENT38       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESELVTMPNHPSK----
SYQ_KLEP3       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVAMPNHPNK----
SYQ_KLEP7       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVVMPNHPNK----
SYQ_SHIDS       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_SHIBS       RQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_SHIFL       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_SHIF8       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_SHIB3       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO7I       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO57       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO5E       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOUT       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO27       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOK1       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO45       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOL6       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOL5       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO81       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO55       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOLC       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOBW       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECODH       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOLI       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOSE       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO24       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECO8A       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOHS       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_SHISS       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOSM       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ECOLU       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_ESCF3       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENY-QGEGEMVTMPNHPNK----
SYQ_CITK8       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALAR       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALCH       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALTI       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALSV       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALNS       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALPB       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALA4       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALDC       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALEP       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALG2       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALHS       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALPA       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALPK       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALPC       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_SALTY       KQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQGESEMVTMPNHPNK----
SYQ_PECAS       KQDNNVEMAALESCIRDDLNENAPRAMAVLDPVKVVIENLPAGHEEFVAMPNHPNK----
SYQ_PECCP       KQDNNVEMAALESCIRDDLNENAPRAMAVLDPVKVVIENLPAGHEEFVAMPNHPNK----
SYQ_EDWI9       KQDNNVEMAALESCIRDDLNENAPRAMAVLDPVRLVIDNLAADSVQLLTMPNHPSK----
SYQ_SERP5       KQDNNVEMMALEACIREELNENAPRAMAVLDPVKVVIENLTTGV-EMVTMPNHPSK----
SYQ_BUCBP       KQENTIQLSFLESCIRSDLNPIAPRYMAVIHPIKIQICNLSDNYEEILNIPNHPTK----
SYQ_BUCAP       KQNNLIEFSMLEYCIRKELNKKAIRTMAVLEPIKIFLYNIDNDHEEKLIVPNHPKH----
SYQ_BUCAI       KQNNLIEFSMLEHCIRKELNQTAIRTMAILDPIKIFLYNLDSNYKEEFIVPNHPNN----
SYQ_BUCA5       KQNNLIEFSMLEHCIRKELNQTAIRTMAILDPIKIFLYNLDSNYKEEFIVPNHPNN----
SYQ_BUCAT       KQNNLIEFSMLEHCIRKELNQTAIRTMAILDPIKIFLYNLDSNYKEEFIVPNHPNN----
                .    ::    :  :*. *:  :      : .: : : .             ..      

SYQ_DEIRA       SPDGLVGMPGGGRVAPEEAVRDVPLTRELYIERDDFSPAPPKGFKRLT------PGGTVR
SYQ_CLOK5       ---------------ASAGVREVPFSREIYIEQEDFMENPPKKYYRLF------PGNEVR
SYQ_PEPD6       ---------------ESQGKRLVPFSRELYIEQDDFMEEPVKKYFRFF------PGNEVR
SYQ_CLOPS       ---------------ESAGKRAVTFSREIYIEREDFMENPPKKYFRLF------PGNEVR
SYQ_CLOPE       ---------------ESAGKRAVTFSREVYIEREDFMENPPKKYFRLF------PGNEVR
SYQ_CLOP1       ---------------ESAGKRAVTFSREVYIEREDFMENPPKKYFRLF------PGNEVR
SYQ_RHOBA       ---------------ESAGSREIPFSGELYIETEDFREEAPRKFFRLK------KGGSVR
SYQ_XYLFA       ---------------DTQGTRTMPFSRELWIERDDFSEIPPKGWKRLV------PGGEVR
SYQ_XYLFM       ---------------DTQGTRTVPFSRELWIERDDFSEVPPKGWKRLV------PGGEVR
SYQ_XYLFT       ---------------DTQGTRTVPFSRELWIERDDFSEAPPKGWKRLI------PGGEVR
SYQ_XANCP       ---------------ESFGTREVPFARELWIEREDFAEVPPKGWKRLV------PGGEIR
SYQ_XANC8       ---------------ESFGTREVPFARELWIEREDFAEVPPKGWKRLV------PGGEIR
SYQ_XANOR       ---------------ESFGTREVPFARVLWIEREDFAEVPPKGWKRLV------PGGEIR
SYQ_XANOM       ---------------ESFGTREVPFARVLWIEREDFAEVPPKGWKRLV------PGGEIR
SYQ_XANAC       ---------------DSFGTREVPFARELWIEREDFAEVPPKGWKRLV------PGGEIR
SYQ_XANC5       ---------------ESFGTREVPFARELWIEREDFAEVPPKGWKRLV------PGGEIR
SYQ_NITEU       ---------------PELGTRELRLTKQLYIDREDFMEIPNKGFFRLA------PGAEVR
SYQ_BORA1       ---------------PEAGQREFPFSRELWIERDDFREEAPKKYFRLF------PGNLVR
SYQ_BORBR       ---------------PQAGVREFPFTRELWIEQDDFREEPPKKYFRLF------PGNTVR
SYQ_BORPA       ---------------PQAGVREFPFTRELWIEQDDFREEPPKKYFRLF------PGNTVR
SYQ_BORPE       ---------------PQAGVREFPFTRELWIEQDDFREEPPKKYFRLF------PGNTVR
SYQ_POLNS       ---------------PEWGNREFNFTRELWIEADDFMQEPIKGFFRLYPPIDDQPGSRVR
SYQ_POLAQ       ---------------PEWGNREFNFTKELWIEADDFMQEPVKGFFRLYPPIGDQPGSRVR
SYQ_RALPJ       ---------------PELGRREFPLTRELWIEREDFTETPPKGYFRLF------PGNKVR
SYQ_RALSO       ---------------PELGRREFPLTRELWIEREDFTETPPKGYFRLF------PGNKVR
SYQ_CUPMC       ---------------PEMGRRVFPLSRELWIEREDFNENPPKGYFRLF------PGNKVR
SYQ_CUPTR       ---------------PELGKRVFPLSRELWIEREDFNETPPKGYFRLF------PGNKVR
SYQ_CUPNH       ---------------PELGKRVFPLSRELWIEREDFNETPPKGYFRLF------PGNKVR
SYQ_BRADU       ---------------PSAGTRKITFGRELYIEQDDFMENPPKKFFRLS------PGNEVR
