CLUSTAL format seed alignment for MF_00631

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CRGA_MYCTU            ------------------------------------------------------------
CRGA_MYCBO            ------------------------------------------------------------
CRGA_MYCBT            ------------------------------------------------------------
CRGA_MYCTA            ------------------------------------------------------------
CRGA_MYCA1            ------------------------------------------------------------
CRGA_MYCPA            ------------------------------------------------------------
H8IHK7_MYCIA          ------------------------------------------------------------
CRGA_MYCMM            ------------------------------------------------------------
CRGA_MYCUA            ------------------------------------------------------------
CRGA_MYCLE            ------------------------------------------------------------
CRGA_MYCLB            ------------------------------------------------------------
I4BC38_MYCCN          ------------------------------------------------------------
CRGA_MYCSJ            ------------------------------------------------------------
CRGA_MYCSK            ------------------------------------------------------------
CRGA_MYCSS            ------------------------------------------------------------
A0QNF8_MYCS2          ------------------------------------------------------------
F5YWB1_MYCSD          ------------------------------------------------------------
B1ME67_MYCA9          ------------------------------------------------------------
G8RME6_MYCRN          ------------------------------------------------------------
E4WB79_RHOH1          ------------------------------------------------------------
C1B7V2_RHOOB          ------------------------------------------------------------
C0ZLG5_RHOE4          ------------------------------------------------------------
D0LA53_GORB4          ------------------------------------------------------------
H6N358_GORPV          ------------------------------------------------------------
Q5Z3S3_NOCFA          ------------------------------------------------------------
H6R5A6_NOCCG          ------------------------------------------------------------
F6ERG8_HOYSD          ------------------------------------------------------------
D6ZB54_SEGRD          ------------------------------------------------------------
D5UPC7_TSUPD          ------------------------------------------------------------
C6WCG9_ACTMD          ------------------------------------------------------------
A4F5R6_SACEN          ------------------------------------------------------------
G0G5P1_AMYMS          ------------------------------------------------------------
C7MRQ7_SACVD          ------------------------------------------------------------
F4CQF1_PSEUX          ------------------------------------------------------------
C8XIS1_NAKMY          ------------------------------------------------------------
Q6NKH4_CORDI          ------------------------------------------------------------
V6V7I9_CORUL          ------------------------------------------------------------
CRGA_CORA7            ------------------------------------------------------------
CRGA_CORGL            ------------------------------------------------------------
CRGA_CORGB            ------------------------------------------------------------
CRGA_COREF            ------------------------------------------------------------
