CLUSTAL format seed alignment for MF_00437

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YCF4_RHDSA      ------------------MQTR-------------YDLILGSRRFSNYLWTLISFSGGIG
YCF4_GUITH      ----------------MNTKIR-------------TDLILGSKRFSNYAWCFILMTGGIG
YCF4_PORPU      -----------MKQVLPIHKVR-------------KDVILGSRRFSNYWWASTIFIGALG
YCF4_PYRYE      -----------MKKTLSIHSVR-------------KDLILGSRRLSNYWWATIIFIGALG
YCF4_GRATL      --------------MYTMAQIK-------------TDKILGSRRISNYFWATIILLGGLS
YCF4_CYAPA      -----------MNLKNNTDQIK-------------RDLITGSRRLSNYWWAITIGLGSSG
YCF4_SYNPX      -----------------------------MSAEVLEQPVLGSRRLSNYLVAAAVSIGGIG
YCF4_SYNSC      -----------------------------MSAAVLEQPVLGSRRLSNFLVASAVTIGGVG
YCF4_SYNS9      -----------------------------MSAAVLEQSVLGSRRLSNFLVAAAVSVGGVG
YCF4_SYNPW      -----------------------------MAAELLEQPVLGSRRLSNILVAAMVTIGGVG
YCF4_SYNS3      -----------------------------MAAELLEQPVLGSRRLSNILVALMVTIGGIG
YCF4_PROM3      -------------MSADLQETPKAGD---ASLERLEQSVLGFRRLSNQLLAVIVTIGGLG
YCF4_PROMM      -------------MSADLQETPKAGD---ASLERLEQSVLGFRRLSNQLLAVIVTIGGLG
YCF4_SYNR3      ------------------------------MDAPIDQPVLGSRRLSNYLVALLVSIGGVG
YCF4_PROM1      -------------MSSESKSSQSEKE---LSGLVLEQKIKGSRKVSNYLVASMLSIGGVG
YCF4_PROMT      -------------MSSESKLSQSEKE---LSGLVLEQKIKGSRKVSNYLVASMLSIGGVG
YCF4_PROMA      -------------MSADFKEASSPTD---SSETLLEQIVKGSRKTSNYIVASMLAVGGIG
YCF4_PROMS      -------------MNSDLTSFDK-----------IEQKIGGSRKISNYIIGGMLTIGGIG
YCF4_PROM0      -------------MNSDLKSFDK-----------IEQKIGGSRKISNYIIGGMLTIGGIG
YCF4_PROM9      -------------MNSDLTSFDK-----------IEQKIGGSRKTSNYIIGGMLTIGGIG
YCF4_PROM2      -------------MNSDLTSFDK-----------IEQKIDGSRKISNYIIGGMLTIGGIG
YCF4_PROM5      -------------MESNLSSFNK-----------IEQQINGSRKISNYLIGGMLTIGGIG
YCF4_PROMP      -------------MQSNLSSFNK-----------IEQKINGSRKISNYLIGGMLSIGGIG
YCF4_SYNJA      -----------MSATVPEIRS----------ENLLRYTVIGSRRPSVYFWAVALTGGGLG
YCF4_SYNJB      -----------MSAIVPEIRS----------ADLLRYTVIGSRRPSVYFWAVALTGGGLG
YCF4_GLOVI      ------------MAAPAIYQT----------DKVLRFEVPGSRRPSTYFFALVLTLGGLG
YCF4_TRIEI      -------------MTTQTSTG----------DRLVHQEIIGSRRLSNYLWAIIVTMGGIG
YCF4_EMIHU      -------------MRTYIS---------------------GSRRLSNIFWALTITLGGLG
YCF4_ODOSI      -------------MQKEIR----------------RDDIIGSRRFSNYFWAVFLCSGGIS
YCF4_THAPS      -------------MQDQIR----------------QEKIVGSRRFSNYFWASLLLVGGLM
YCF4_PHATC      -------------MQNEIR----------------QDKIIGSRRFSNYFWAFFLLVGGLG
YCF4_NOSS1      ------------MTASTTINKGDSPNGDSSASSVLHQKVLGSRRFSNYWWASIVTLGASG
YCF4_ANAVT      ------------MTASTTINKGDSPNGDSSASSVLHQKVLGSRRFSNYWWASIVTLGASG
YCF4_SYNP6      -------------MPSPVA---------TVETDSLQQPILGSRRPSNYFWAIAVSVGGTG
YCF4_SYNE7      -------------MPSPVA---------TVETDSLQQPILGSRRPSNYFWAIAVSVGGTG
YCF4_THEEB      ------------MTNSPITEP------SPRQESVLRYPVLGSRRPSNYFWATAVSIGGLG
YCF4_SYNY3      ------------MGGQTLAE----------SSQVLRQEVLGARRFSNFFWAGISTIGGVG
YCF4_PINKO      -------------MNRRSKWLW-------------IEPITGSRKRSNFFWACILFLGSLG
YCF4_PINTH      -------------MNRRSKWLW-------------IEPITGSRKRSNFFWACILFLGSLG
YCF4_GNEPA      -------------MNHQAKRLW-------------IEPIKGSRRKSNFFFASIILGGALG
YCF4_CYCTA      -------------MNWRSEWLW-------------IEPITGSRRTSNFCRACILFFGSLG
YCF4_CUSEX      -------------MSWRSEHIW-------------IELIAGSRKISNLCWAFILFLGSLG
YCF4_CUSRE      -------------MSWRSEHIW-------------IDLITGSRKISNLCWAFTLFLGSLG
YCF4_IPOPU      -------------MSWRSEHIW-------------IELLPGSRKISNFCWAFILFLGSLG
YCF4_NICSY      -------------MTWRSEHIW-------------IELITGSRKISNFCWAFILFLGSLG
YCF4_TOBAC      -------------MTWRSEHIW-------------IELITGSRKISNFCWAFILFLGSLG
YCF4_ATRBE      -------------MTWRSEHIW-------------IELITGSRKISNFCWAFILFLGSLG
YCF4_NICTO      -------------MTWRSEHIW-------------IELITGSRKISNFCWAFILFLGSLG
YCF4_SOLBU      -------------MTWRSDDIW-------------IELITGSRKISNFCWALILFLGSLG
YCF4_SOLLC      -------------MTWRSDDIW-------------IELITGSRKISNFCWALILFLGSLG
YCF4_SOLTU      -------------MTWRSDDIW-------------IELITGSRKISNFCWALILFLGSLG
YCF4_JASNU      -------------MSWRSEDIW-------------IELLTGSRKLSNFCWALILFLGSLG
YCF4_DAUCA      -------------MSCRSEHIW-------------IQPITGSRKTSNLCWAIILFLGSLG
YCF4_PANGI      -------------MSCRSEHIW-------------IEPITGSRKTSNFCWAVILFLGSLG
YCF4_HELAN      -------------MSCRSEHIW-------------IEPIKGARKTSNFCWAIILFLGSLG
YCF4_LACSA      -------------MSCRSEHIW-------------IEPITGARKTSNFCWAVILFLGSLG
YCF4_COFAR      -------------MSLRSEHIW-------------IELIKGSRKISNFCWAFILFVGSVG
YCF4_MORIN      -------------MSWRSDHIC-------------IELIAGSRKPSNVCWAFILFLGSLG
YCF4_POPTR      -------------MSWRSEHIW-------------IELIAGSRKISNFCWAIILFLGSLG
YCF4_POPAL      -------------MSWRSEHIW-------------IELIAGSRKISNFCWAIILFLGSLG
YCF4_EUCGG      -------------MSCRSEHIW-------------IELIVGSRKISNFCWAFILFLGSLG
YCF4_OENEH      -------------MIWRSEHIW-------------IELIVGSRKISNFCWAFLLFLGSLG
YCF4_ACOCL      -------------MNWRSEHIW-------------IEFITGSRKTSNFGWACILFLGSLG
YCF4_PHAAO      -------------MNWRSEHIW-------------IELITGSRKTSNFCWACILFLGSLG
YCF4_LOLPR      -------------MNWRSEHVW-------------VELLKGSRKRGNFFWACILFLGSLG
YCF4_AGRST      -------------MNWRSEHVW-------------VELLKGSRKRGNFFWACILFLGSLG
YCF4_HORVU      -------------MNWRSEHIW-------------VELLKGSRKRSNFFWACILFLGSLG
YCF4_WHEAT      -------------MNWRSEHIW-------------VELLKGSRKRGNFFWACILFLGSLG
YCF4_ORYNI      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_ORYSA      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_ORYSI      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_ORYSJ      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_SACHY      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_MAIZE      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_SACOF      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_SORBI      -------------MNWRSEHIW-------------IELLKGSRKRGNFFWACILFLGSLG
YCF4_CHLSC      -------------MNWRSERIW-------------IELITGSRKTSNFCWACILFLGSLG
YCF4_CALFG      -------------MNWRSERIW-------------IELITGSRKTSNFCWACILFLGSLG