SYQ_NITHX       ---------------PSRGTRRIRFGRELYIEQDDFMENPPKKFFRLS------PGREVR
SYQ_NITWN       ---------------PSQGTRRIRFGREIYIEQEDFMENPPKKFFRLS------PGREVR
SYQ_CHRVO       ---------------PEFGERDVPIAREIWIERDDFAETPPPKWQRLT------AGGEVR
SYQ_NEIG1       ---------------EEMGDREVPVSQTIYIEADDFAENPPKGFKRLI------PGGEVR
SYQ_NEIMA       ---------------EEMGEREVPISQTIYIEADDFAENPPKGFKRLI------PGGEVR
SYQ_NEIMB       ---------------EEMGEREVPISQTIYIEADDFAENPPKGFKRLI------PGGEVR
SYQ_PSEPK       ----------------DMGVRVLPFSRELYIDRDDFMEEPPKGYKRLE------PAGEVR
SYQ_PSESM       ----------------DLGMRELPFSREIYIDRDDYMEEPPKGYKRLE------PNGEVR
SYQ_PSEAE       ----------------DMGVRVLPFGRELFIDAGDFEEVPPAGYKRLI------PGGEVR
SYQ_PSEA8       ----------------DMGVRVLPFGRELFIDAGDFEEVPPAGYKRLI------PGGEVR
SYQ_PSEAB       ----------------DMGVRVLPFGRELFIDAGDFEEVPPAGYKRLI------PGGEVR
SYQ_PSEMY       ----------------DMGVRVLPFSREIYIDASDFEETPPDGFKRLI------PGGEVR
SYQ_AZOVD       ----------------DMGVRVLPFSREIYIDAGDFEETPPAGYKRLI------PGGEVR
SYQ_PSEU5       ----------------DMGVRVLPFSREIYIDAGDFEEVPPAGFKRLV------PGGEVR
SYQ_PSYIN       ---------------ESMGTRTVTFSREIFIDRADFREEANKKYKRLV------LGKEVR
SYQ_COLP3       ---------------DEQGTRIVPFSKELYIEAEDFREEANKKYKRLV------IDKAVR
SYQ_SHEON       ---------------ESMGTRELAFGREIFIDVADFREEANKQYKRLV------MGKEVR
SYQ_IDILO       ---------------PEMGSRQVTFSREIWIEREDFRESANKKFKRLV------LDKEVR
SYQ_HAMD5       ---------------PGMGHRQMPFNRVLYIDRADFREEANKKYKRLV------LGKEVR
SYQ_ALTMD       ---------------ESMGTRNIGFSREVYIEAEDFRESANKKFKRLV------LEKEVR
SYQ_PSEA6       ---------------PELGSREVPFAREIYIEAEDFREEANKKFKRLV------LGKEVR
SYQ_HAEDU       ---------------PELGERDLPFTREIYIDEADFREEANKQYKRLV------LGKEVR
SYQ_ACTSZ       ---------------EEMGTRQVQLTKELYIDQADFREEANKQYKRLV------LGKEVR
SYQ_PASMU       ---------------DELGVRELPFTRELYIDQADFREEANKQYKRLV------LGKEVR
SYQ_HAEIN       ---------------PELGERQLPFTKELYIDRADFREEANKQYKRLV------LGKEVR
SYQ_HAEI8       ---------------PELGERQLPFTKELYIDRADFREEANKQYKRLV------LGKEVR
SYQ_PSEHT       ---------------EEMGRRDVPFTREIYIEREDFKEEANNKFKRLV------LDKEVR
SYQ_PHOPR       ---------------SEMGTREVPFTREIWIEREDFREEANKKYKRLV------LGKEVR
SYQ_ALISL       ---------------PEMGTREVPFTREIYIEQDDFREEANKKYKRLV------LGKEVR
SYQ_VIBF1       ---------------PEMGTREVPFTREVYIEQDDFREEANKKYKRLV------LGKEVR
SYQ_VIBFM       ---------------PEMGTREVPFTREVYIEQDDFREEANKKYKRLV------LGKEVR
SYQ_VIBCH       ---------------PEMGDREVPFTRELWIEREDFREEANKKYKRLV------LGKEVR
SYQ_VIBCM       ---------------PEMGDREVPFTRELWIEREDFREEANKKYKRLV------LGKEVR
SYQ_VIBC3       ---------------PEMGDREVPFTRELWIEREDFREEANKKYKRLV------LGKEVR
SYQ_VIBTL       ---------------PEMGTREVPFTREVWIERDDFREEANKKYKRLV------LGKEVR
SYQ_VIBVY       ---------------PEMGEREVPFSREIWIEREDFREEANKKYKRLV------LGSEVR
SYQ_VIBCB       ---------------PEMGEREVPFTREVWIEREDFREEANKKYKRLV------LGKEVR
SYQ_VIBPA       ---------------PEMGEREVPFTREVWIEREDFREEANKKYKRLV------LGKEVR
SYQ_TOLAT       ---------------PEAGERLVPFSREIYIDRADFREEANKQYKRLV------MGKEVR
SYQ_SODGM       ---------------PEMGTRQVAFSREIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_ERWT9       ---------------PEMGTRQVPFSREIYIDRADFREEANKHYKRLV------LGKEVR
SYQ_PHOLL       ---------------PEMGSREVPFSREIYIDRADFREEANRQYKRLV------LGKEVR
SYQ_PROMH       ---------------PEMGTREVPFSREIYIDRADFKEEANRQYKRLV------LGKEVR
SYQ_YERE8       ---------------PDMGTRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPE       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPP       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPG       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPA       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPN       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPS       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPB       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERP3       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_YERPY       ---------------PEMGSRQVPFDSEIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_CROS8       ---------------PEMGNRDVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ENT38       ---------------PEMGSREVPFSAEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_KLEP3       ---------------PEMGSREVPFSAEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_KLEP7       ---------------PEMGSREVPFSAEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_SHIDS       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_SHIBS       ---------------PEMGSRQVPFSSEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_SHIFL       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_SHIF8       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_SHIB3       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO7I       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO57       ---------------PEMGSRQVPFSGEIWIDRSDFREEANKQYKRLV------LGKEVR
SYQ_ECO5E       ---------------PEMGSRQVPFSGEIWIDRSDFREEANKQYKRLV------LGKEVR
SYQ_ECOUT       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO27       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOK1       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO45       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOL6       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOL5       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO81       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO55       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOLC       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOBW       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECODH       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOLI       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOSE       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO24       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECO8A       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOHS       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_SHISS       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOSM       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ECOLU       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_ESCF3       ---------------PEMGSRQVPFSGEIWIDRADFREEANKQYKRLV------LGKEVR