C4LLS1_CORK4          ------------------------------------------------------------
CRGA_CORJK            ------------------------------------------------------------
CRGA_CORU7            ------------------------------------------------------------
G0H9U3_CORVD          ------------------------------------------------------------
F8E0M6_CORRG          ------------------------------------------------------------
I4EQ29_9ACTN          ------------------------------------------------------------
H6RJC5_BLASD          ------------------------------------------------------------
D2SGG1_GEOOG          ------------------------------------------------------------
D7GI16_PROFC          ------------------------------------------------------------
F5XIS0_MICPN          ------------------------------------------------------------
I6WZX9_PSEPQ          ------------------------------------------------------------
Q6ABC6_PROAC          ------------------------------------------------------------
D2PQJ9_KRIFD          ------------------------------------------------------------
A8LCF9_FRASN          ------------------------------------------------------------
E3J3G6_FRAIE          ------------------------------------------------------------
Q2J4K7_FRACC          ------------------------------------------------------------
F8B2N4_FRADG          ------------------------------------------------------------
D2AXI3_STRRD          ------------------------------------------------------------
D6Y259_THEBD          ------------------------------------------------------------
D1ADF7_THECD          ------------------------------------------------------------
J7L9G3_NOCAA          ------------------------------------------------------------
D7B8W7_NOCDD          ------------------------------------------------------------
C7MH28_BRAFD          ------------------------------------------------------------
D6ZJS9_MOBCV          ------------------------------------------------------------
CRGA_BIFLO            ------------------------------------------------------------
D6ZX97_BIFLJ          MLMADEELHETDSNNQKDWQSETSSSTAADETANKDTEQ---------------------
F9XZH6_BIFBU          --MADEELHETDSNDQKDWQGETSSEAATDDAAKSE------------------------
E3EPK9_BIFBS          --MADTELHETDSEDQKDWQAETDADVKDTDTNETD------------------------
S4I509_GARVA          --MADEELNTLNA--------------------ASSADA---------------------
D2RCM1_GARV4          --MADEELHT-----------------------TAADDA---------------------
D2Q6Y3_BIFDB          MLMADEELHETTADTQEDWQSE-----AAESTEETTDND---------------------
A0ZZD2_BIFAA          MLMADEELHETTADDQKDLQSADDTAAVEETTEDVVDKT---------------------
A0A0L7CUJ9_9BIFI      --MAEEELHKTDADVSANDAADSNATVTDDVVIDAATDSEGDAVAVESETVTEEPQTDSE
F4H3V2_CELFA          ------------------------------------------------------------
F8A237_CELGA          ------------------------------------------------------------
D5UFI1_CELFN          ------------------------------------------------------------
C5BUR3_BEUC1          ------------------------------------------------------------
E6SEM0_INTC7          ------------------------------------------------------------
F6FQ79_ISOV2          ------------------------------------------------------------
D1BTB2_XYLCX          ------------------------------------------------------------
C7QYJ3_JONDD          ------------------------------------------------------------
D1BI18_SANKS          ------------------------------------------------------------