YCF4_DIOEL      -------------MNWRSEHIW-------------IELITGSRKTSNFCWACILFLGSLG
YCF4_DRIGR      -------------MNWRSERIW-------------IELITGSRKISNFCWACILFLGSLG
YCF4_LIRTU      -------------MNWQSERIW-------------IELITGSRKTSNFCWACILFLGSLG
YCF4_ILLOL      -------------MNWRSERIW-------------IELITGSRKTSNFCWACILFLGSIG
YCF4_NYMAL      -------------MNWRSEHIW-------------IELITGSRKISNFCWACILFLGSLG
YCF4_AMBTC      -------------MNWRSERIW-------------IELITGSRKTSNLCWACILFLGSLG
YCF4_NANDO      -------------MNWRSERIW-------------IELITGSRKTSNFFWACILFLGSLG
YCF4_CERDE      -------------MNWRSERIW-------------IEVITGSRKTSNFFWACILFLGSLG
YCF4_LEMMI      -------------MNWRSEHIW-------------IEFITGSRKTSNFFWACILFLGSLG
YCF4_PIPCE      -------------MNRRSERIW-------------IEFIMGSRKTSNFCWACILLLGSLG
YCF4_BUXMI      -------------MSWRSERIW-------------IELIMGSRKTSNFCWAFILFLGSLG
YCF4_PLAOC      -------------MNWRSERIW-------------IELITGSRKTSNFCWAFILFLGSLG
YCF4_AETCO      -------------MSWRSESIW-------------IELRTGSRKTSNFFWAFILFLGSLG
YCF4_AETGR      -------------MSWRSESIW-------------IEFRTGSRKTSNFFWAFILFLGSLG
YCF4_ARAHI      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_DRANE      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_LOBMA      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_CRUWA      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_ARATH      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_BARVE      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_OLIPU      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_CAPBU      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_LEPVR      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_NASOF      -------------MSWRSESIW-------------IEFITGSRKTSNFCWAFILFLGSLG
YCF4_CUCSA      -------------MNWRSERIW-------------IEFLRGSRKISNFCWAFILFLGSLG
YCF4_GOSBA      -------------MSWRSESIW-------------IEFIVGSRKTSNFCWAFILFFGSLG
YCF4_GOSHI      -------------MSWRSESIW-------------IEFIVGSRKTSNFCWAFILFFGSLG
YCF4_VITVI      -------------MSWRSERIW-------------IELITGSRKTSNFCWAFILFLGSLG
YCF4_PELHO      -------------MSCRSENLW-------------LELIAGSRKTSNFLWALILFLGSFA
YCF4_CITSI      -------------MSWRSEYIW-------------VEFIAGSRKPGNFFWAFILFLGSLG
YCF4_SPIOL      -------------MNWRSERIW-------------VEFITGSRKISNFCWAFILFLGSSG
YCF4_CUSGR      -------------MSWRSEQIW-------------IELIPGSRRGSNFVWAFILFFGSLE
YCF4_CUSOB      -------------MSWRSEQIW-------------IELIPGSRRESNFLWAFILFFGSLE
YCF4_LOTJA      -------------MTWISEDTWQSEE-------VRVDFVTGCRNPRDFFWAFITLLGSVG
YCF4_HUPLU      -------------MNWQSEWLR-------------VEPIMGSRRISNFCWACITSLGALG
YCF4_PHYPA      -------------MNRESDWLW-------------VEPIMGSRRVSNFCWAAILLFGALG
YCF4_ANGEV      -------------MNYQSEWLR-------------IDPIKGSRRFSNLCWAFILVLGAIG
YCF4_ANTFO      -------------MNWESEWFR-------------IELIRGSRRISNFFWAFILLSGALG
YCF4_PSINU      -------------MKRQSEWIR-------------VESIRGARRISNFFWAFILILGALG
YCF4_ADICA      -------------MNSRPTWIQ-------------VEFIRGSRTFVNLCWACILVCGATG
YCF4_CHAGL      -------------MNIKSEFFR-------------VDFIIGARRLSNYFWATVVFLGSLG
YCF4_MARPO      -------------MNLQVDHIR-------------VDFIIGSRRISNFCWAFILLFGALG
YCF4_STAPU      -------------MDTKSEFLW-------------IEKVVGSRRFSNVFWALVVLLGALG
YCF4_ZYGCR      -------------MNIQSDGIR-------------IDLVTGSRRISNLGWASVLLLGTSG
YCF4_CHAVU      ----------MKIKPCKSQVFR-------------LEPIIGSRKYINYFWSFSIFFGAFG
YCF4_CHLAT      --------MTNSSIDSKSDLIR-------------RDPVLGSRRLSNYWWATVILVGASG
YCF4_MESVI      --------MINFSTNS--DLIL-------------RESVVGSRRISNYWWASVVLLGASG
YCF4_CHLRE      -------------MTQNNILIR-------------RYIIVGERRFSNYWWAIVIFLGSCG
YCF4_TETOB      -------------MNQEN-FIR-------------RYFIIGERRFSNYWWATVILIGSFG
YCF4_STIHE      -------------MNSEN-LIR-------------RYVITGSRRLSNYWWASVVFLGAIG
YCF4_OLTVI      -------------MSEEL--IR-------------RYSITGSRRFSNYWWSSVIFLGASG
YCF4_PSEAK      -------------MKPDS--IR-------------RYNVIGSRRISNYWWAIIIGSGGLG
YCF4_NEPOL      -------------MDTTN-LVR-------------RDIVIGSRRVSNYWWASVLLLGGSS
YCF4_CHLVU      -------------MTAQE-LSI-------------RYEVPGARRFGNYIWGSLMCLGGLG
YCF4_EUGGR      MTLSKNENIKAKQKQINLPKIL-------------RQEIKENNKIIKWFYNIVMLLGGIG
YCF4_CYACA      -----------------MKKIK-------------RDKIVGAGKISNYLLLIIMLGGGIS
                                                                        *   

YCF4_RHDSA      FLLAGLSSYLGVQ---------LLPFG-------------NTETIVFIPQGIVMTFYGTI
YCF4_GUITH      FCLTGVGSYFNLH---------TILFV-------------KFSDINFIPQGIVMMFYGTI
YCF4_PORPU      FLLAGLSSYFQTD---------LLPFA-------------NSTELVFIPQGIVMTFYGSV
YCF4_PYRYE      FLLAGLSSYFQVD---------LLPFT-------------NSTDLVFIPQGIVMTFYGSI
YCF4_GRATL      FFLVGLSSYLKIE---------LLPFT-------------KSTDLLFLPQGIIMTFYGTA
YCF4_CYAPA      FILAGISSYTKIN---------LLPFT-------------DTTQFLFIPQGITMLLYGTI
YCF4_SYNPX      FLLASLSSYLGRD---------LLPLG-------------HPAALIFVPQGLVMGLYSIA
YCF4_SYNSC      FLLASLSSYLGRD---------LVPIG-------------HPAALVFVPQGLVMGLYSLA
YCF4_SYNS9      FLLASLSSYLGQD---------LLPFG-------------HPAALIFVPQGLVMGLYSIA
YCF4_SYNPW      FLFASLSSYLGRD---------LLPLG-------------HPAGLVFVPQGLVMGLYSIA
YCF4_SYNS3      FLFASLSSYLGRD---------LLPLG-------------HPAGLVFVPQGLIMGLYSLA
YCF4_PROM3      FTLTCLSSYLGRD---------LLPIG-------------SPSSLLFVPQGLVMGLYGIA
YCF4_PROMM      FTLTCLSSYLGRD---------LLPIG-------------SPSTLLFVPQGLVMGLYGIA
YCF4_SYNR3      FLLTSASSYFGRD---------FLPIG-------------HPAELIWVPQGLVMGAYGVG
YCF4_PROM1      FLLASFSSYFGRD---------FLPLG-------------NPSTLIFVPQGLVMGLYGLA
YCF4_PROMT      FLLASFSSYFGRD---------FLPLG-------------NPSTLIFVPQGLVMGLYGVA
YCF4_PROMA      FSLASLSSYFGID---------LLPLG-------------NPSTLIFVPQGLFMGFYGIA
YCF4_PROMS      FLLASISSYTGRD---------LLPLG-------------NPSTLLFIPQGIIMGAYGVI
YCF4_PROM0      FLLASISSYTGRD---------LLPLG-------------NPSTLLFIPQGIIMGAYGVI
YCF4_PROM9      FLLASISSYTGKD---------LLPLG-------------NPSTLLFIPQGIIMGAYGVV
YCF4_PROM2      FLLASISSYTGRD---------LLPLG-------------NPSALLFIPQGIIMGAYGVI
YCF4_PROM5      FILASISSYTGRD---------LLPLG-------------NPSSLLFIPQGIIMGAYGVI