SYQ_CITK8       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALAR       ---------------LEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALCH       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALTI       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALSV       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALNS       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALPB       ---------------LEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALA4       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALDC       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALEP       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALG2       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALHS       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALPA       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALPK       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALPC       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_SALTY       ---------------PEMGSREVPFSGEIWIDRADFREEANKQYKRLV------MGKEVR
SYQ_PECAS       ---------------PEMGSRQVAFSREVYIDRADFREEANKQYKRLV------LGKEVR
SYQ_PECCP       ---------------PEMGSRQVAFSREVYIDRADFREEANKQYKRLV------LGKEVR
SYQ_EDWI9       ---------------PEMGNREVPFARELYIDRADFREEANKQYKRLV------LGKEVR
SYQ_SERP5       ---------------PEMGSREVPFSRDIYIDRADFREEANKQYKRLV------LGKEVR
SYQ_BUCBP       ---------------PNMGCHKSIFSNTLYIDQNDFYENKSELLKKLA------IGKEIR
SYQ_BUCAP       ---------------LHLGTHEIIFTNTIYIEREDFKEKYDKKYKRLK------IGEEVR
SYQ_BUCAI       ---------------PEMGTHKIIFTNTIYIDRSDFKEKYDKKYKRLK------LGEKIR
SYQ_BUCA5       ---------------PEMGTHKIIFTNTIYIDRSDFKEKYDKKYKRLK------LGEKIR
SYQ_BUCAT       ---------------PEMGTHKIIFTNTIYIDRSDFKEKYDKKYKRLK------LGEKIR
                                  . .   .   ::*:  *:         .:           :*

SYQ_DEIRA       LRGAGIIRADDFGTDEAGQVTHIRATL----LGEDA-----KAAGVIHWVSAERALPAEF
SYQ_CLOK5       LKSAYFIKCTEAIKDKDGNVIELRCTYDPASKGGNS-PDGRKVRGTLHWINVDTAIPAEI
SYQ_PEPD6       LKGAYFVKCTDVIKDENGNVVEIHGTYDPETKSGSG-FTGRKVKSTIHWVDAKSAIPCEF
SYQ_CLOPS       LKGAYFVKCNEVIKDENGEVTEIHCTYDPETKSGTG-FTGRKVKGTIHWVDANNCIPAEF
SYQ_CLOPE       LKGAYFVKCNEVIKDENGEVTEIHCTYDPETKSGTG-FTGRKVKGTIHWVDANNCIPAEF
SYQ_CLOP1       LKGAYFVKCNEVIKDENGEVTEIHCTYDPETKSGTG-FTGRKVKGTIHWVDANNCIPAEF
SYQ_RHOBA       LRSGYIVDCHDVVKDADGNVTEVLCTYDPETKSGED-TSGRKVKGTIHWVSREHAQKVTV
SYQ_XYLFA       LRGAGIARVDEVVKNAAGDIIALHGWLDPTSRPGME-GAHRKVKGTIHWVSAPHAVAAEI
SYQ_XYLFM       LRGAGIARIDEVVKNAEGHIIALHGWLDPTSRPGME-GAHRKVKGTIHWVSAPHAVAAEI
SYQ_XYLFT       LRGAGIARIDEVVKNAEGHVIALHGWLDPTSRPGME-GAHRKVKGTIHWVSAPHAVAAEI
SYQ_XANCP       LRGAGIARVDEVIKDAAGEIVELRGWLDPESRPGMI-GSNRKVKGTIHWVSAVHAVEAEI
SYQ_XANC8       LRGAGIARVDEVIKDAAGEIVELRGWLDPESRPGMI-GSNRKVKGTIHWVSAVHAVEAEI
SYQ_XANOR       LRGAGIARVDEVIKNADGDIVALRGWLDPESRPGME-GANRKVKGTIHWVSAAHAVEAEI
SYQ_XANOM       LRGAGIARVDEVIKNADGDIVALRGWLDPESRPGME-GANRKVKGTIHWVSAAHAVEAEI
SYQ_XANAC       LRGAGIARVDEVIKNADGEIVELRGWLDPESRPGME-GANRKVKGTIHWVSAAHAVEAEI
SYQ_XANC5       LRGAGIARVDEVIKNADGEIVELRGWLDPESRPGME-GANRKVKGTIHWVSAVHAVEAEI
SYQ_NITEU       LRYAFIIKCTHVVKDDQGKILEIHCVYDPDTKSGTAGAETRKVRGNIHWLSATYAKAVEI
SYQ_BORA1       LKYGYVVRCTGFTKDEAGNITEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAEV
SYQ_BORBR       LKYGYVVRCTGFTKDQSGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQV
SYQ_BORPA       LKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQV
SYQ_BORPE       LKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQV
SYQ_POLNS       LRHGFVVECTGFETDAQGNVTQVNVTHFPDSKSGTPGSNNYKVKGNIHWISAAEAIPAEV
SYQ_POLAQ       LRHGFVVECTDFETDAKGNITQVNVNYFPDSKSGTPGSNNYKVKGNIHWISAAEAIPAEV
SYQ_RALPJ       LRYGYVIECTGCDKDAAGNITAVHANIIPDTKSGTPGADSVKVKGNIHWVSAAHALEAEV
SYQ_RALSO       LRYGYVIECTGCDKDADGNITAVHANIIPDTKSGTPGADSVKVKGNIHWVSAAHALEAEV
SYQ_CUPMC       LRYGYVIECTGVDKDADGNVIAVHANYLPETKSGTPGADSVKVKGNIHWVSAPHACEAEV
SYQ_CUPTR       LKYGYVIECTGVDKDADGNVIAVHASYLPDTKSGTPGADSVKVKGVIHWVSAAHAYEAEV
SYQ_CUPNH       LKYGYVIECTGVDKDADGNVIAVHASYLPETKSGTPGADSVKVKGVIHWVSAAHAYEAEV
SYQ_BRADU       LRYAYFVKCTGVIKNESGEVVELRCTYDPATRGGNA-PDGRKVKATMHWLSAAASKPAEI
SYQ_NITHX       LRYAYFVTCREVVKNAAGDVVELRCTYDPATKGGNA-PDGRKVKATMHWVSAAEAVPAEI
SYQ_NITWN       LRYAYFITCREVVKNPAGDVLELRCTYDPATRGGNA-PDGRKVKATMHWVNTADAVPAEV
SYQ_CHRVO       LRYSYVIKCDEVVKDAADEIVELKCSIDHDTLGKNP--EGRKVKGVIHWVSAEHAIQADV
SYQ_NEIG1       LRHGYVIKCGEVVKDEAGNVVELKCSIDHDTLGKNP--EGRKVKGVIHWVSAEHAAEIKV
SYQ_NEIMA       LRHGYVIKCDEVVKDEAGNVVELKCSIDHDTLGKNP--EGRKVKGVIHWVSAEHAAEIKV
SYQ_NEIMB       LRHGYVIKCDEVVKDEAGNVVELKCSIDHDTLGKNP--EGRKVKGVIHWVSAEHAAEIKV
SYQ_PSEPK       LRGSYVIRADEAIKDADGNIVELRCSYDPDTLGKNP--EGRKVKGVIHWVPAEGSVECEV
SYQ_PSESM       LRGSYVIRADEAIKDADGNIVELRCSYDPDTLGKNP--EGRKVKGVVHWVPAAESVECEV
SYQ_PSEAE       LRGSYVIRADEAIKDADGNIVELRCSYDPDTLGKNP--EGRKVKGVIHWVPAEGSVECEV
SYQ_PSEA8       LRGSYVIRADEAIKDADGNIVELRCSYDPDTLGKNP--EGRKVKGVIHWVPAEGSVECEV
SYQ_PSEAB       LRGSYVIRADEAIKDADGNIVELRCSYDPDTLGKNP--EGRKVKGVIHWVPAEGSVECEV
SYQ_PSEMY       LRGSYVIRADEAIKDAAGNIVELRCSYDENTLGKNP--EGRKVKGVIHWVPAAESVECEV
SYQ_AZOVD       LRGSYVIRADEAIKDEAGNIVELRCSYDENTLGKNP--EGRKVKGVIHWVPLEGSIKCEV
SYQ_PSEU5       LRGSYVIRADEAVKDDQGNIVELRCSYDENTLGKNP--EGRKVKGVIHWVPAAESVECEV
SYQ_PSYIN       LRNAYVIKADQVIKNDAGEITEIHCSYDPETLGNNP-TDGRKVKGVIHWVSAVENQAAEF
SYQ_COLP3       LRGAYVVTATRCDKDEQGNVTTVYCTYNEDTLGKNP-TDGTKPKGVIHWVDANKSLDAIV
SYQ_SHEON       LRNAYVIKAERCDKDSEGNITTVYCSYDADTLGKNP-ADGRKVKGVIHWVEATTAKPAQF
SYQ_IDILO       LRNAYVIRADRIETDDNGEIQTIYCHYDADTLGKDP-ADGRKVKGVIHWVSAETAKAAEF
SYQ_HAMD5       LRHAYVVKAKYVEKNAQGMITAIHCEYDPETLNKDP-SDGRKIRGVIHWVSADDAVPAEI
SYQ_ALTMD       LRNAYVVKANRVEKDEEGNVTTVYCTYDPDTLGKDP-ADGRKVKGVIHWVDAATAQAAEF
SYQ_PSEA6       LRNAYVIKAQRVEKDEQGNVTTIFCEYDGDTLGKDP-ADGRKVKGVIHWVSAAHAVAAEI
SYQ_HAEDU       LRNAYVIKAERVEKDASGKITTIFCSYDPETLGKNP-ADGRKVKGVIHWVSATQNKVAEF
SYQ_ACTSZ       LRNAYIIKAERVEKDAEGNIVCVYCSYDPETLGKNP-SDGRKVKGVIQWVSATDCLPAEF
SYQ_PASMU       LRNAYVIKAERVEKDAEENITTVYCTYDPDTLGKNP-ADGRKVKGVIQWVSAEDYLPAEF
SYQ_HAEIN       LRNAYVIKAERVEKDANGEITTIFCTYDPETLGKNP-ADGRKVKGVIHWVSAVNNHPAEF