CRGA_TROW8            ------------------------------------------------------------
CRGA_TROWT            ------------------------------------------------------------
B8H7E3_PSECP          ------------------------------------------------------------
F0M4P4_PSEPM          ------------------------------------------------------------
A0JQU7_ARTS2          ------------------------------------------------------------
A1R0U3_PAEAT          -----------------------------------MRHKVSLHRARAAWADPRLRLDLTA
A9WTU9_RENSM          -------------------------------------------------MDRQLLSFSRI
B0RH81_CLAMS          ------------------------------------------------------------
Q6AHM3_LEIXX          ------------------------------------------------------------
E8N924_MICTS          ------------------------------------------------------------
E1VRL3_GLUAR          ------------------------------------------------------------
C5C837_MICLC          ------------------------------------------------------------
D2NQ77_ROTMD          ------------------------------------------------------------
E3H360_ROTDC          ------------------------------------------------------------
C7NIE3_KYTSD          ------------------------------------------------------------
D7BLR3_ARCHD          ------------------------------------------------------------
A6W3X8_KINRD          ------------------------------------------------------------
G8S4M3_ACTS5          ------------------------------------------------------------
I0GWY5_ACTM4          ------------------------------------------------------------
F4F971_VERMA          ------------------------------------------------------------
D3Q1H5_STANL          ------------------------------------------------------------
A0LQT0_ACIC1          ------------------------------------------------------------
CRGA_STRAW            ------------------------------------------------------------
C9ZAJ0_STRSW          ------------------------------------------------------------
CRGA_STRCO            ------------------------------------------------------------
H2K3T2_STRHJ          ------------------------------------------------------------
F2RD30_STRVP          ------------------------------------------------------------
B1VPG8_STRGG          ------------------------------------------------------------
E2PWL1_STRC2          ------------------------------------------------------------
F8JSE2_STREN          ------------------------------------------------------------
D7C8W8_STRBB          ------------------------------------------------------------
E4MZF6_KITSK          ------------------------------------------------------------
C7QFQ9_CATAD          ------------------------------------------------------------
A1SCN5_NOCSJ          -----------------------------------------------MAKAKLDPLAPAR
C7Q8N0_CATAD          ------------------------------------------------------------
                                                                                  

CRGA_MYCTU            -----------------------------------MPKSKVRKKNDF------TVSA---
CRGA_MYCBO            -----------------------------------MPKSKVRKKNDF------TVSA---
CRGA_MYCBT            -----------------------------------MPKSKVRKKNDF------TVSA---
CRGA_MYCTA            -----------------------------------MPKSKVRKKNDF------TVSA---
CRGA_MYCA1            -----------------------------------MPKSKVRKKNDF------TVSA---
CRGA_MYCPA            -----------------------------------MPKSKVRKKNDF------TVSA---