YCF4_PROMP      FILAAISSYTGRD---------LLPLG-------------NPSTLLFIPQGIIMGAYGVI
YCF4_SYNJA      FTLAGLSSYFHRN---------LLPFS-------------DPASLVFIPQGIAMLFYGVL
YCF4_SYNJB      FTLAGLSSYLHRN---------LLPFS-------------DPASLVFIPQGIAMLFYGVL
YCF4_GLOVI      FLFAGLSPFVETN---------LLPFS-------------DTRGLTRFPQGVTMIFYGAL
YCF4_TRIEI      FLLSGISSYLKVN---------LLIVA-------------DPTQLNFLPQGIAMSFYGLL
YCF4_EMIHU      FFLNGCSSYFNTN---------LLIFS-------------DASSIAFIPQGIILMFYGTV
YCF4_ODOSI      FLLAGISSYFKIN---------FLPFA-------------NPKELAFIPQGLVMSFYGTL
YCF4_THAPS      FLLAGISSYLKIN---------LLPFA-------------NTTELVFIPQGIVMMFYGTL
YCF4_PHATC      FLLAGISSYFKVN---------LLPFT-------------NTTELVFIPQGLVMMFYGAL
YCF4_NOSS1      FFLAGISSYLRVN---------LLIVT-------------DPTQLIFVPQGLVMGLYGTA
YCF4_ANAVT      FLLAGISSYLKVN---------LLIVT-------------DPTQLIFVPQGLVMGLYGTA
YCF4_SYNP6      FLLAGLSSYLQVN---------LLPFS-------------EPTRLAFLPQGLVMGLYGIA
YCF4_SYNE7      LLLAGLSSYLQVN---------LLPFS-------------EPTRLAFLPQGLVMGLYGIA
YCF4_THEEB      FFLAGLSSYLHRN---------LLPIG-------------NPIDLVFIPQGIAIGFYGVA
YCF4_SYNY3      FLLAGLSSYFGKN---------LLIVS-------------DTTGLQFIPQGVALLFYGVA
YCF4_PINKO      FFLVGISSYFGEN---------LIPL-------------LSSQQILFVPQGIVMCFYGIA
YCF4_PINTH      FFLVGISSYFGEN---------LIPL-------------LSSQQILFVPQGIVMCFYGIA
YCF4_GNEPA      FLLVGFSSYIGRN---------LVPP-------------LLSHQILFVPQGIVMCFYGIA
YCF4_CYCTA      FFLVGISSYLGKN---------LIPV-------------LSSQQILFVPQGIVMCFYGIA
YCF4_CUSEX      FFLVGTSSYLGRN---------LISF-------------FPLQQIIFFPQGIVMSFYGIA
YCF4_CUSRE      FVLVGTYSYLGRN---------LISF-------------FPLQQIIFFPQGIVMSFYGIA
YCF4_IPOPU      FLLVGISSYLGRN---------LISF-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_NICSY      FLLVGTSSYLGRN---------LISF-------------FPPQQIIFFPQGLVMSFYGIA
YCF4_TOBAC      FLLVGTSSYLGRN---------LISF-------------FPPQQIIFFPQGLVMSFYGIA
YCF4_ATRBE      FLLVGTSSYLGRN---------LISF-------------FPTQQIVFFPQGIVMSFYGIA
YCF4_NICTO      FLLVGTSSYLGRN---------LISF-------------FPPQQIVFFPQGIVMSFYGIA
YCF4_SOLBU      FLLVGTSSYLGRN---------LLSF-------------FPPQQIIFFPQGIVMSFYGIA
YCF4_SOLLC      FLLVGTSSYLGRN---------LLSF-------------FPPQQIIFFPQGIVMSFYGIA
YCF4_SOLTU      FLLVGTSSYLGRN---------LLSF-------------FPPQQIIFFPQGIVMSFYGIA
YCF4_JASNU      FLLVGTSSYLGRN---------WISF-------------VPSQQFIFFPQGIVMSFYGIA
YCF4_DAUCA      FLLVGTSSYLGRN---------LISL-------------FPSQQILFFPQGIVMSFYGIA
YCF4_PANGI      FLLVGTSSYLGRN---------LISL-------------FPSQQILFFPQGIVMSFYGIA
YCF4_HELAN      FLLVGTSSYLGRN---------LISL-------------FPSQEIVFFPQGIVMSFYGIA
YCF4_LACSA      FLLVGTSSYLGRN---------LISL-------------FPSQEIVFFPQGIVMSFYGIA
YCF4_COFAR      FLLVGISSYLGRN---------LISF-------------FPSQQIVFFPQGIVMSFYGIA
YCF4_MORIN      FLLVGTSSYLGRN---------FIPF-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_POPTR      FLLIGISSYLDRN---------LISL-------------FPSQQILFFPQGIVMSFYGLA
YCF4_POPAL      FLLIGISSYLDRN---------LISL-------------FPSQQIIFFPQGLVMSFYGLA
YCF4_EUCGG      FVLVGSSSYLGKN---------LISL-------------VPSQQILFFPQGIVMSFYGIA
YCF4_OENEH      FVLVGTSSYLGKN---------LISL-------------VSSQQIHFFPQGLVMSFYGIA
YCF4_ACOCL      FLVVGASSYLGRN---------LISV-------------FPSQQIVFFPQGIVMSFYGIA
YCF4_PHAAO      FLVVGTSSYLGKN---------LISV-------------FPSQQILFFPQGIVMSFYGIA
YCF4_LOLPR      FLSVGASSYLGKN---------IISI-------------LPSQQILFFPQGVVMSFYGIA
YCF4_AGRST      FLSVGASSYLGKN---------IISI-------------LPSQQILFFPQGVVMSFYGIA
YCF4_HORVU      FLLVGTSSYLGKN---------IISI-------------LPSQEILFFPQGVVMSFYGIA
YCF4_WHEAT      FLSVGISSYLGKN---------IISI-------------LPSQEILFFPQGVVMSFYGIA
YCF4_ORYNI      FLAVGASSYLGKN---------IISV-------------LPSQQILFFPQGVVMSFYGIA
YCF4_ORYSA      FLAVGASSYLGKN---------IISV-------------LPSQQILFFPQGVVMSFYGIA
YCF4_ORYSI      FLAVGASSYLGKN---------IISV-------------LPSQQILFFPQGVVMSFYGIA
YCF4_ORYSJ      FLAVGASSYLGKN---------IISV-------------LPSQQILFFPQGVVMSFYGIA
YCF4_SACHY      FLAVGASSYLGKN---------MISV-------------LPSQQILFFPQGVVMSFYGIA
YCF4_MAIZE      FLAVGASSYLGKN---------MISV-------------LPSQQILFFPQGVVMSFYGIA
YCF4_SACOF      FLAVGASSYLGKN---------MISV-------------LPSQQILFFPQGVVMSFYGIA
YCF4_SORBI      FLAVGASSYLGKN---------MISL-------------LPSQQILFFPQGVVMSFYGIA
YCF4_CHLSC      FLLVGTSSYLGKN---------LISL-------------LPSQQILFFPQGIVMSFYGIA
YCF4_CALFG      FLLVGTSSYLGRN---------LISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_DIOEL      FLVVGTSSYLGRN---------LISV-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_DRIGR      FLLVGTSSYLGRN---------LISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_LIRTU      FLLVGTSSYLGRN---------LISL-------------FPSQQILFFPQGIVMSFYGIA
YCF4_ILLOL      FLLVGISSYLGRN---------LISL-------------FPSQQILFFPQGIVMCFYGIA
YCF4_NYMAL      FLLVGTSSYFGRN---------LISL-------------FPSQQIVFFPQGIVMCFYGIA
YCF4_AMBTC      FLLVGTSSYLGRN---------LISL-------------FPSQQILFFPQGIVMSFYGIA
YCF4_NANDO      FLLVGTSSYLGRN---------LISL-------------FPSQQILFFPQGIVMSFYGIA
YCF4_CERDE      FLLVGTSSYLGRN---------LISL-------------FPSQQIPFFPQGIVMSFYGIA
YCF4_LEMMI      FLVVGTSSYLGRN---------LISV-------------FPSQQISFFPQGIVMSFYGIA
YCF4_PIPCE      FLLVGISSYLGRN---------LISL-------------FPSQQINFFPQGIVMSFYGIA
YCF4_BUXMI      FLLVGTSSYIGRN---------LISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_PLAOC      FLLVGTSSYLGRN---------LISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_AETCO      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_AETGR      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_ARAHI      FLLVGTSSYLGRN---------FISV-------------FASQQIIFFPQGIVMSFYGIA
YCF4_DRANE      FLLVGTSSYLGRN---------FISL-------------FASQQIIFFPQGIVMSFYGIA
YCF4_LOBMA      FLLVGTSSYLGRN---------FISL-------------FASQQIIFFPQGIVMSFYGIA
YCF4_CRUWA      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_ARATH      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_BARVE      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_OLIPU      FLLVGTSSYLGRN---------VISL-------------FPSQEIIFFPQGIVMSFYGIA