SYQ_HAEI8       LRNAYVIKAERVEKDANGEITTIFCTYDPETLGKNP-ADGRKVKGVIHWVSAVNNHPAEF
SYQ_PSEHT       LRGAYVIKAQRVEKDENGEITTIYCTYDPETLGKNP-SDGRKVKGVIHWVSASEAITAEV
SYQ_PHOPR       LRGAYVIKAERIEKDAEGNITTIFCSYDNETLGVNP-SDGRKVKGVIHWVSADAGLPAEI
SYQ_ALISL       LRGAYVIQANRIEKDEAGNITTIFCSYDTETLGKNP-ADGRKVKGVIHWVSADKAFPAEI
SYQ_VIBF1       LRGAYVIQANRIEKDEAGNITTIFCSYDEDTLGKNP-ADGRKVKGVIHWVSADKALPAEI
SYQ_VIBFM       LRGAYVIQANRIEKDEAGNITTIFCSYDEDTLGKNP-ADGRKVKGVIHWVSADKALPAEI
SYQ_VIBCH       LRGAYVIKAERIEKDEQGNITTIFCSYDPETLGKNP-ADGRKVKGVIHWVSAEKGVPAEF
SYQ_VIBCM       LRGAYVIKAERIEKDEQGNITTIFCSYDPETLGKNP-ADGRKVKGVIHWVSAEKGVPAEF
SYQ_VIBC3       LRGAYVIKAERIEKDEQGNITTIFCSYDPETLGKNP-ADGRKVKGVIHWVSAEKGVPAEF
SYQ_VIBTL       LRGAYVIKAERIEKDAEGNITTIFCSYDNETLGKNP-ADGRKVKGVIHWVSADKALPAEI
SYQ_VIBVY       LRGAYVIKAERVEKDDEGNITTIFCTYDSETLGVNP-ADGRKVRGVIHWVSADKGVPAEI
SYQ_VIBCB       LRGAYVIKAERIEKDAEGNITTIFCTYDAETLGKNP-ADGRKVKGVIHWVSADKALPAEI
SYQ_VIBPA       LRGAYVIKAERVEKDAEGNITTIYCTYDPETLGKNP-ADGRKVKGVIHWVSADKALPAEI
SYQ_TOLAT       LRHAYIIKAERVEKDAEGNITTLYCSCDRDTLGTNP-ADGRKVKGVIHWVSAPHALDAEV
SYQ_SODGM       LRNAFVIKAEHVEKDPQGQITTIFCRHDPDTLSKDP-ADGRKVKGVIHWVSANRSLAAEF
SYQ_ERWT9       LRNAYVIKAERIAKDEEGNITCLFCSCDIDTLSKDP-ADGRKVKGVIHWVSAEHALLAEF
SYQ_PHOLL       LRNAYIIKAERVEKDADDNITTIYCSYDDQTLNKDP-ADGRKVKGVIHWVSAVHAVAAEF
SYQ_PROMH       LRNAYVIKAERVEKDEQGEITTIYCTYDPQTLNKDP-ADGRKVKGVIHWVSIPHAIPAEI
SYQ_YERE8       LRNAYVIKAERVEKDAEGHVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVKHALPAEI
SYQ_YERPE       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERPP       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERPG       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERPA       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERPN       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERPS       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERPB       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERP3       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_YERPY       LRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDP-ADGRKVKGVIHWVSVAHALPAEI
SYQ_CROS8       LRNAYVIKAERVEKDDAGEITTIYCTYDAETLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ENT38       LRNAYVIKAERVEKDTEGNITTIFCSYDAETLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_KLEP3       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_KLEP7       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_SHIDS       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_SHIBS       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_SHIFL       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_SHIF8       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_SHIB3       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO7I       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_ECO57       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO5E       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOUT       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO27       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOK1       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO45       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOL6       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOL5       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO81       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO55       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOLC       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOBW       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECODH       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOLI       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOSE       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO24       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECO8A       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOHS       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_SHISS       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOSM       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ECOLU       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_ESCF3       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_CITK8       LRNAYVVKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPVEI
SYQ_SALAR       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALCH       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALTI       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSVAHALPIEI
SYQ_SALSV       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALNS       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALPB       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALA4       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALDC       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALEP       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALG2       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALHS       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALPA       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALPK       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALPC       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_SALTY       LRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDP-ADGRKVKGVIHWVSAAHALPIEI
SYQ_PECAS       LRNAYVIKADRIEKDEQGTITTIYCSYDAETLSKDP-ADGRKVKGVIHWVSAAHAVPAEF
SYQ_PECCP       LRNAYVIKADRIEKDEQGTITTIYCSYDAETLSKDP-ADGRKVKGVIHWVSAAHAVPAEF
SYQ_EDWI9       LRNAYVIRAERVEKDADGEITTIYCSYDADTLSKDP-ADGRKVKGVIHWVSASHALPAEF
SYQ_SERP5       LRNAYVIKAERIEKDAEGEITTIFCSYDPDTLSKDP-ADGRKVKGVIHWVSAEHALPAEI
SYQ_BUCBP       LRYSYVIKAHKIKKDQNNNIKTIFCTYDKNTLGKNP--KNRKILGVIHWISEKNVLPARF
SYQ_BUCAP       LRYAYIIKAEKIEKDESGNIIKIICFCDINSLGKKP--INRKNPAVIHWIAVKNSFPAKF
SYQ_BUCAI       LRYSYIIHAEKIEKDEYGNISNIICYCDLNTLGRKP--KDNKNPAVIHWISEKNTLSAEF
SYQ_BUCA5       LRYSYIIHAEKIEKDEYGNISNIICYCDLNTLGRKP--KDNKNPAVIHWISEKNTLSAEF
SYQ_BUCAT       LRYSYIIHAEKIEKDEYGNISNIICYCDLNTLGRKP--KDNKNPAVIHWISEKNTLSAEF
                *. . .       .:    :  :                  *  . : *:         .