H8IHK7_MYCIA          -----------------------------------MPKSKVRKKNDF------TVSA---
CRGA_MYCMM            -----------------------------------MPKSKVRKKNDF------TVKP---
CRGA_MYCUA            -----------------------------------MPKSKVRKKNDF------TVKP---
CRGA_MYCLE            -----------------------------------MPKSKVRKKNDF------TITS---
CRGA_MYCLB            -----------------------------------MPKSKVRKKNDF------TITS---
I4BC38_MYCCN          -----------------------------------MPKSKVRKKNDF------TINP---
CRGA_MYCSJ            -----------------------------------MPKSKVRKKNDF------TISP---
CRGA_MYCSK            -----------------------------------MPKSKVRKKNDF------TISP---
CRGA_MYCSS            -----------------------------------MPKSKVRKKNDF------TISP---
A0QNF8_MYCS2          -----------------------------------MPKSKVRKKNDF------TSRP---
F5YWB1_MYCSD          -----------------------------------MPKSKVRKKTSF------TPSS---
B1ME67_MYCA9          -----------------------------------MPKSKVRKKSAF------NATT---
G8RME6_MYCRN          -----------------------------------MPKSKVRKKNDF------TISP---
E4WB79_RHOH1          -----------------------------------MPKSKVRKKTDY------TINP---
C1B7V2_RHOOB          -----------------------------------MPKSKVRKKTDY------TINP---
C0ZLG5_RHOE4          -----------------------------------MPKSKVRKKNDY------TVNP---
D0LA53_GORB4          -----------------------------------MPKSKVRKKTDY------TINP---
H6N358_GORPV          -----------------------------------MPKSKVRKKTDY------TINP---
Q5Z3S3_NOCFA          -----------------------------------MPKSKVRKKTDY------TINP---
H6R5A6_NOCCG          -----------------------------------MPKSKVRKKTDY------SSSP---
F6ERG8_HOYSD          -----------------------------------MPKSRVRKKNDH------STSPT--
D6ZB54_SEGRD          -----------------------------------MPKSKVRKKTDF------TINP---
D5UPC7_TSUPD          -----------------------------------MPKSKVRKKTDY------TINA---
C6WCG9_ACTMD          -----------------------------------MPKSKVRKKAVY------TAPA---
A4F5R6_SACEN          -----------------------------------MPKSKVRKKDSS------TPVA---
G0G5P1_AMYMS          -----------------------------------MPKSKVRKKTAY------TPPA---
C7MRQ7_SACVD          -----------------------------------MPKSKVRKKTAY------TPPP---
F4CQF1_PSEUX          -----------------------------------MPKSKVRKKTAY------TPPA---
C8XIS1_NAKMY          -----------------------------------MPKSKVRKKVAS------SSASASA
Q6NKH4_CORDI          -----------------------------------MPKSKINHSSTAY-----TAGST--
V6V7I9_CORUL          -----------------------------------MPKSKITQSSAPF-----ASSST--
CRGA_CORA7            -----------------------------------MPKSKITTEGSALPQ---SSSSA--
CRGA_CORGL            -----------------------------------MPKARVTKNETAP-V---SSNPS--
CRGA_CORGB            -----------------------------------MPKARVTKNETAP-V---SSNPS--
CRGA_COREF            -----------------------------------MPKAKVTKNSIAP-V---SSNPS--
C4LLS1_CORK4          -----------------------------------MPKSKVTESSESR-P---ASSST--
CRGA_CORJK            -----------------------------------MPKSKVNSAEENYSS---SSSA---
CRGA_CORU7            -----------------------------------MPKSKINSPEENFDS---SAAAGV-
G0H9U3_CORVD          -----------------------------------MPKSRISSTPE---G---AGASPV-
F8E0M6_CORRG          -----------------------------------MPKSKVNTGSEN-YS---APTNSA-
I4EQ29_9ACTN          -----------------------------------MPKSKVRKKSVY------TPPEG--
H6RJC5_BLASD          -----------------------------------MPKSKVRKKSVY------TPPED--