YCF4_CAPBU      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_LEPVR      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_NASOF      FLLVGTSSYLGRN---------VISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_CUCSA      FLLVGTSSYLGRD---------LISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_GOSBA      FLLVGTSSYLGRN---------LISL-------------FPSQQIVFFPQGIVMSFYGIA
YCF4_GOSHI      FLLVGTSSYLGRN---------LISL-------------FPSQQIVFFPQGIVMSFYGIA
YCF4_VITVI      FLLVGTSSYLGRN---------LISL-------------FPSQQIIFFPQGIVMSFYGIA
YCF4_PELHO      FLLVGTSSYLGRN---------WISL-------------FPSQQILFFPQGVVMSFYGIA
YCF4_CITSI      FLVVGISSYLDRN---------LLSL-------------FPSQQINFFPQGIVMSFYGIA
YCF4_SPIOL      FLLVGISSYLGKN---------FISL-------------FPPQQILFFPQGLVMSFYGIA
YCF4_CUSGR      FILVGTASYFSQN---------LIA---------------------FFPQGMVMIFYGIS
YCF4_CUSOB      FILVGTASYLRQN---------LIA---------------------FFPQGMVMTFYGIS
YCF4_LOTJA      FLLVAASSYLHKN---------FLSFI---------SSEFDSELIRFLPQGATITVYGTA
YCF4_HUPLU      FFLVGIPSYLGKD---------LIPV-------------LPSQQIVFVPQGIVMCFYGIA
YCF4_PHYPA      FFFVGISSYFGKD---------LIPF-------------LSSQQILFVPQGVVMCFYGIA
YCF4_ANGEV      FSLVGFSSYLGRD---------LIPI-------------LSSQQIIFLPQGIVMCFYGIA
YCF4_ANTFO      FLSVGLSSYFGKD---------LISF-------------LSYEQIVFIPQGIVMCFYGIA
YCF4_PSINU      FLLVGSSSYLGRD---------LIPL-------------LPSQQIVFIPQGIVMCFYGIA
YCF4_ADICA      FLLVGFSSCIGKD---------LIPI-------------LSSKQIAFIPQGLVMCFYGIA
YCF4_CHAGL      FFIVGVSSYLQKN---------IVFF-------------LSASDILFTPQGIVMCFYGIA
YCF4_MARPO      FFFVGFSSYLQKD---------LIPF-------------LSAEQILFIPQGIVMCFYGIA
YCF4_STAPU      FILVGLSSYLNKD---------IISFL----------PSQ---SITFTPQGLVMCFYGIG
YCF4_ZYGCR      FLLTGLSSYLGKD---------LIPFL---------YPSEEHMKIAFAPQGLVMCFYGIA
YCF4_CHAVU      FLIVGICSYLKKE---------LFFF--------------SAENIIFIPQGAVMCFYGIA
YCF4_CHLAT      FFLVGISSYFGFN---------LVPFIKSEE-------------ILFIPQGLVMSFYGVA
YCF4_MESVI      FLIVGISSYLQYD---------LVPFLSAKN-------------IVFVPQGLVMCFYGSA
YCF4_CHLRE      FLATGICSYLGIP--------NWLSLLNIGTTFSSETETLASGIVPFFPQGLLMSFYGSL
YCF4_TETOB      FLLTGISSYISTSLNSTALSSNIESQMQLPFFLSMLKNSNSTGAINFFPQGLLMCFYGSL
YCF4_STIHE      FLFTGLSSYFGQN---------LLPFLQVQN-------------ITFFPQGLVMSFYGIL
YCF4_OLTVI      FLLTGLSSYLNVN---------LLPFIHAEN-------------IIFFPQGLVMCFYGIL
YCF4_PSEAK      FLFTGLSSYLQFN---------LLPIIHAEK-------------IIFFPQGLVMSFYGIL
YCF4_NEPOL      FLVVGLSSRLGFD---------LVPFLPAGD-------------IIFIPQGLVMCFYGLV
YCF4_CHLVU      FLTIGISSYLDFP---------ILSLVKSSN-------------IQFFPQGLVMCFYGVL
YCF4_EUGGR      FLIVGISSYIGN---------NLIYFL-------------DASEIIFFPQGITMCFYGTC
YCF4_CYACA      FFIVGFLSYFKAFE-----HIALFSRF-------------VNSDIRFIPQGITMIFYGTM
                :      .                                        ***  :  *.  

YCF4_RHDSA      GILLSLFLLLNISLNVGGGYNSYDKSTGAIQIFRLGFPGKRRKILLQYKIQEIKSIKLSI
YCF4_GUITH      AILFSLFLMYSIFTDVGGGYNKYDKEKKEIEIFRLGYNKKNKQMLLKYNFRDIKSIKIEL
YCF4_PORPU      GIFLSMFLWLTIIWNIGAGYNEFNKNEGIVKIFRLGFPGKNRQICLKFNIKEIKSIKIDI
YCF4_PYRYE      GVFLSLFLWLTIIWNIGAGYNEFNKDKGIVKIFRLGFPGKNRKICLQFNIKEIKSIKIDI
YCF4_GRATL      AILISLFLWLTIIWNIGSGYNEFNRDIGLVTIYRLGFPGKNRLIKLRYKIHDIYSIKVQI
YCF4_CYAPA      GFLLDIYLWLLILWNVGAGYNEYNKKKGTVSIFRWGFPGTNRRIEVIYPIEQIQAIKLEI
YCF4_SYNPX      AALLATYLWYVIAVDVGGGSNRFDKAAGVVTVSRRGF---RKPVLVEIPLKDVKAVKVEV
YCF4_SYNSC      AALLATYLWYVIAVNVGGGSNRFDKDAGVVTISRRGF---RKPVLVEIPLKDVKAVKVEV
YCF4_SYNS9      AALLASYLWYVIAVDVGSGSNRFDKESGVVVISRRGF---RRPVCVEFPLKDVKAVKVEV
YCF4_SYNPW      AALLATYLWAVIAIDVGSGSNRFDKQAGVITISRRGF---RKPISVEIPLKDVQAVKVEV
YCF4_SYNS3      AALLASYLWAVITINVGSGSNRFDRSAGVVTISRRGF---RQPISVEIPIKDIQAVKVEV
YCF4_PROM3      GLLLASYLWAMININLGAGSNNFDKASGMVKICRRGY---FKLISAEFPLKDVKAVKVEV
YCF4_PROMM      GLLLASYLWAMININLGAGSNNFDKASGMVKICRRGY---FKLISAEFPLKDVKAVKVEV
YCF4_SYNR3      AVLLSSYLWAVIAIDVGGGRNLFDRGADTITIERRGF---RRLISFTLPCGDVQAVKVEV
YCF4_PROM1      AFLLAIYFWRLINIDYGSGVNRFDKNKGVLSLSRRGL---FKNIEIEIPIDEIKAVKLEV
YCF4_PROMT      AFLLAIYFWRLINIDYGSGVNRFDKNKGVLSLSRRGL---FKNIEIEIPIDEIKAVKLEV
YCF4_PROMA      ATFISVYLWALIKVDYGSGLNRFDKNKGVLSVSRKGL---LKEILVEIPIDDIQAVKLEV
YCF4_PROMS      ANLLNFYLWYLVYINFGSGSNYFDKSSKSVEIKRKGL---FKDVEVKLNFDEIKSVKLDI
YCF4_PROM0      ANLLNFYLWYLVYINFGSGSNYFDKSSKSIEIRRKGL---FKDIEVKLNFDEIKSVKLDI
YCF4_PROM9      ANLLNFYLWYMVYINFGSGSNSFNKSSKSVEIKRKGL---FKDIDVKLNFDEIKSVKLDI
YCF4_PROM2      ANLLNFYLWYMVYINFGSGSNSFDKSSKSVEIKRKGL---FKDIEVRLDFDEIKSVKLDI
YCF4_PROM5      ANLLNIYLWYLVFINFGSGYNSFDKVSQSVEIKRKGL---FKDIEVKLNFDEIKSVKLDI
YCF4_PROMP      ANLLNIYLWYLVFINFGSGYNFFDKDSQSVEIKRKGL---FKDIEVKLSFDEIKSVKLDI
YCF4_SYNJA      GSLAGLYQWLSLYWNLGGGYNEFDRRTQKITLVRQGFPGKNREVRLEYDFAEVQSLRVEL
YCF4_SYNJB      GSLAGLYQWLSLYWNLGGGYNEFDRRTQKITLVRQGFPGKNREVRLEYDFADVQSLRVEL
YCF4_GLOVI      ATLFSLYYWLVLALDVGSGYNEFDKQNKKVTLFRRGFPGKNRIIEIVHPLENILGLKVQI
YCF4_TRIEI      GTIYGIFLWLTVIWDLGGGYNDFNQESGQIMIFRRGFPGKNRKVEFNCTTENVQSIKVDI
YCF4_EMIHU      ALILGLFLCLTIIWDVGFGYNDYNAD--QITVYRKGFPGKNRELNLTFPSEVVKSIKVRV
YCF4_ODOSI      SIALAIYILGTLFWDIGSGYNEYNKVENLVKIVRKGFPGKNREILLTYPLTNIRAIGIKI
YCF4_THAPS      SFGLSIYIMATLFWDIGSGYNEYNKVENLVKVVRRGFPGKNREILLTYPLNNIRSIGIKI
YCF4_PHATC      SLGISIYTLLTIILDIGSGYNEYNRIENLVKVVRKGFPGKNREILLTYSLSNVRAIGIKI
YCF4_NOSS1      GLLLASYLWLVILWDLGGGYNDFNRETGNIKIFRWGFPGKNRKIEIGSRIQDIQSVRVDI
YCF4_ANAVT      GLLLASYLWLAILWDLGGGYNDFNRETGNIKIFRWGFPGKNRKIEIGSRIQDIQSVRIDI
YCF4_SYNP6      AILLASYLWFVISLDVGGGYNAFDRKTQKATIFRWGFPGKNRRVEITYPLSDIQAVRVDI
YCF4_SYNE7      AILLASYLWFVISLDVGGGYNAFDRKTQKATIFRWGFPGKNRRVEITYPLSDIQAVRVDI
YCF4_THEEB      ALLLATYLWLAIAWDVGGGFNEFNKETGFVRIFRWGFPGKNRQIEVSCPISDVQAVKIVI
YCF4_SYNY3      GSTVAGYLWLTMALNVGSGYNEFNKKSGQVTIFRWGFPGKNRRIELINKIADVQAVKAEI
YCF4_PINKO      GLFISSYLWCTILFNVGSGYNKFDKKKGIVCLFRWGFPGINRRIFSRFLMKDIQMIKTEI
YCF4_PINTH      GLFISSYLWCTILFNVGSGYNKFDKKKGIVCLFRWGFPGINRRIFPRFLMKDIQMIKMEI
YCF4_GNEPA      GLFFSSYLWCTILFNVGGGYNKIMKKKEFYVFFAGVSQGKIVVFFLRVPLKNVQTIKMEV
YCF4_CYCTA      GLFISSYLWCTILWNVGSGYDKFDEEEGIVCLFRWGFPGRNRRTFLRFLMKDIQAIKMEV
YCF4_CUSEX      GLFISSYLWCTISWNVGSGYDLFNRKEGIVCIFRWGFPGINRRIFLRFLLKDIRSVRIEV
YCF4_CUSRE      GLFISSYLWCTISWNVGSGYDLFNRKEGIVCIFRWGFPGINRRIFLRFLLKDIRSVRIEV