SYQ_DEIRA       RLYDRLFRVPHPEGENADVEDDSAGPAEHEAEPGAGQETAPVSQGFMRYLTPDSL-RVLR
SYQ_CLOK5       RLYEPLILEQQEKE----GEEDL----------------------FLDHVNPNSL-KVVK
SYQ_PEPD6       RLFEPLILDDIPEN----EGKH-----------------------FLEQINPNSL-EILQ
SYQ_CLOPS       RLYEPLILDDCEEN----EGKH-----------------------FLEQINPNSL-TICK
SYQ_CLOPE       RLYEPLILDDCEEN----EGKH-----------------------FLEQINPNSL-TICK
SYQ_CLOP1       RLYEPLILDDCEEN----EGKH-----------------------FLEQINPNSL-TICK
SYQ_RHOBA       RNYDRLFKVENPDA----SSDTGS---------------------FLDHLNPDSL-TTLT
SYQ_XYLFA       RLYDRLFSVEKPDD----NTDGKT---------------------YRDVLNPDSK-RVVH
SYQ_XYLFM       RLYDRLFSIEKPDD----NTDGKT---------------------YRDFLNPDSK-RVVH
SYQ_XYLFT       RLYDRLFSIEKPDD----NTDGKT---------------------YRDFLNPDSK-RVVH
SYQ_XANCP       RLYDRLFSVEKPDD----ESEGKT---------------------YRDYLNPESK-RSVR
SYQ_XANC8       RLYDRLFSVEKPDD----ESEGKT---------------------YRDYLNPESK-RSVR
SYQ_XANOR       RLYDRLFSVEKPDD----ESEGKT---------------------YRDYLNPESK-RNVR
SYQ_XANOM       RLYDRLFSVEKPDD----ESEGKT---------------------YRDYLNPESK-RNVR
SYQ_XANAC       RLYDRLFSVEKPDD----ESEGKT---------------------YRDYLNPESK-RNVR
SYQ_XANC5       RLYDRLFSVEKPDD----ESEGKT---------------------YRDYLNPESK-RNVR
SYQ_NITEU       RLYDRLFIDSHPDT---EGKD------------------------FKISLNPNSK-EVIT
SYQ_BORA1       RLYDRLFADPHPDG----GDKD-----------------------FLACLNPNSI-QTVQ
SYQ_BORBR       HLYDRLFADAHPDG----GDKD-----------------------FLACLNPHSK-QTVQ
SYQ_BORPA       HLYDRLFADAHPDG----GDKD-----------------------FLACLNPNSK-QTVQ
SYQ_BORPE       HLYDRLFADAHPDG----GDKD-----------------------FLACLNPNSK-QTVQ
SYQ_POLNS       RLYDHLFTDPYPDS----GDKN-----------------------FLDAINPNSK-QTIS
SYQ_POLAQ       RLYDHLFTDPHPDS----GDKN-----------------------FLDTINPHSK-ETIK
SYQ_RALPJ       RLYDRLFSDPQPDS----GDKN-----------------------FLDALNPNSK-KIVK
SYQ_RALSO       RLYDRLFTDPQPDS----GDKN-----------------------FLDALNPDAK-RVVT
SYQ_CUPMC       RLYDRLFNDPNPDA----GGKN-----------------------FLDALNPESK-KVVT
SYQ_CUPTR       RLYDRLFNDPNPDA----GGKN-----------------------FLDALNPDSK-QVIT
SYQ_CUPNH       RLYDRLFNDPNPDA----GGKN-----------------------FLDALNPDSK-QVIT
SYQ_BRADU       RIYNQLFANPSPDA----SN-------------------------FAADLNPQSLEILSN
SYQ_NITHX       RLYGHLFATAQPDA----AN-------------------------FASELNPQSL-ETLS
SYQ_NITWN       RLYGHLFETEQPDA----AN-------------------------FASELNPQSV-QILS
SYQ_CHRVO       RWYERLFTEQRPDAVRGEDGEYVD---------------------FRQFLNPESL-KLVP
SYQ_NEIG1       RLYDRLFTVERPGAVRGEDGEYLP---------------------FTDFLNPESV-KEIT
SYQ_NEIMA       RLYDRLFTIERPDAVRGEDGEYLP---------------------FTDFLNPESV-KEIT
SYQ_NEIMB       RLYDRLFTVERPDAVR--GEDGEYLP-------------------FTDFLNPESV-KEIT
SYQ_PSEPK       RLYDRLFRSPNPEK----TEEGGS---------------------FLDNINPASL-QVLS
SYQ_PSESM       RLYDRLFRSANPEK----AEDGAS---------------------FLDNINPDSL-QVLT
SYQ_PSEAE       RLYDRLFRSANPEK----AEEGGS---------------------FLDNINADSL-QVLA
SYQ_PSEA8       RLYDRLFRSANPEK----AEEGGS---------------------FLDNINADSL-QVLT
SYQ_PSEAB       RLYDRLFRSANPEK----AEEGGS---------------------FLDNINADSL-QVLT
SYQ_PSEMY       RLYDRLFRSANPEK----SEEGGS---------------------FLDNINPDSL-VVLT
SYQ_AZOVD       RLYDRLFKVANPEK----SEEGGS---------------------FLDNINSGSL-VVLT
SYQ_PSEU5       RLYDRLFRSANPEK----DEEGGS---------------------FLDNINPESL-VVLK
SYQ_PSYIN       RIYEPLFLVENPAA----AEN------------------------IDEVLNPNAL-VIKH
SYQ_COLP3       RLYDRLFTVPNPAA----ADD------------------------FNSVINPQSL-VTIT
SYQ_SHEON       RLYQRLFTDPNPAA----AET------------------------VDEVLNPNSL-EVVN
SYQ_IDILO       RVYDRLFQVPNPAA----EED------------------------LFSTLNPESL-VIKK
SYQ_HAMD5       RLYHHLLTASHADT----CL-------------------------FLEAFNPESL-FIRQ
SYQ_ALTMD       RLYDRLFNVPNPAA----EEN------------------------FTDAINPESL-EVKQ
SYQ_PSEA6       RLYDSLFTVPNPAA----EDD------------------------FVACINPESL-TVKQ
SYQ_HAEDU       RIYNRLFNVANPGD----EED------------------------INAVINPSSL-IVKH
SYQ_ACTSZ       RQYSRLFTMPNPGS----EED------------------------IIAAINPQSL-VVRQ
SYQ_PASMU       RQYGRLFTVANPGA----AED------------------------IHQVLNPDSL-VIKQ
SYQ_HAEIN       RLYDRLFTVPNPGA----EDD------------------------IESVLNPNSL-VIKQ
SYQ_HAEI8       RLYDRLFTVPNPGA----EDD------------------------IESVLNPNSL-VIKQ
SYQ_PSEHT       RLYDRLFSVPNPAA----ADE------------------------FESTLNPDSL-VILT
SYQ_PHOPR       RLYDRLFTVANPAA----ADD------------------------FVTVINPESL-TVLN
SYQ_ALISL       RLYDRLFTVPNSAA----LED------------------------FSESINPESL-ITKQ
SYQ_VIBF1       RLYDRLFTVPNPGA----ADD------------------------FAATINPESL-VVKN
SYQ_VIBFM       RLYDRLFTVPNPGA----ADD------------------------FAATINPESL-VVKN
SYQ_VIBCH       RLYERLFTVPNPGA----ADN------------------------FAETINPESL-VKVQ
SYQ_VIBCM       RLYERLFTVPNPGA----ADN------------------------FAETINPESL-VKVQ
SYQ_VIBC3       RLYERLFTVPNPGA----ADN------------------------FAETINPESL-VKVQ
SYQ_VIBTL       RLYDRLFTVPNPAA----ADD------------------------FAATLNPESL-VTLN
SYQ_VIBVY       RLYDRLFTVPNPAA----ADD------------------------FASTINPESL-TVMN
SYQ_VIBCB       RLYDRLFTVPNPAA----ADD------------------------FAATINPESL-VILN
SYQ_VIBPA       RLYDRLFTVPNPAA----AED------------------------FASTINTDSL-VVIN
SYQ_TOLAT       RLYDRLFSVANPGA----AED------------------------FLSTINPQSLRIVPH
SYQ_SODGM       RLYDRLFSEANPAA----AED------------------------FLSTLNPDSL-VIRQ
SYQ_ERWT9       RLYDRLFSVPNPAA----AED------------------------FLTTINPESL-VIRQ
SYQ_PHOLL       RLYDRLFCVPNPGA----EDD------------------------FLATINPESL-VIRQ
SYQ_PROMH       RLYDRLFSVPNPGA----EED------------------------FLSTINPESL-VIRQ
SYQ_YERE8       RLYDRLFSVPNPAA----AED------------------------FLSTINPESL-IIRQ
SYQ_YERPE       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERPP       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERPG       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERPA       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERPN       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERPS       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERPB       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERP3       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_YERPY       RLYDRLFNVPNPAA----AED------------------------FLSTINPESL-VIRQ
SYQ_CROS8       RLYDRLFSVPNPGA----AED------------------------FLTTINKDSL-VIKQ