D2SGG1_GEOOG          -----------------------------------MPKSKVRKKSAY------TPPQG--
D7GI16_PROFC          -----------------------------------MPESQSRKKAQQKKAAKNKQAAA--
F5XIS0_MICPN          -----------------------------------MPESRTRKSAETK-----KKQQA--
I6WZX9_PSEPQ          -----------------------------------MPESKVRKEAKSKAR---KKQSE--
Q6ABC6_PROAC          -----------------------------------MPESKVRPQAKKKAQ---AKDRA--
D2PQJ9_KRIFD          -----------------------------------MPESSSR---EQK-----KKPAA--
A8LCF9_FRASN          -----------------------------------MPESRRRKPKKTTV----AAPQT--
E3J3G6_FRAIE          -----------------------------------MPESRRRKPKKATA----ARPAS--
Q2J4K7_FRACC          -----------------------------------MPESRRRKPKKPTP----TTTAG--
F8B2N4_FRADG          -----------------------------------MPVSRRRK-KKSTS----APPQT--
D2AXI3_STRRD          -----------------------------------MPKPK--TRKKA-------------
D6Y259_THEBD          -----------------------------------MPKSK--VRKKA-------------
D1ADF7_THECD          -----------------------------------MPKSK--VRKKA-------------
J7L9G3_NOCAA          -----------------------------------MPKSRNDRKKKA-------------
D7B8W7_NOCDD          -----------------------------------MPKSRSDRKKKA-------------
C7MH28_BRAFD          ---------MARSRKKSSRQATSNAKATASAKDPVTPAGGEISEKAKDSTRST-------
D6ZJS9_MOBCV          ---------MPESKKR---------------------------KRASKVVKSD-------
CRGA_BIFLO            --------------------------------MEQVQAALNATADKATLTPQM-------
D6ZX97_BIFLJ          ----------------NAENASAEEDAAYGVNMEQVQAVLNATADKATLTPQM-------
F9XZH6_BIFBU          ----------------NAADETAAEDENYGVDMEKVEAVLNATADKATLTPQM-------
E3EPK9_BIFBS          ------------------ANETDEADDDYGVSMDKVQAVLNATADKSEMTPQM-------
S4I509_GARVA          ----------------GEAKESSKEDL-YGVPMEQVEAVLNATADKDSLSPQI-------
D2RCM1_GARV4          ----------------AKKSDTSNENT-YGVPMDEVEAVLNATADKAALSPQI-------
D2Q6Y3_BIFDB          ----------------AVAESAEDDDD-LDIPMDRVEAVLNATVDKDSLTPQM-------
A0ZZD2_BIFAA          ----------------SVDEDQSDDDD-LDIPMDRVEAVLNATVDKDSLSPQM-------
A0A0L7CUJ9_9BIFI      KKVEREEKRAEDNEKRAEEAAVVSEEEANDLSLDKIQAVLNSTIDEKDMSPQM-------
F4H3V2_CELFA          -----------------------------------MPES--RSRKKAAYIPPP-------
F8A237_CELGA          -----------------------------------MPES--RSRKKATYTPPT-------
D5UFI1_CELFN          -----------------------------------MPES--KSRKKATYTPPP-------
C5BUR3_BEUC1          -----------------------------------MPES--KSRKKPAYTPPP-------
E6SEM0_INTC7          -----------------------------------MPESKGRDRKTAAYIPPP-------
F6FQ79_ISOV2          -----------------------------------MPESKSRKKKVAPATP---------
D1BTB2_XYLCX          -----------------------------------MPESKSRKKKVRPSDPEF-------
C7QYJ3_JONDD          -----------------------------------MPVSRSRKKRHQDDEVT--------
D1BI18_SANKS          -----------------------------------MPESKRRKKAAQTSSAQ--------
CRGA_TROW8            ----------------------------------------------------M-------
CRGA_TROWT            ----------------------------------------------------M-------
B8H7E3_PSECP          -----------------------------------MPESKPR---KKTASTAE-------
F0M4P4_PSEPM          -----------------------------------MPESKPR---KKTASTAQ-------
A0JQU7_ARTS2          -----------------------------------MPESKPR---KKTVPAGK-------
A1R0U3_PAEAT          RTNPERRVAVNRWKFPSCRISRLAGRVLTEQPGGSVPESKPR---KRPARQAQ-------
A9WTU9_RENSM          PSVGERHIPVRWSKPFTCQ-------------GEPVPESKSR---RRPARSQQ-------
B0RH81_CLAMS          -----------------------------------MAR-------DKTTRPSR-------