YCF4_IPOPU      GLFISSYLWCTISWNVGSGYDLFDRREGIVCIFRWGFPGRNRRIFLRFLIKDIRSVRIEV
YCF4_NICSY      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_TOBAC      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_ATRBE      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_NICTO      GLFISSYLWCTISWNVGSGYDRFDIKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_SOLBU      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_SOLLC      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_SOLTU      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_JASNU      GLFISSYLWCTISWNIGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_DAUCA      GLFISSYLWCTISWNVGGGYDRFDRKEGMVCLFRWGFPGKNRRIFLRFLIKDIQSVRIEV
YCF4_PANGI      GLFISSYLWCTLSLNVGGGYDRFDRKEGMVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEA
YCF4_HELAN      GLFISSYLWCTISWNVGSGYDRFDIKDGIVCIFRWGFPGKNRRVFLRFLIKDIQSVRIEV
YCF4_LACSA      GLFISSYLWCTISWNVGSGYDRFDRKDGIVCIFRWGFPGKNRRVFLQFLIKDIQSVRIEV
YCF4_COFAR      GLFISSYLWCTISWNVGNGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSIRIEV
YCF4_MORIN      GLFISSYLWCTISWNVGSGYDRFDIKEGIVCIFRWGFPGKNRRIFLRFLMKDIQSIRIEV
YCF4_POPTR      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRILLRLFMKDIQSIRIEV
YCF4_POPAL      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRILLRLFMKDIQSIRIEV
YCF4_EUCGG      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFRMKDIQSIRIEV
YCF4_OENEH      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFRMKDIQSIRIEV
YCF4_ACOCL      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRFFIRDIQSIRIEV
YCF4_PHAAO      GLFISSYLWCTISWNVGSGYDRFDRKEGIMSLFRWGFPGRDRRIFLRFFLKDIQSIRMEV
YCF4_LOLPR      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLQFLMRDIQSIRIQV
YCF4_AGRST      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLQFLMRDIQSIRIQV
YCF4_HORVU      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLRFLMRDIQSIRIQV
YCF4_WHEAT      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLRFLMRDIQSIRIQV
YCF4_ORYNI      GLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRFLMRDIQSIRIQV
YCF4_ORYSA      GLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRFLMRDIQSIRIQV
YCF4_ORYSI      GLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRFLMRDIQSIRIQV
YCF4_ORYSJ      GLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRFLMRDIQSIRIQV
YCF4_SACHY      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRIFLQFLVRDIQSIRIQV
YCF4_MAIZE      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRIFLQFLVRDIQSIRIQV
YCF4_SACOF      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRIFLQFLVRDIQSIRIQV
YCF4_SORBI      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRIFLQFLVRDIQSIRIQV
YCF4_CHLSC      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRFLMRDIQSIRMEV
YCF4_CALFG      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRFLMRDIQSIRMEV
YCF4_DIOEL      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRFLMRDIQSIRMQV
YCF4_DRIGR      GLFISSYLWCTISWNVGSGYDRFDRKEGVVCIFRWGFPGINRRIFLRFLMRDIQSIRMEV
YCF4_LIRTU      GLFISSYLWCTISWNVGSGYDLFDRKEGIVCIFRWGFPGINRRIFLRFLMRDIQSIRMEV
YCF4_ILLOL      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRFRMRDIRSIRMKV
YCF4_NYMAL      GLFISSYLWCTISWSVGSGYDKFDRKEGIVCIFRWGFPGRNRRIFFRFRIRDIRSIRIEV
YCF4_AMBTC      GLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGRNRRIFFRFLMRDIRSIRMEV
YCF4_NANDO      GLFISSYLWCTIWWNVGSGYDQFDRKEGIVCIFRWGFPGRNRRIFLRFLMRDIQSIRIEV
YCF4_CERDE      GLFISSYLWCTISWNVGSGYDRFDRKEGIVYIFRWGFPGKNRRIFLRFLMKDIQSIRMEV
YCF4_LEMMI      GLFISSYLWSTILWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIVLRFLMSDVQSIRVEV
YCF4_PIPCE      GLFISSYLWSTILWNIGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRVFMGDIQSIRIEV
YCF4_BUXMI      GLFISSYLWCTISWNVGGGYDRFDRKEGRVCIFRWGFPGINRRIFLRFLMRDIQSIRIEV
YCF4_PLAOC      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFFMKDIQSIRIEV
YCF4_AETCO      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFLMKDIQSIRIEV
YCF4_AETGR      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFLMKDIQSIRIEV
YCF4_ARAHI      GLFISCYLWCTFLWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFLMKDIQSIRIEV
YCF4_DRANE      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFLMKDIQSIRIEV
YCF4_LOBMA      GLFISCYLWCTIFWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFLMKDIQSIRIEV
YCF4_CRUWA      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFFMKDIQSIRIEV
YCF4_ARATH      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFFMKDIQSIRIEV
YCF4_BARVE      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFFMKDIQSIRIEV
YCF4_OLIPU      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFFMKDIQSIRIEV
YCF4_CAPBU      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKTRRIFLRFFMKDIQSIRIEV
YCF4_LEPVR      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFLMKDIQSIRIEV
YCF4_NASOF      GLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRFLMKDIQSIRIEV
YCF4_CUCSA      GLFISSYLWCTILWNVGSGYDRFDRKEEIVSIFRWGFPGKNRRIFLRFLMKDIQSIRIEV
YCF4_GOSBA      GLFISSYLWCTIFWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLMKDIQSIRIEV
YCF4_GOSHI      GLFISSYLWCTIFWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLMKDIQSIRIEV
YCF4_VITVI      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRLLMKDIQSIRIAV
YCF4_PELHO      GLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGRNRRIFLRFLMKDIQSIRIEA
YCF4_CITSI      GLFISSYLWCTIIWNVGSGYDRFDTKEGIVCIFRWGFPGKNRRIFLRFLMKDIQSIRIEV
YCF4_SPIOL      GLFISAYLWCAISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFFRYLIKDIQSIRIEL
YCF4_CUSGR      GLFISLYLSSMLFWNVGGGYNQFDKTRGVICIFRWVFPGRNRRLLLRFFMKDIRSIRIEV
YCF4_CUSOB      GLFISLYLLSMLFWNVGGGYHQFDKTRGVICIFRWVFPGRNRRLLLRFFMKDIRSIRIEV
YCF4_LOTJA      GLFVSLFLWLTIFWNVGSGYDLFDKKRGIVCIFRYGFPGKNRRIFIRVLINDIQSLIIQS
YCF4_HUPLU      GLFPSFYLWCTILWNVGSGYNIFDKREGIICLFRWGFPGENRRICIRFSMKDIQAIRVEV
YCF4_PHYPA      GLFLSFYLWCTIFWNVGSGYNKFDKKKKIVSLFRWGFPGENRRICINFFMKDIQGIRMEV
YCF4_ANGEV      GIFLGFYLWCTILWNVGSGYNQFNKREGIVYLFRWGFPGENRRICIRFMIKDIQAIRMEI
YCF4_ANTFO      GSAFSLYLWGTIFWNIGSGYNKFDKGKGIVCIYRWGFPGKNRRIRIEFSMKDIEAIGMEV