SYQ_ENT38       RLYDRLFSVPNPGA----AED------------------------FLATINPESL-LIKQ
SYQ_KLEP3       RLYDRLFSVPNPGA----EED------------------------FLAVINPDSL-VIKQ
SYQ_KLEP7       RLYDRLFSVPNPGA----ADD------------------------FLAVINPESL-VIKQ
SYQ_SHIDS       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_SHIBS       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_SHIFL       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_SHIF8       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_SHIB3       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO7I       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO57       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO5E       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOUT       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO27       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOK1       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO45       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOL6       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOL5       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO81       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO55       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOLC       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOBW       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECODH       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOLI       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOSE       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO24       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECO8A       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOHS       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_SHISS       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOSM       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ECOLU       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_ESCF3       RLYDRLFSVPNPGA----ADD------------------------FLSVINPESL-VIKQ
SYQ_CITK8       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALAR       RLYDRLFSVPNPGA----AED------------------------FLSVINTESL-VIKQ
SYQ_SALCH       RLYDRLFSVPNPGT----AED------------------------FLSVINPESL-VIKQ
SYQ_SALTI       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALSV       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALNS       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKR
SYQ_SALPB       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALA4       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALDC       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALEP       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALG2       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALHS       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALPA       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALPK       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALPC       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_SALTY       RLYDRLFSVPNPGA----AED------------------------FLSVINPESL-VIKQ
SYQ_PECAS       RLYDRLFSVANPAA----ADD------------------------FLSTINPDSL-KITQ
SYQ_PECCP       RLYDRLFSVANPGA----AED------------------------FLSTINPDSL-KITQ
SYQ_EDWI9       RLYDRLFSVANPGA----AED------------------------FLSTINPESL-VIRR
SYQ_SERP5       RVYDRLFSVPNPAA----AED------------------------FLTTINPESL-VIKH
SYQ_BUCBP       FLYDKLFTIQSPET----VKN------------------------FLQYINTNSL-VIKY
SYQ_BUCAP       KLYNQLFKIKNPDQ----EKN------------------------FLSYLNSNSL-IVKN
SYQ_BUCAI       KLYDQLFNIKNPEQ----QEN------------------------FLLYINSKSL-IKKF
SYQ_BUCA5       KLYDQLFNIKNPEQ----QEN------------------------FLLYINSKSL-IKKF
SYQ_BUCAT       KLYDQLFNIKNPEQ----QEN------------------------FLLYINSKSL-IKKF
                  :  *:                                          ..  :      

SYQ_DEIRA       G-YVEPSV-AGDPADTR--------YQFERQGYFWRDPVELERVDSRE-DALVFGRIITL
SYQ_CLOK5       G-FVEPDM-KHVKSDEK--------FQFFRHGYF-----VLDGKCSKN-GELVFNRIVSL
SYQ_PEPD6       G-FVEPTQIKDAKPFDK--------FQFVRNGFF-----SIDNKYTTD-EKFVFNRIVPL
SYQ_CLOPS       G-FIEPSA-KDAKPQDK--------YQLFRHGYF-----NVDPNFTSD-DNLVFNRIVSL
SYQ_CLOPE       G-FIEPSA-KDAKPQDK--------YQLFRHGYF-----NVDPNFTSD-DNLVFNRIVSL
SYQ_CLOP1       G-FIEPSA-KDAKPQDK--------YQLFRHGYF-----NVDPNFTSD-DNLVFNRIVSL
SYQ_RHOBA       A-HVEPAL-AEAAVGDR--------VQFERLGYY-----VVD-PDSTD-GEIIFNRIVPL
SYQ_XYLFA       G-YIEPAA-AQTAPEHA--------FQFERLGYF-----VTDRHDHDA-AHPVFNRSVTL
SYQ_XYLFM       G-YIEPAA-AQTAPEHA--------FQFERLGYF-----VTDRHDHDA-THPVFNRSVTL
SYQ_XYLFT       G-YIEPAA-AQTAPEHA--------FQFERLGYF-----VTDRHDHDA-THPVFNRSVTL
SYQ_XANCP       G-YVEPSA-AQAAPEQA--------FQFERTGYF-----VADRRDHSA-ATPAFNRSVTL
SYQ_XANC8       G-YVEPSA-AQAAPEQA--------FQFERTGYF-----VADRRDHSA-ATPAFNRSVTL
SYQ_XANOR       G-YVEPSA-ALAAPEQA--------FQFERTGYF-----VADSRDHSA-STPVFNRSVTL
SYQ_XANOM       G-YVEPSA-ALAAPEQA--------FQFERTGYF-----VADSRDHSA-STPVFNRSVTL
SYQ_XANAC       G-YVEPSA-AMAAPEQA--------FQFERTGYF-----VADRRDHSE-ATPVFNRSVTL
SYQ_XANC5       G-YVEPSA-AMAAPEQA--------FQFERSGYF-----VADRRDHSA-ATPVFNRSVTL
SYQ_NITEU       G-YVEPSL-CEAQPEQR--------FQFERHGYF-----VADLADTGP-GKPIFNRTVSL
SYQ_BORA1       A-WLEPGT-R-AEPGAT--------WQFERLGYF-----TVDSKDSSP-EAPVLNRIVTL
SYQ_BORBR       A-WLEPGI--EAVPGAT--------WQFERLGYF-----TVDSKDSRP-EAPVLNRIVTL
SYQ_BORPA       A-WLEPGI--EAVPGAT--------WQFERLGYF-----TVDSKDSRP-EAPVLNRIVTL
SYQ_BORPE       A-WLEPGI--EAVPGAT--------WQFERLGYF-----TVDSKDSRP-EAPVLNRIVTL
SYQ_POLNS       A-YLEPCM-KDAKAEDR--------FQFERHGYF-----VADQSDSKP-GKPIFNRAVGL
SYQ_POLAQ       A-YLEPCM-KDVKPEDR--------FQFERHGYF-----VADQNDSAP-GKPVFNRTVGL
SYQ_RALPJ       A-FLEPTL-ATAKAEDR--------FQFERHGYF-----VADRIDSQP-GKPVFNRVVGL
SYQ_RALSO       A-YLEPTL-ATAKPEDR--------FQFERHGYF-----VADRIDSQP-GKPVFNRVVGL
SYQ_CUPMC       A-YLEPGL-RDAKPEDR--------FQFERHGYF-----VADRVDSQP-GKPVFNRTVGL
SYQ_CUPTR       A-YLEPGL-REAQPEDR--------FQFERHGYF-----VADRSDSTP-GKPVFNRIVGL
SYQ_CUPNH       A-YLEPGL-REAQPEDR--------FQFERHGYF-----VADRTDSQP-GKPVFNRIVGL
SYQ_BRADU       A-RVEASV-AESNSTEP--------MQFERQGYF-----VRD-KDSTP-GKPVFSRTIGL
SYQ_NITHX       G-MVEPAL-ARDDTDGA--------VQFERQGYF-----CRD-RDSSP-GRLVFNRTVGL
SYQ_NITWN       GCMVEPAL-ARDDAGAA--------VQFERQGYF-----YRD-RDSAP-GRLVFNRTVGL