Q6AHM3_LEIXX          -----------------------------------MARSKSKTKPDRSTRPER-------
E8N924_MICTS          -----------------------------------MAR-------TGNGDDPI-------
E1VRL3_GLUAR          -----------------------------------MPESKPR---RKKNSQPQ-------
C5C837_MICLC          ---------------------------------MAAPAGKRKDSARRKREELE-------
D2NQ77_ROTMD          ----------MSTNSAKASSK-------KKSQ--KSAKSEVEDASELRLREIA-------
E3H360_ROTDC          ----------MSPKSTAKKSKKTANTKSKKSQDKKSAKAVEEDASELRLLEVA-------
C7NIE3_KYTSD          -----------------------------------MSTLPPELRDAEEPTDPR-------
D7BLR3_ARCHD          -----------------------------------MPESKKRKKVEERRIAAS-------
A6W3X8_KINRD          -----------------------------------MSRRKESDDAGSTTGAATGATAATP
G8S4M3_ACTS5          -----------------------------------MPKSQVRKKKVYTPPSDI-------
I0GWY5_ACTM4          -----------------------------------MPKSQVRKKKVYTPPADI-------
F4F971_VERMA          -----------------------------------MPKSQVRKKKVYTPPTDV-------
D3Q1H5_STANL          -----------------------------------MPKSRVRKKKVYTAPAEL-------
A0LQT0_ACIC1          -----------------------------------MPKSRVRKTVDYIPPPTR-------
CRGA_STRAW            -----------------------------------MPKSRIRKKADYTPPPS--------
C9ZAJ0_STRSW          -----------------------------------MPKSRIRKKADYTPPPS--------
CRGA_STRCO            -----------------------------------MPKSRIRKKADYTPPPS--------
H2K3T2_STRHJ          -----------------------------------MPKSRIRKKADYTPPAA--------
F2RD30_STRVP          -----------------------------------MPKSRIRKKADFTPPPA--------
B1VPG8_STRGG          -----------------------------------MPKSRIRKKADFTPPPA--------
E2PWL1_STRC2          -----------------------------------MPKSRIRKKADFTPPPNN-------
F8JSE2_STREN          -----------------------------------MPKSRIRKKADFTPPPE--------
D7C8W8_STRBB          -----------------------------------MPKSRIRKKDDFTPPPA--------
E4MZF6_KITSK          -----------------------------------MPKSRLRKKADYTPPPS--------
C7QFQ9_CATAD          -----------------------------------MPESKVRKKAAYTPPPD--------
A1SCN5_NOCSJ          GPLLSVRSVIALVLIVLGIAWMAYFYIVVRVDPTAFPKPDPGSPAFMDDLGDWNYLIGFG
C7Q8N0_CATAD          ------------------------------------------------------------
                                                                                  

CRGA_MYCTU            ----VSRTPMKVKV-----------GPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGS---
CRGA_MYCBO            ----VSRTPMKVKV-----------GPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGS---
CRGA_MYCBT            ----VSRTPMKVKV-----------GPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGS---
CRGA_MYCTA            ----VSRTPMKVKV-----------GPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGS---
CRGA_MYCA1            ----VSRTPVKVKV-----------GPSSVWFVALFIGLMLIGLVWLMVFQLAAVGS---
CRGA_MYCPA            ----VSRTPVKVKV-----------GPSSVWFVALFIGLMLIGLVWLMVFQLAAVGS---
H8IHK7_MYCIA          ----VSRTPVKVKV-----------GPSSVWFVALFIGLMLIGLVWLMVFQLAAVGS---
CRGA_MYCMM            ----VSRTPVKVKV-----------GPSSVWFVALFIGLMLIGLVWLMVFQLAAVGS---
CRGA_MYCUA            ----VSRTPVKVKV-----------GPSSVWFVALFIGLMLIGLVWLMVFQLAAVGS---
CRGA_MYCLE            ----VSRTPVKVKV-----------GPSSVWFVTLFVGLMLIGLVWLMVFQLAALGT---
CRGA_MYCLB            ----VSRTPVKVKV-----------GPSSVWFVTLFVGLMLIGLVWLMVFQLAALGT---
I4BC38_MYCCN          ----VSRTPVKVKA-----------GPSSVWFVVLFVGLMLIGLVWLIVFQLAGSGP---
CRGA_MYCSJ            ----VSRTPVKVKA-----------GPSSVWFVALFVGLMLIGLIWLLVFQLAATNPV--