YCF4_PSINU      GISIGFYLGFAISWDIGNGYNLFDKQRGIVRIFRWGFPGENRRICIQFFMKDIQAIGLEI
YCF4_ADICA      GLFLGLYLCCTVFWNVGSGYNYFDKREGISSIFRWGFPGKNRRIHIRLILGDIEAVGLRS
YCF4_CHAGL      GLFLSFYLWFTIFLDIGSGYNEFDKKKGIISIFRWGYPGQNRRIKLSFPIKDVQAIKLEV
YCF4_MARPO      GLFISFYLWCTICWNVGSGYNKFDKQKGIFSIFRWGFPGKNRRIFIQFLIKDIQSIRMEV
YCF4_STAPU      GFFLSLYLWFAILWDVGSGYNEFDRCEGVISIFRWGFPGKNRRIRIRFLVEDVQSIRLEL
YCF4_ZYGCR      GLFLSTYLWCAILWNVGGGYNEFDRQEGTITIFRWGFPGQNRRIRIRCLIKDVKAVRIET
YCF4_CHAVU      GIFLSFYLWFTMILGVGSGFNEFNKNEGIVNIFRWGFPGQNRRIKICCLIKDIKSIRIYI
YCF4_CHLAT      GILLSVYLWLTIIWNVGEGYNEYNKQDGIVRIFRWGFPGKNRRIDLVYPIQDVQAIRVEI
YCF4_MESVI      GILLSIYLWLTIFWNVGEGYNEFDKVNGLVRIFRWGYPGKDRRINIVYDIKDIQAIRVEI
YCF4_CHLRE      GFLLSIYWSLLIFWNVGGGFNEFNKKEGFVRIFRWGYPGKNRKIDLSYSLKDIEAIRVEL
YCF4_TETOB      GFLLSIYWWCLIFWNVGGGFNEFNKKENFIRIFRWGYPGKNRKIDLYYTLKDVESIRVEI
YCF4_STIHE      GLLLSIYLWLTIIWNVGGGFNEFNKKAGAIRIFRWGFPGKTRCIDISYSLKEVEAIKVDF
YCF4_OLTVI      GLIFSVYLGLTIFWSVGSGFNEFNKKDGLVRIFRWGFPGKNRRIDLSYALTDVEAIRVEL
YCF4_PSEAK      GIFFSLYLGLTILFSVGEGFNEFNKELGIIRIFRWGFPGKNRRIDLSYSIDDVKAIRVEL
YCF4_NEPOL      GLVVSTYLWLTILWSVGGGYNEFNKQEGVMRIFRWGFPGRDRRIQLTCPLQDIEAIRVEL
YCF4_CHLVU      GFLLGVYIWLLILWNLGEGFNEFNLETGYVRIFRWGFPGKNRRIDLQYPIQEIQSIRVEI
YCF4_EUGGR      GILFSINQISIILNGVGEGYNEFNKELNLMTIYRKGKQGKNSDINITYSLKDIEGIRIEI
YCF4_CYACA      AICLSIYIYFSIYYDIGAGYNEFNLISKKVVVFRKGFPGKNRLIKFVLPIPHLKSVKVMA
                .          .  . * * .          .                    :  :    

YCF4_RHDSA      A-----EGLNPKR--EIYLQTKDQRQ-IPLTRVGEPL-LLSQIEEEAVELANFLNIPLEG
YCF4_GUITH      K-----DDINPKR--EIYLVTKNKNQ-IPLTRIGEPL-LLSDVENQAIELANFLNIPIEG
YCF4_PORPU      K-----EGLNPRR--EIYLCTKDKRN-IPLTRVGQPL-LLSEVEEQAAEIARFLDVVLEG
YCF4_PYRYE      K-----EGLNPRR--EIYLCTKDKRV-IPLTRVGQPL-LLSEVEEQAAEIARFLDVVLEG
YCF4_GRATL      Q-----EGLTPKR--EIYLKTKDKRE-IPLTQVGQPM-SLAQIEERAAFLAKFLGVILEG
YCF4_CYAPA      K-----QGLNPRH--SISLKIQEKNE-IVITPIGYLL-PISVVEEQAANLASFLNIPLDS
YCF4_SYNPX      R-----DGFNARR--RVALRIQGRRD-MPLTRVGEPL-PLAQLEQDGAELARFLGVNLEG
YCF4_SYNSC      R-----DGFNARR--RVALRIQGRRD-MPLTRVGEPL-PLAQLEKDGAELARFLGVNLEG
YCF4_SYNS9      R-----DGFNARR--RVSLRLQGRRD-LPLTRVGEPL-PLAQLEQEGAELARFLGVNLEG
YCF4_SYNPW      R-----DGFNTRR--RVSLRVQGRRD-MPLTRVGEPL-PLAQLEQDGAELARFLGVNLEG
YCF4_SYNS3      R-----DGFNTRR--RVSLRVRGRRD-MPLTRVGEPL-PLAQLEQDGAELARFLGVNLEG
YCF4_PROM3      R-----DGFNPLR--RLSLRVQGRRD-ITLTRVGQPL-PLAQLEQDGAELARFLDVNLEG
YCF4_PROMM      R-----DGFNPLR--RLSLRVQGRRD-ITLTRVGQPL-PLAQLEQDGAELARFLDVNLEG
YCF4_SYNR3      R-----DGLNPRR--RLALRLRGRRD-VPLTRVGEPI-ALAELERSGAELARYLNVPLEG
YCF4_PROM1      R-----EGFNPLR--RVSLRIKGRKD-LPISRVGSPK-PLLDLENEGAEIARFLEVNLEG
YCF4_PROMT      R-----EGFNPLR--RVSLRIKGRKD-LPISRVGSPQ-PLLDLENEGAEIARFLEVNLEG
YCF4_PROMA      R-----EGFNPRR--RITLRLQGRRD-LPISEVGGPQ-PLLSLEQEGAEIARFLKVNLEG
YCF4_PROMS      S-----EGFNPRR--RIALVLKGRKKPLPLSGAGELK-PLLQVEEEGARLAKFLDVNLEG
YCF4_PROM0      S-----EGFNPRR--RIALVLKGRKKPLPLSGAGELK-PLLQVEEEGARLAKFLDVNLEG
YCF4_PROM9      S-----EGFNPRR--RIALVLKGRKKPLPLSGAGELK-PLLQVEEEGARLAKFLNVNLEG
YCF4_PROM2      S-----EGFNPRR--RIALVIKGRKKPLPISGAGELK-PLLQVEEEGARLAKFLNVNLEG
YCF4_PROM5      S-----EGFNPRR--RIALVLKGRKKALPLSGAGELK-PLLQVEEEGARLAKFLNVNLEG
YCF4_PROMP      S-----EGFNPRR--RIALVLKGRKKPLPLSGAGELK-PLLQVEEEGARLAKFLNVNLEG
YCF4_SYNJA      R-----EGFNPRR--AIYLRIKGRGD-IPLTGVGQPP-PLAEIENQAAEIARFLNVSLEG
YCF4_SYNJB      R-----EGLNPRR--AIYLRVKGRGD-IPLTGVGQPP-PLTEIENQAAEIARFLNVSLEG
YCF4_GLOVI      K-----EGLNPRR--AYFLKLKGARD-LRLSPVGQPQ-PLAAVEDQVSAIARFLNIGVEG
YCF4_TRIEI      K-----EGLNPRR--AIYLCLKDRRQ-IPLTRVGQPL-ALSKLENEAAQLAKFLQVPLEG
YCF4_EMIHU      T-----EGLNPRR--QLFLCLKDSRE-IPLTGVDQPA-ALNKIENEAVTLAKYLNVFLET
YCF4_ODOSI      S-----EGLNPKR--SIYLCLKDERQ-IPLTPVQQPN-SISNLEEEAAELAKFLDLKLEN
YCF4_THAPS      S-----EGLNPQR--IIYLCLKDERK-IPLTPVQQPD-SISDLEDQAADLAKFLDLKLEN
YCF4_PHATC      T-----EGLNPTR--SIYLCLKDERN-IPLTPVQEPT-AISNLEEEATDLAKFLDLRLEN
YCF4_NOSS1      K-----EGLNPRR--ALYLRVKGRRD-IPLTRVGQPL-SLAELETQGAQLARFLGVPLEG
YCF4_ANAVT      K-----EGLNPRR--ALYLRVKGRRD-IPLTRVGQPL-SLAELETQGAQLARFLGVPLEG
YCF4_SYNP6      K-----EGLNPKR--ALYLKVKGRGD-VPLTRVGQPL-PLTELESQGAELARFLAVPLEG
YCF4_SYNE7      K-----EGLNPKR--ALYLKVKGRGD-VPLTRVGQPL-PLTELESQGAELARFLAVPLEG
YCF4_THEEB      K-----EGLNPKR--SLYLKIKGRGE-VPLTRVGAPL-PLAELETQGATIASFLGVPVEG
YCF4_SYNY3      K-----EGVNPKR--SLYLKVKQRRD-IPLTRAGQPI-SLSQLENQGAELARFLGVPLEG
YCF4_PINKO      Q-----EGIS-PRR-VLYMEIKGRQD-IPLTRTGDNV-NLREIEQKAAESARFLRVSIEG
YCF4_PINTH      Q-----EGIS-PRR-VLYMEIKGRQD-IPLTRTGDNV-NLREIEQKAAESARFLRVSIEG
YCF4_GNEPA      Q-----ESLFYSRH-VLYMKVKGLPD-IPLARTGDHF-NLSEMEQKAAELAHFLRVSIEG
YCF4_CYCTA      Q-----EGLY-PRR-VLYMEIKGQRD-IPLARTGENL-TLREMEQKAAELARFLRISIEV
YCF4_CUSEX      E-----EGIYAGR--VLYMDIRGQRA-IPLTRTDENL-TPGEIEKKAAELAYFLRVPIEV
YCF4_CUSRE      E-----EGIYAGR--VLYMDIRGHRA-IPLTRTDENL-TPGELEKKAAELAYFLRVPIEV
YCF4_IPOPU      K-----EGIYARR--VLYMDIRGQRA-IPLTRTDENL-TPGEIEKKAAELAYFLRVPIEV
YCF4_NICSY      K-----EGISARR--VLYMDIRGQGS-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_TOBAC      K-----EGISARR--VLYMDIRGQGS-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_ATRBE      K-----EGISARR--VLYMDIRGQGS-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_NICTO      K-----EGIYARR--VLYMDIRGQGS-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_SOLBU      K-----EGIYARR--VLYMDIRGQGS-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_SOLLC      K-----EGIYARR--VLYMDIRGQGS-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_SOLTU      K-----EGIYARR--VLYMDIRGQGS-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_JASNU      K-----EGLYARH--VLYMDIRGQGA-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_DAUCA      K-----EGIYARR--VLYMDIRGQGA-IPLTRTDENV-TPREIEQKAAELAYFLRVPIEV
YCF4_PANGI      K-----EGIYARR--VLYMDIRGQGA-IPLTRTDENV-TPREIEQKAAELAYFLRVPIEV
YCF4_HELAN      K-----EGIYARR--VLYMDIRGQGA-IPLTRTDENF-TPREMEQKAAELAYFLRVPIEV
YCF4_LACSA      K-----EGIYARR--VLYMDIRGQGA-IPLTRTDENF-TPREMEQKAAELAYFLRVPIEV
YCF4_COFAR      K-----EGIFARR--VLYMEIRGQGT-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_MORIN      K-----EGIYARR--VLYMEIRGQGS-IPLTRTDENL-TLREIEQKAAELAYFLRVPIEV