SYQ_CHRVO       A-YVEASV-LQAEPESR--------FQFERLGYF-----VTDRYEHRKGDKAVFNRTVGL
SYQ_NEIG1       A-YAEPAA-KDLPAESR--------WQFERIGYF-----VTDRQDHGK-DTPVFNRTVTL
SYQ_NEIMA       A-YAEPAA-KDLPAESR--------WQFERIGYF-----VTDRKDHGK-DTPVFNRTVTL
SYQ_NEIMB       A-YAEPAA-KDLPAESR--------WQFERIGYF-----VTDRKDHGK-DTPVFNRTVTL
SYQ_PSEPK       GCRAEPSL-AQAQPEDR--------FQFEREGYF-----CADLKDSQP-GRPVFNRTVTL
SYQ_PSESM       GCRAEPSL-GHAQPEDR--------FQFEREGYF-----CADIKDSKP-GQPVFNRTVTL
SYQ_PSEAE       GCRAEPSL-GQANPEDR--------FQFEREGYF-----VADLKDSRP-GKPVFNRTVTL
SYQ_PSEA8       GCRAEPSL-GQANPEDR--------FQFEREGYF-----VADLKDSRP-GKPVFNRTVTL
SYQ_PSEAB       GCRAEPSL-GQANPEDR--------FQFEREGYF-----VADLKDSRP-GKPVFNRTVTL
SYQ_PSEMY       GCRAEPSL-AQAAPEER--------FQFEREGYF-----VADLKDSQP-GKPVFNRTVTL
SYQ_AZOVD       GCRAEPSL-ANARPEER--------FQFEREGYF-----CADLKDSRP-GAPVFNRTVTL
SYQ_PSEU5       GCRAEPSL-ANAAPEER--------FQFEREGYF-----CADMKDSKP-GAPVFNRTVTL
SYQ_PSYIN       G-FVESGL-SDALAEKA--------YQFEREGYF-----CADNKDSSP-ERLVFNRTVAL
SYQ_COLP3       GAKVEPSL-AEAKPEFA--------YQFERQGYF-----CLDNDIKEP-GALVFNRTVGL
SYQ_SHEON       G-LVEASL-ANAPAEKA--------YQFEREGYF-----CADNKDSSA-DHLVFNLTVAL
SYQ_IDILO       G-FVEANL-ASAKLGEN--------FQFERLGYY-----CLDQDAETE-GRLIFNQTVGL
SYQ_HAMD5       G-FVEPSL-ANTQEGKT--------YQFEREGYF-----CTD-KDSSE-KHLVFNRTVSL
SYQ_ALTMD       G-WAEAGL-IGHVPEVGA-------WQFERTGYF-----CVD-KDSTD-AKPVFNRTVGL
SYQ_PSEA6       G-WVEPSL-AKVDIDEANIQA----FQFERTGYF-----CFD-KDSTT-SKLVFNRTVGL
SYQ_HAEDU       G-FVEVNL-ANAQKEQG--------YQFEREGYY-----CLDSKEGSA-DNLIFNLTVSL
SYQ_ACTSZ       G-FVERSV-ANALSEKA--------YQFEREGYY-----CADSKDSRP-DHLVFNLTVSL
SYQ_PASMU       G-VVEKSL-ANAQPEKA--------YQFEREGYY-----CADSKDSRP-DHLVFNLTVSL
SYQ_HAEIN       G-FVEQSL-ANAEAEKG--------YQFEREGYF-----CADSKDSRP-EHLVFNLTVSL
SYQ_HAEI8       G-FVEQSL-ANAEAEKG--------YQFEREGYF-----CADSKDSRP-EHLVFNLTVSL
SYQ_PSEHT       NAKLEPSL-ANSAAEQG--------FQFERTGYF--------SRDSKA-KNIVFNQTVGL
SYQ_PHOPR       G-FVEPSL-KVAEAEKA--------FQFERIGYF-----CVDSKDSSA-EKLVFNRTVGL
SYQ_ALISL       G-FVEPSL-VTAEAEAG--------YQFERTGYF-----CIDNKDSTP-EALVFNRTVGL
SYQ_VIBF1       G-FVEPSL-ATAEAEVG--------YQFERTGYF-----CADNKDSSA-DALVFNRTVGL
SYQ_VIBFM       G-FVEPSL-ATAEAEVG--------YQFERTGYF-----CADNKDSSA-DALVFNRTVGL
SYQ_VIBCH       G-YVEPSL-VEAKPEFG--------YQFERMGYF-----CADNKDSSP-QALVFNRTVGL
SYQ_VIBCM       G-YVEPSL-VEAKPEFG--------YQFERMGYF-----CADNKDSSP-QALVFNRTVGL
SYQ_VIBC3       G-YVEPSL-VEAKPEFG--------YQFERMGYF-----CADNKDSSP-QALVFNRTVGL
SYQ_VIBTL       G-FVEPSL-AEGVAEQA--------YQFERTGYF-----CVDSKDSKA-DALVFNRTVGL
SYQ_VIBVY       G-FVEPSL-VEAEAEKG--------YQFERMGYF-----CADSKDSSK-EHLVFNRTVGL
SYQ_VIBCB       G-FVEPSL-AASEAEKG--------YQFERMGYF-----CADSKDSSA-DNLVFNRTVGL
SYQ_VIBPA       G-FVEPSL-ASAEAEQG--------YQFERMGYF-----CADSKDSTA-DNLVFNRTVGL
SYQ_TOLAT       A-KLEPSL-RDAKPEFA--------YQFEREGYF-----CADSKLSSA-EKPVFNLTVAL
SYQ_SODGM       G-FVEAGV-PAANTGEP--------FQFEREGYF-----CADSRYFSP-THPVFNRTVGL
SYQ_ERWT9       G-FVEPGM-QQALASAP--------YQFEREGYF-----CADSVYSTS-NKLVFNRTVGL
SYQ_PHOLL       G-FVEPSL-ADAKSEQT--------YQFEREGYF-----CADSCHSSA-ENLVFNRTAGL
SYQ_PROMH       G-FVEASL-KDAAIEKA--------YQFEREGYF-----CAD-KLSTA-DKLVFNRTVGL
SYQ_YERE8       G-FVEPSL-ADAVPEKT--------YQFEREGYF-----CADSHYSRP-DALVFNRTVGL
SYQ_YERPE       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERPP       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERPG       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERPA       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERPN       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERPS       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERPB       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERP3       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_YERPY       G-FVEPSL-ADAVSDKT--------YQFEREGYF-----CADSRYSRP-GALVFNRTVGL
SYQ_CROS8       G-YAEPGL-KNAEAGKA--------WQFEREGYF-----CLDSRHANG-DKLVFNRTVGL
SYQ_ENT38       G-YAEPSL-KNAETGKA--------YQFEREGYF-----CLDSRYATA-TKLVFNRTVGL
SYQ_KLEP3       G-YAEPSL-AQAEAGKA--------YQFEREGYF-----CLDSRYANA-SSLVFNRTVGL
SYQ_KLEP7       G-YAEPSL-AQAEAGKA--------YQFEREGYF-----CLDSRYATA-TNLVFNRTVGL
SYQ_SHIDS       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_SHIBS       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_SHIFL       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_SHIF8       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_SHIB3       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO7I       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO57       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO5E       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOUT       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO27       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOK1       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO45       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOL6       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOL5       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO81       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO55       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOLC       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOBW       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECODH       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOLI       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOSE       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO24       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECO8A       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOHS       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_SHISS       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOSM       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ECOLU       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_ESCF3       G-FAEPSL-KDAVAGKA--------FQFEREGYF-----CLDSRHSTA-EKPVFNRTVGL
SYQ_CITK8       G-YAEPSL-QNAVAGKA--------YQFEREGYF-----CLDSRYTTA-DKRVFNRTVGL
SYQ_SALAR       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALCH       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSCYATA-DKLVFNRTVGL