CRGA_MYCSK            ----VSRTPVKVKA-----------GPSSVWFVALFVGLMLIGLIWLLVFQLAATNPV--
CRGA_MYCSS            ----VSRTPVKVKA-----------GPSSVWFVALFVGLMLIGLIWLLVFQLAATNPV--
A0QNF8_MYCS2          ----VSRTPVKVKA-----------GPSSVWFVALFIGLMLFGLIWLLVFQLAATNPI--
F5YWB1_MYCSD          ----VSRTPVKVKG-----------GPSSVWFVALFLGLMLFGLVWLMVYQLAATGL---
B1ME67_MYCA9          ----VSRTPVKVKA-----------GPSSVWFVAFFLTLMLIGLAWLMVFQLA-------
G8RME6_MYCRN          ----VSRTPVKVKA-----------GPSSTWFVVFFISLMLIGLAWLLVFQLA-------
E4WB79_RHOH1          ----ANRTPVKVKA-----------GPSSAVYVSVMLGFMLVGLAWLIVYYLAG------
C1B7V2_RHOOB          ----ASRTPVKVKA-----------GPSSTLYVSVMLGFMLVGLVWLLVYYLAA------
C0ZLG5_RHOE4          ----ANRTPVKVKM-----------GPSSTLYVSVMLGFMLLGLAWLIVYYLAA------
D0LA53_GORB4          ----ASRTPVKVKA-----------GPSSTIYVGVMLGLMLLGLAWLVVYYLAATPSTFG
H6N358_GORPV          ----ASRTPVKVKA-----------GPSSSIYVGVMLGLMLLGLAWLIVYYLAAGETTYG
Q5Z3S3_NOCFA          ----ASRTPVKVKA-----------GPSPVWYVAIMLGFMLAGLLWLLVYYLAA------
H6R5A6_NOCCG          ----ASRTPVKVKAV----------GPSPVWYVAIMLGFMLAGLVWLLVYYLAG------
F6ERG8_HOYSD          ----TSRTPVKVKG------------PSSTLYVSVMLGFMLAGLIWLVVYYLAS------
D6ZB54_SEGRD          ----GAAGAGSAR-T----------APSSTWYVALMLGFMLAGLAWLVVYYIAAADL---
D5UPC7_TSUPD          ----STDSRTPVKVS----------APSGRWFVALFLGFMLAGLAWLLVYYLGADESGMG
C6WCG9_ACTMD          ----DRRTPVKVKAA----------GPSHPFYITVMLGVMLLGLAWLVVNYIAG------
A4F5R6_SACEN          ----DRRTPVKAKAV----------GPSHPIYVVVMLGMMVIGLLWLVVNYLAG------
G0G5P1_AMYMS          ----DRRTPVKVRAA----------GPTGLAWKIPMFGLMLIGLVWLLVNYIAG------
C7MRQ7_SACVD          ----NRQ-PVKVKAA----------GPSHPVYKIVMFGLMLLGLLWLVVNYLAG------
F4CQF1_PSEUX          ----QRS---AARAA----------GPTSPVYVAVMLGLMLVGLAWLIVNYLAG------
C8XIS1_NAKMY          QANEAAAAAARAHVA----------APSSPLYIGIMLGLMVLGLVWLVVYYLWG------
Q6NKH4_CORDI          ----ANRTPVKINS-----------TGTPLWYKIIMFGLILAGLLWLIVNYLAG------
V6V7I9_CORUL          ----ANRTPVKINS-----------TGTPVWYKTIMFGLILAGLLWLIVNYLAG------
CRGA_CORA7            ----TNRTPVKINS-----------EGTPKWYIAIMLGLMLLGLLWLVVNYLAG------
CRGA_CORGL            ----ANRTPVKINS-----------AGTPMWYKVIMFAFMIVGLAWLIINYLVG------
CRGA_CORGB            ----ANRTPVKINS-----------AGTPMWYKVIMFAFMIVGLAWLIVNYLVG------
CRGA_COREF            ----ANRTPVKINS-----------TGTPMWYKVIMFAFMLVGLLWLVANYLVG------
C4LLS1_CORK4          ----STRTPVKLNN-----------ASTPLWYRIIMFGFIIAGLLWLVVNYIAG------
CRGA_CORJK            ----DRRTPVKLNS-----------SGTPRWYIVLMLALMLLGLAWLVVNYIAG------
CRGA_CORU7            ----DRRTPVKLNA-----------SGTPRWYIVIMLGLMLLGLAWLVVNYIAG------
G0H9U3_CORVD          ----DHRTPVKLNA-----------TGTSRWYIVVMLGLMLLGLAWIVVNYIAG------
F8E0M6_CORRG          ----ERRTPVKLNA-----------SGTPRWYVVLMLGLMILGLLWLVVNYIAG------
I4EQ29_9ACTN          ---VLPSRAARARAA----------EPSPRWYAVVMVALMLIGLLWIVVYYVAG------
H6RJC5_BLASD          ---VARSRGAQAKAL----------QPSPRWYAPVMAALMLFGLLWIVVYYVAG------
D2SGG1_GEOOG          ---TLQSGTASARAV----------QPSPRWYAPLMVALMLLGLLWIVVFYVAG------
D7GI16_PROFC          ----TKSAKNREAV----------NVSSRAWVPWVFVPMGLLGVIWLVVYYIGG------
F5XIS0_MICPN          ----TAEAKPKKVK----------SPGGGRWVAPTFITVGLLGVLWLIVFYVGG------
I6WZX9_PSEPQ          ----ELEKTRKERRDR----KRLAANTERRWVPWVFIPVGLLGVLWMVTWNLAG------
Q6ABC6_PROAC          ----TMDERRAEKK---------AAPVDRSWVPKVFVPLFLLGVLWLIVYYIAG------
D2PQJ9_KRIFD          ----EKPQKTPKKP----------RTTSRPWVAPLMLGCWLLGLIWLVVFYVAG------
A8LCF9_FRASN          ----STRAPKRRPP-------------SPPWFGGMILAFFLIGIAYLLVYYFSN------