YCF4_POPTR      K-----EGFYARR--VLYMEIRGQGA-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_POPAL      K-----EGFYARR--VLYMEIRGQGA-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_EUCGG      K-----EGISARR--VLYMEIKGQGA-VPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_OENEH      K-----EGIYARR--VLYMEIKGQGA-IPLTRSDDNL-TLREIEQKAAELAYFLRVPIEV
YCF4_ACOCL      K-----EGLYSRR--VLYMEIRGQGA-IPLTRTDENL-TPREIEQKAADSAYFLRVPIEV
YCF4_PHAAO      R-----EGLFPRR--VLYMEIKGQGA-IPLTRTDEDL-TPREIEQKAAELAYFLRVPIEV
YCF4_LOLPR      K-----EGLSPRR--ILYMEIRGQGV-IPLTRTDEKFFTPREMEQKAAELAYFLRVPIEV
YCF4_AGRST      K-----EGLYPRR--ILYMEIRGQGV-IPLTRTDEKFFTPREIEQKAAELAYFLRVPIEV
YCF4_HORVU      K-----EGLYPRR--ILYMEIRGQGI-IPLTRTDDKFFTPREIEQKAAELAYFLRVPIEV
YCF4_WHEAT      K-----EGLYPRR--ILYMEIRGQGI-IPLTRTDDKFFTPREIEQKAAELAYFLRVPIEV
YCF4_ORYNI      K-----EGLFPRR--ILYMEIRGQGA-IPLTRTDEKFFTPREIEQKAAELAYFLRIPMEV
YCF4_ORYSA      K-----EGLFPRR--ILYMEIRGQGA-IPLTRTDEKFFTPREIEQKAAELAYFLRIPMEV
YCF4_ORYSI      K-----EGLFPRR--ILYMEIRGQGA-IPLTRTDEKFFTPREIEQKAAELAYFLRIPMEV
YCF4_ORYSJ      K-----EGLFPRR--ILYMEIRGQGA-IPLTRTDEKFFTPREIEQKAAELAYFLRIPMEV
YCF4_SACHY      K-----EGLYPRR--ILYMEIRGQGV-IPLTRTDEKFFTPREIEQKAAELAYFLRVPIEV
YCF4_MAIZE      K-----EGLYPRR--ILYMEIRGQGV-IPLTRTDEKFFTPREIEQKAAELAYFLRVPIEV
YCF4_SACOF      K-----EGLYPRR--ILYMEIRGQGV-IPLTRTDEKFFTPREIEQKAAELAYFLRVPIEV
YCF4_SORBI      K-----EGLYPRR--ILYMEIRGQGV-IPLTRTDEKFFTPREIEQKAAELAYFLGVPIEV
YCF4_CHLSC      K-----EGLYSRR--VLYMEIRGQGA-IPLTRTDDNL-TPREIEQKAAELAYFLRVPIEL
YCF4_CALFG      K-----GGLYSRR--VLYMEIRGQGA-IPLTRTDENF-TPREIEQKAAELAYFLRVPIEL
YCF4_DIOEL      K-----EGLYPRR--VLYMEIRGQGA-IPLTRTDENF-TPREIEQKAAELAYFLRVPIEG
YCF4_DRIGR      K-----EGLYSRR--VLYMEIRGQGA-IPLTRTDENL-TPREIEQKAAESAYFLRVPIEV
YCF4_LIRTU      K-----EGLYPRR--VLYMEIRGQGA-IPLTRTDENF-TPREIEQKAAESAYFLRVPIEV
YCF4_ILLOL      K-----EGLYPRR--VLYMEIRGRGD-IPLTRTDENL-SPLEIEQKAAEWAYFLRVPIEV
YCF4_NYMAL      K-----EGLFPRR--VLYMEIGGRGD-IPLTRTDENL-TPREIEQKAAESAYFLRVPIEV
YCF4_AMBTC      K-----EGIYPRR--VLSIEIRSQGS-IPLTRTDENF-TPREIEQKAAELAYFLRVPIEV
YCF4_NANDO      K-----EGLYPRR--VLYMEIRGQGA-LPLTRIDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_CERDE      K-----EGVYPRP--ALYMEIRGQGT-IPLTRTDENF-TSREMEQKAAELAYFLNVPIEV
YCF4_LEMMI      K-----EGLYTRR--VLYMEVRGQGT-IPLTRTDENL-TPREMEQKAAELAYFLRVPIEG
YCF4_PIPCE      K-----GGVYPRR--VLYMDIRGQGS-VPLTRTDENF-TPREIEQKAAESAYFLRVPIEV
YCF4_BUXMI      K-----EGLYPRR--VLYMEVRGQGA-IPLTRTDENF-TPREIEQKAAELAYFLRVPIEV
YCF4_PLAOC      K-----EGLYPRR--VLYMEIRGQGA-IPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_AETCO      K-----EGISARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_AETGR      K-----EGISARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_ARAHI      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_DRANE      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_LOBMA      K-----EGVSTRR--VLYMEIRGQGA-IPLIRADENF-TTREIEQKAAELAYFLRVPIEV
YCF4_CRUWA      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_ARATH      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_BARVE      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_OLIPU      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_CAPBU      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_LEPVR      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_NASOF      K-----EGVSARR--VLYMEIRGQGA-IPLIRTDENF-TTREIEQKAAELAYFLRVPIEV
YCF4_CUCSA      K-----EGIYARR--VLYMEIRGQGA-IPLTRTDQNL-TPREIEQKAAELAYFLRVPIEV
YCF4_GOSBA      K-----EGIYARR--VLYMEIRGQGA-VPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_GOSHI      K-----EGIYARR--VLYMEIRGQGA-VPLTRTDENL-TPREIEQKAAELAYFLRVPIEV
YCF4_VITVI      K-----EDIYARRILVLYMEIRGQGA-IPLTRTDENL-TPREMEQKAAELAYFLRVPIEV
YCF4_PELHO      R-----EGFYARR--ILYMEIRGQGA-IPLTRTAENW-TPREIEQKAAELAYFLRVPMEV
YCF4_CITSI      K-----EGIYARR--VLYIESRGLGA-IPLNRTDENL-TPREIEQKAAELAYFLRVPIEG
YCF4_SPIOL      K-----EGIYTRR--VLYLEIRGQGA-IPLTRTDENL-TPREMEQKAAELAYFLRVPIEV
YCF4_CUSGR      K-----EGFYTRR--LLYMDIRGQKA-IPLTRTDEVL-TPVEIEKKAAELASFLCVPIEV
YCF4_CUSOB      K-----EGFYTRR--VLYMDIRGQKG-IPLTRTDEVL-TPVEIEKKAAELASFLCVPIEV
YCF4_LOTJA      KKENKKEGRYLRSG-VLYMQTREQGA-IPLTAVDDSW-NPPKIAQKAGDLSKLLRVPIEI
YCF4_HUPLU      R-----EAISPRR--VLHMKVKGQQD-VPLTRISENL-TLREMEEKAAELARFLHVSMEG
YCF4_PHYPA      Q-----EGIYPRR--TLYMKIKGQQD-IPLTRIRENL-TLGEIEEKAAELARFLRVSIEG
YCF4_ANGEV      Q-----EGFSPRR--VLYLRIKGQQD-VPLTRLDEEL-TLREMEEKAAELARFLRVSIEG
YCF4_ANTFO      Q-----EGFYPRR--TLRLKIKGQQD-VPLTYIGENL-TLREIEEEAAELARFLQISIEG
YCF4_PSINU      R-----EGFYSRR--IIYMRMKGQQK-IFLTHISENS-TLKEMEEKAANLARFMCVSIEG
YCF4_ADICA      Q-----EGLFPSR--ILYLKVRGRQS-IPLTRIGENS-TPEYMEEKAAELARFLRISIEG
YCF4_CHAGL      K-----EVLPARR--MIYIKIKGQQD-IPLNRIAENI-TLREMEDKAADLARFLKVSIEG
YCF4_MARPO      Q-----EGFLSRR--VLYIKIKGQPD-IPLSRIEEYF-TLREMEDKAAELARFLKVSIEG
YCF4_STAPU      K-----DNLSSRG--LISIRLKNQQD-VPLTQQKDSL-NLSEMEEKAAQLARFLRVPIEG
YCF4_ZYGCR      Q-----TGLLSRN--DISILLRDKQR-LVFNQLGDSL-TLQEIEDKAVQLAQFLQVPLEG
YCF4_CHAVU      R-----DGISPRS--ALYLKIRGMPD-IPLDVIEDRF-NLNEIEKRATELASFLRVPIEG
YCF4_CHLAT      K-----EGINPRR--VIYLKIKGKRE-IPLTRIGQPL-TLGEIEEKAANLARFLQVSIEG
YCF4_MESVI      K-----EGINPRR--VIYLKIKGTRD-MPLTRIGQPL-TLAEIEEQAARLARFLQVNIEG
YCF4_CHLRE      K-----QGLDAQR--TIYLRLKGKRE-IPLTGIGQPL-TLKEIEKQASELANFLQVSLEA
YCF4_TETOB      L-----QGFDSQR--TIFLKLKGNRE-IPITGIGQPL-TLQEIEKQASELANFLQVSLEG
YCF4_STIHE      K-----QGVNPQR--TLYLRVKGKRE-IPLSQIGQPL-TVEEVEKQAAELAKFLQVSVEG
YCF4_OLTVI      Q-----EGINPRR--TIYLCVKGNRE-IPVTRIGQPM-SLEEVETQAAELAKFLQIDLFL
YCF4_PSEAK      K-----DGINPKR--TIYLCIKGQRQ-IPLTRVGQPL-TLEEIEMQAAELAQFLQKDLLL
YCF4_NEPOL      Q-----EGMNPRR--TIYVRLKGKRE-VPLTRIGQPL-TLAEIEKQAAELAGFLQVSLEG
YCF4_CHLVU      Q-----EGINPKR--IIYLKLRGNRE-IPLTRAGQPL-SIQQIETQAAELAKFLQVSLEG
YCF4_EUGGR      KNEY----FNVKQ--NVFLRIKDKND-LPIIQLSNPI-KISDLEKQASEIASFLNVPIKG
YCF4_CYACA      RGG-----INPKY--EVFLYTKN----LSRIPIGQVF-KLSKLEYQASEIATFLGLAFEQ
                                  :        :              :       :  :   .  