SYQ_SALTI       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALSV       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALNS       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALPB       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALA4       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALDC       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALEP       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALG2       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALHS       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALPA       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALPK       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALPC       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_SALTY       G-YGEPSL-KAAVAGKA--------FQFEREGYF-----CLDSRYATA-DKLVFNRTVGL
SYQ_PECAS       G-FVEASL-VQAEVEKA--------YQFEREGYF-----CADRVYSSA-EHLVFNRTVGL
SYQ_PECCP       G-FVEASL-AQAEAEKA--------YQFEREGYF-----CADRVYSSA-EHLVFNRTVGL
SYQ_EDWI9       G-FVEPTL-AAAVPEVT--------YQFEREGYF-----CADIRYSSA-GHLVFNRTVGL
SYQ_SERP5       G-FVEPSL-AAAQPEKA--------YQFEREGYF-----CADNRHSSA-EHLVFNRTVGL
SYQ_BUCBP       G-FVEKDI-LTNISTTA--------YQFEREGYF-----CINKNFSIT-KNLTFNRIVTL
SYQ_BUCAP       G-FVEKKI-AQKIIKKMSNNFIKLFFQFERTGYF-----CVDEVDSKE-NKLVFNRTVSL
SYQ_BUCAI       G-FIEKKI-GEEIQKKISNNNIEIFFQFERIGYF-----CIDFIDSKK-NQLVFNRTVGL
SYQ_BUCA5       G-FIEKKI-GEEIQKKISNNNIEIFFQFERIGYF-----CIDFIDSKK-NQLVFNRTVGL
SYQ_BUCAT       G-FIEKKI-GEEIQKKISNNNIEIFFQFERIGYF-----CIDFIDSKK-NQLVFNRTVGL
                    *                     *: * *::                   :.    *

SYQ_DEIRA       KDTWGK>----------
SYQ_CLOK5       KSSFKIPENK-------
SYQ_PEPD6       KSSF--KPGK-------
SYQ_CLOPS       KSSFKLK----------
SYQ_CLOPE       KSSFKLK----------
SYQ_CLOP1       KSSFKLK----------
SYQ_RHOBA       RDTW-GKIEAKGKK---
SYQ_XYLFA       RDTWQRD----------
SYQ_XYLFM       RDTWQRD----------
SYQ_XYLFT       RDTWQRD----------
SYQ_XANCP       RDTW-AK----------
SYQ_XANC8       RDTW-AK----------
SYQ_XANOR       RDAW-AK----------
SYQ_XANOM       RDAW-AK----------
SYQ_XANAC       RDTW-AK----------
SYQ_XANC5       RDTW-AK----------
SYQ_NITEU       RNTW-KK----------
SYQ_BORA1       KDSWAA-----------
SYQ_BORBR       RDSWQAA----------
SYQ_BORPA       RDSWQAA----------
SYQ_BORPE       RDSWQAA----------
SYQ_POLNS       KDSWK------------
SYQ_POLAQ       KDSWK------------
SYQ_RALPJ       KDSW-GK----------
SYQ_RALSO       KDSW-GK----------
SYQ_CUPMC       KDSW-GK----------
SYQ_CUPTR       KDSW-GK----------
SYQ_CUPNH       KDSW-GK----------
SYQ_BRADU       RDTFAKEVAKG------
SYQ_NITHX       RDTW-AKVAAAGS----
SYQ_NITWN       RDTW-AKVAAAGS----
SYQ_CHRVO       KDSWK------------
SYQ_NEIG1       KDSWQPK----------
SYQ_NEIMA       KDSWQPK----------
SYQ_NEIMB       KDSWQPK----------
SYQ_PSEPK       RDSW-GS----------
SYQ_PSESM       RDSW-T-----------
SYQ_PSEAE       RDSW-GQG---------
SYQ_PSEA8       RDSW-GQG---------
SYQ_PSEAB       RDSW-GQG---------
SYQ_PSEMY       RDSW----GQ-------
SYQ_AZOVD       RDSW----GQ-------
SYQ_PSEU5       RDSW----GQ-------
SYQ_PSYIN       RDSWGG-----------
SYQ_COLP3       RDTW-AKISQ-------
SYQ_SHEON       RDSFE------------
SYQ_IDILO       RDSW-AKIEQEQTTGS-
SYQ_HAMD5       RGES-ALYDL-------
SYQ_ALTMD       RDTW-AKIGE-------
SYQ_PSEA6       RDTW-AKIGD-------
SYQ_HAEDU       KEGFTA-----------
SYQ_ACTSZ       KEGF-------------
SYQ_PASMU       KEGF-------------
SYQ_HAEIN       KEGF-------------
SYQ_HAEI8       KEGF-------------
SYQ_PSEHT       RDSW-SKTQ--------
SYQ_PHOPR       RDTW-AKMGE-------
SYQ_ALISL       RDTW-EG----------
SYQ_VIBF1       RDTW-AG----------
SYQ_VIBFM       RDTW-AG----------
SYQ_VIBCH       RDSF-AKIDEE------
SYQ_VIBCM       RDSF-AKIDEE------
SYQ_VIBC3       RDSF-VKIDEE------
SYQ_VIBTL       RDTW-GKTEA-------
SYQ_VIBVY       RDTW-AKIEAK------
SYQ_VIBCB       RDTW-AKIENQ------
SYQ_VIBPA       RDTW-AKIENQ------
SYQ_TOLAT       RDTW---VG--------
SYQ_SODGM       RDTWAQRAAM-------
SYQ_ERWT9       RDTW-AKNGE-------
SYQ_PHOLL       RDTW-AKISQD------
SYQ_PROMH       RDTW-AKISKQG-----
SYQ_YERE8       RDTWAAKVTN-------
SYQ_YERPE       RDTWAAKATQ-------
SYQ_YERPP       RDTWAAKATQ-------
SYQ_YERPG       RDTWAAKATQ-------
SYQ_YERPA       RDTWAAKATQ-------
SYQ_YERPN       RDTWAAKATQ-------
SYQ_YERPS       RDTWAAKATQ-------
SYQ_YERPB       RDTWAAKATQ-------
SYQ_YERP3       RDTWAAKATQ-------
SYQ_YERPY       RDTWAAKATQ-------
SYQ_CROS8       RDTW-AKIGE-------
SYQ_ENT38       RDTW-AKAGE-------
SYQ_KLEP3       RDTW-AKVGE-------
SYQ_KLEP7       RDTW-AKAGE-------
SYQ_SHIDS       RDTW-AKVGE-------
SYQ_SHIBS       RDTW-AKVGE-------
SYQ_SHIFL       RDTW-AKVGE-------
SYQ_SHIF8       RDTW-AKVGE-------
SYQ_SHIB3       RDTW-AKVGE-------
SYQ_ECO7I       RDTW-AKVGE-------
SYQ_ECO57       RDTW-AKVGE-------
SYQ_ECO5E       RDTW-AKVGE-------
SYQ_ECOUT       RDTW-AKVGE-------
SYQ_ECO27       RDTW-AKVGE-------
SYQ_ECOK1       RDTW-AKVGE-------
SYQ_ECO45       RDTW-AKVGE-------
SYQ_ECOL6       RDTW-AKVGE-------
SYQ_ECOL5       RDTW-AKVGE-------
SYQ_ECO81       RDTW-AKVGE-------
SYQ_ECO55       RDTW-AKVGE-------
SYQ_ECOLC       RDTW-AKVGE-------
SYQ_ECOBW       RDTW-AKVGE-------
SYQ_ECODH       RDTW-AKVGE-------
SYQ_ECOLI       RDTW-AKVGE-------
SYQ_ECOSE       RDTW-AKVGE-------
SYQ_ECO24       RDTW-AKVGE-------
SYQ_ECO8A       RDTW-AKVGE-------
SYQ_ECOHS       RDTW-AKVGE-------
SYQ_SHISS       RDTW-AKVGE-------
SYQ_ECOSM       RDTW-AKVGE-------
SYQ_ECOLU       RDTW-AKVGE-------
SYQ_ESCF3       RDTW-AKVGE-------
SYQ_CITK8       RDTW-AKAGE-------
SYQ_SALAR       RDTW-AKAGE-------
SYQ_SALCH       RDTW-AKAGE-------
SYQ_SALTI       RDTW-AKAGE-------
SYQ_SALSV       RDTW-AKAGE-------
SYQ_SALNS       RDTW-AKAGE-------
SYQ_SALPB       RDTW-AKAGE-------
SYQ_SALA4       RDTW-AKAGE-------
SYQ_SALDC       RDTW-AKAGE-------
SYQ_SALEP       RDTW-AKAGE-------
SYQ_SALG2       RDTW-AKAGE-------
SYQ_SALHS       RDTW-AKAGE-------
SYQ_SALPA       RDTW-AKAGE-------
SYQ_SALPK       RDTW-AKAGE-------
SYQ_SALPC       RDTW-AKAGE-------
SYQ_SALTY       RDTW-AKAGE-------
SYQ_PECAS       RDTW-VG----------
SYQ_PECCP       RDTW-VG----------
SYQ_EDWI9       RDTW-AKAAL-------
SYQ_SERP5       RDTW-AKIGA-------
SYQ_BUCBP       KDKIK------------
SYQ_BUCAP       KDSWNLKK---------
SYQ_BUCAI       RDTWDSKKIKTKNITNN
SYQ_BUCA5       RDTWDSKKIKTKNITNN
SYQ_BUCAT       RDTWDSKKIKTKNITNN
                .