YCF4_RHDSA      L---------------------------------------------------
YCF4_GUITH      I---------------------------------------------------
YCF4_PORPU      A---------------------------------------------------
YCF4_PYRYE      A---------------------------------------------------
YCF4_GRATL      IR--------------------------------------------------
YCF4_CYAPA      NQ--------------------------------------------------
YCF4_SYNPX      L---------------------------------------------------
YCF4_SYNSC      L---------------------------------------------------
YCF4_SYNS9      L---------------------------------------------------
YCF4_SYNPW      L---------------------------------------------------
YCF4_SYNS3      L---------------------------------------------------
YCF4_PROM3      L---------------------------------------------------
YCF4_PROMM      L---------------------------------------------------
YCF4_SYNR3      V---------------------------------------------------
YCF4_PROM1      I---------------------------------------------------
YCF4_PROMT      I---------------------------------------------------
YCF4_PROMA      LSN-------------------------------------------------
YCF4_PROMS      LK--------------------------------------------------
YCF4_PROM0      LK--------------------------------------------------
YCF4_PROM9      LK--------------------------------------------------
YCF4_PROM2      LK--------------------------------------------------
YCF4_PROM5      LK--------------------------------------------------
YCF4_PROMP      LK--------------------------------------------------
YCF4_SYNJA      I---------------------------------------------------
YCF4_SYNJB      I---------------------------------------------------
YCF4_GLOVI      I---------------------------------------------------
YCF4_TRIEI      L---------------------------------------------------
YCF4_EMIHU      E---------------------------------------------------
YCF4_ODOSI      L---------------------------------------------------
YCF4_THAPS      L---------------------------------------------------
YCF4_PHATC      L---------------------------------------------------
YCF4_NOSS1      L---------------------------------------------------
YCF4_ANAVT      L---------------------------------------------------
YCF4_SYNP6      L---------------------------------------------------
YCF4_SYNE7      L---------------------------------------------------
YCF4_THEEB      L---------------------------------------------------
YCF4_SYNY3      L---------------------------------------------------
YCF4_PINKO      F---------------------------------------------------
YCF4_PINTH      F---------------------------------------------------
YCF4_GNEPA      F---------------------------------------------------
YCF4_CYCTA      F---------------------------------------------------
YCF4_CUSEX      F---------------------------------------------------
YCF4_CUSRE      F---------------------------------------------------
YCF4_IPOPU      F---------------------------------------------------
YCF4_NICSY      F---------------------------------------------------
YCF4_TOBAC      F---------------------------------------------------
YCF4_ATRBE      F---------------------------------------------------
YCF4_NICTO      F---------------------------------------------------
YCF4_SOLBU      F---------------------------------------------------
YCF4_SOLLC      F---------------------------------------------------
YCF4_SOLTU      F---------------------------------------------------
YCF4_JASNU      F---------------------------------------------------
YCF4_DAUCA      F---------------------------------------------------
YCF4_PANGI      F---------------------------------------------------
YCF4_HELAN      F---------------------------------------------------
YCF4_LACSA      F---------------------------------------------------
YCF4_COFAR      F---------------------------------------------------
YCF4_MORIN      F---------------------------------------------------
YCF4_POPTR      F---------------------------------------------------
YCF4_POPAL      F---------------------------------------------------
YCF4_EUCGG      F---------------------------------------------------
YCF4_OENEH      F---------------------------------------------------
YCF4_ACOCL      F---------------------------------------------------
YCF4_PHAAO      F---------------------------------------------------
YCF4_LOLPR      F---------------------------------------------------
YCF4_AGRST      F---------------------------------------------------
YCF4_HORVU      F---------------------------------------------------
YCF4_WHEAT      F---------------------------------------------------
YCF4_ORYNI      F---------------------------------------------------
YCF4_ORYSA      F---------------------------------------------------
YCF4_ORYSI      F---------------------------------------------------
YCF4_ORYSJ      F---------------------------------------------------
YCF4_SACHY      F---------------------------------------------------
YCF4_MAIZE      F---------------------------------------------------
YCF4_SACOF      F---------------------------------------------------
YCF4_SORBI      F---------------------------------------------------
YCF4_CHLSC      K---------------------------------------------------
YCF4_CALFG      K---------------------------------------------------
YCF4_DIOEL      KRN-------------------------------------------------
YCF4_DRIGR      F---------------------------------------------------
YCF4_LIRTU      F---------------------------------------------------
YCF4_ILLOL      F---------------------------------------------------
YCF4_NYMAL      F---------------------------------------------------
YCF4_AMBTC      FRTKEWILSRHGVGNPRILFNTTDLSSEQLLIRSKHVSVRSYFRSLLFPVCG
YCF4_NANDO      F---------------------------------------------------
YCF4_CERDE      F---------------------------------------------------
YCF4_LEMMI      F---------------------------------------------------
YCF4_PIPCE      F---------------------------------------------------
YCF4_BUXMI      F---------------------------------------------------
YCF4_PLAOC      F---------------------------------------------------
YCF4_AETCO      F---------------------------------------------------
YCF4_AETGR      F---------------------------------------------------
YCF4_ARAHI      F---------------------------------------------------
YCF4_DRANE      F---------------------------------------------------
YCF4_LOBMA      F---------------------------------------------------
YCF4_CRUWA      F---------------------------------------------------
YCF4_ARATH      F---------------------------------------------------
YCF4_BARVE      F---------------------------------------------------
YCF4_OLIPU      F---------------------------------------------------
YCF4_CAPBU      F---------------------------------------------------
YCF4_LEPVR      F---------------------------------------------------
YCF4_NASOF      F---------------------------------------------------
YCF4_CUCSA      F---------------------------------------------------
YCF4_GOSBA      F---------------------------------------------------
YCF4_GOSHI      F---------------------------------------------------
YCF4_VITVI      F---------------------------------------------------
YCF4_PELHO      F---------------------------------------------------
YCF4_CITSI      F---------------------------------------------------
YCF4_SPIOL      F---------------------------------------------------
YCF4_CUSGR      L---------------------------------------------------
YCF4_CUSOB      L---------------------------------------------------
YCF4_LOTJA      F---------------------------------------------------
YCF4_HUPLU      P---------------------------------------------------
YCF4_PHYPA      L---------------------------------------------------
YCF4_ANGEV      F---------------------------------------------------
YCF4_ANTFO      F---------------------------------------------------
YCF4_PSINU      I---------------------------------------------------
YCF4_ADICA      F---------------------------------------------------
YCF4_CHAGL      L---------------------------------------------------
YCF4_MARPO      I---------------------------------------------------
YCF4_STAPU      F---------------------------------------------------
YCF4_ZYGCR      V---------------------------------------------------
YCF4_CHAVU      LE--------------------------------------------------
YCF4_CHLAT      L---------------------------------------------------
YCF4_MESVI      I---------------------------------------------------
YCF4_CHLRE      ----------------------------------------------------
YCF4_TETOB      L---------------------------------------------------
YCF4_STIHE      L---------------------------------------------------
YCF4_OLTVI      K---------------------------------------------------
YCF4_PSEAK      N---------------------------------------------------
YCF4_NEPOL      F---------------------------------------------------
YCF4_CHLVU      I---------------------------------------------------
YCF4_EUGGR      Y---------------------------------------------------
YCF4_CYACA      YNL-------------------------------------------------