E3J3G6_FRAIE          ----TVTA-KRRSP-------------SPRWFGGMIMAFFLIGIAYLLTYYFSN------
Q2J4K7_FRACC          ----ASAR-RRKPP-------------SPPWFGGLILAFFLLGIAYLLVYYFSN------
F8B2N4_FRADG          ----TQLR-KRKPP-------------SPPWMGALILALFLIGIAWLLVYYFSN------
D2AXI3_STRRD          ----VYTPPQTTQQV----------KMSPRWLAPVMVASWIIGILWIAIYYV--------
D6Y259_THEBD          ----VYTPPKRAQAV----------KTSPRWLAPLMVTCWIVGILWIAVYYI--------
D1ADF7_THECD          ----VYTPPQRSQKA----------AVSPRWLVPTMLFLWLAGLVWIATFYVTAST----
J7L9G3_NOCAA          ----VYTPPPSKEQP----------KVSPRWLVPTMLGFFILGILWIGVYYLA-------
D7B8W7_NOCDD          ----VYTPPPSKEKP----------KVSPRWLAPAMLGFFTLGILWIAVYYIA-------
C7MH28_BRAFD          ----SVKKAAAAESTRTTGRRVAAATQNPPWLAPTAVVLLIVGLLYLVTYYI--------
D6ZJS9_MOBCV          ----SELRPSWTEDMK----------RSPRWYAPTAMIIMGLGLLWIVLHYILAQ-----
CRGA_BIFLO            ----QRMMNRQAENTKRVEETIKGTKSNPRWFVPLFCALMIIGLIWCVVYYLSPS-----
D6ZX97_BIFLJ          ----QRMMNRQAENTKRVEETIKGTKSNPRWFVPLFCAFMIIGLIWCVVYYLSPS-----
F9XZH6_BIFBU          ----QRMMSRQAENTKRVEETIKGTKSNPRWFVPVFCALMIIGLIWCVVYYLSPS-----
E3EPK9_BIFBS          ----QRMMSRQAENTRRVEETIKGTKSNPRWFVPLFCALMIIGLIWAVVYYLSPN-----
S4I509_GARVA          ----QRMMKRQEENTRRVEESIKGTKANAGWFVPLFCTLMIVGLFWAVVYYLNP------
D2RCM1_GARV4          ----QQMMQRQAENRRRVEESIKGTKANAAWFVPLFCTLMVVGLIWAVVYYLNP------
D2Q6Y3_BIFDB          ----QRMMNRQAENTRRVEETINGTKSNPRWFVPLFCALMIIGLIWAVTYYLSG------
A0ZZD2_BIFAA          ----QRMMNRQAENTRRVEESIKGTKSNPRWFVPLFCALMIIGLVWAVVYYLTT------
A0A0L7CUJ9_9BIFI      ----RRMVKRQQENTKRVEESIKGTKANPSWFVPLFCAFMIVGLIWVVVFYMTA------
F4H3V2_CELFA          ----EKSAGKK---------------PNPPWFVPVMLGLMLLGLVWIVVTYLS-------
F8A237_CELGA          ----QKAAVK----------------PNPRWWVPVMLGLMLLGLVWIVVFYIGRAT-N--
D5UFI1_CELFN          ----VKASAPK---------------PLPRWYLPLSLGLMILGLVSLVVTYLS----S--
C5BUR3_BEUC1          -----KSAEAK---------------PNPAWYVPTFLTLLIVGLVWVVVTYIS-------
E6SEM0_INTC7          -----KSKATQ---------------PNPTWWAPAFVTLLVLGLLWIVTYYIT-------
F6FQ79_ISOV2          ------AEPRPARQE-----------GNPRWLVPTMLGLMVLGLVWIVLYYLTSN-----
D1BTB2_XYLCX          ----VERMAKAAEKEK---------AGNPPWLVPVMLGLMILGLIWIVTYYLTASR-V--
C7QYJ3_JONDD          ------QADHTPQQV-----------GNPAWLAPTMVTLLIVGCLWVIVYYLTSA-----
D1BI18_SANKS          ------ASAPKVKQVR---------EGNPAWLVPTMITMFIVGILWVVLFYLTSG-----
CRGA_TROW8            ----SRKKHESSE-------------NNPVWFPTIMFGLMGTGAVWMVLFYISNGA----
CRGA_TROWT            ----SRKKHESSE-------------NNPVWFPTIMFGLMGTGAVWMVLFYISNGA----
B8H7E3_PSECP          ----KAA-PDAYK-------------PNPVWFKPVMFGLMIIGLFWIITFYISEGR----
F0M4P4_PSEPM          ----PAS-SQTYK-------------PNPVWFKPVMFGLMIIGLFWIITFYISEGR----
A0JQU7_ARTS2          ----PASASQAYK-------------PNAVWFKPVMFGLMILGLLWIITFYISEGA----
A1R0U3_PAEAT          ----QTSAAQQYK-------------PNPVWYKAVMFGLMILGLIWIITFYITEGQ----
A9WTU9_RENSM          ----AEGASKAVK-------------PNPIWFKPVMFGLMVIGLLWIIVFYITSNTG---
B0RH81_CLAMS          ----QERVHDEDA-------------PNPVWFKPIMFGFMLVGLAWLIVYYVSLNA----
Q6AHM3_LEIXX          ----SSLASGEEA-------------PNPVWFKPVMFGFMLLGLVWIIVFYMSQNQ----
E8N924_MICTS          ----AERNEGASA-------------PNPVWFLPIMIGLMLIGLVWVLVFYLSNSQ----
E1VRL3_GLUAR          ----ESRQSAHAI-----------DKPMPGWYKPVMFGLMLLSLVWIIVYYVSQTL----
C5C837_MICLC          ----AARRSRSAVRTE-LGDVDPGPKPLSPVYKAVMFGLLILGLVWIIVYYLTQGL----
D2NQ77_ROTMD          ----REMESGTQL-----------KEQTPLWYRVIMFSLLAVGILWIIVFYITQGL----
E3H360_ROTDC          ----REMETSGTQ-----------REGTPLWYRVVMFSLVALGILWIIAYYIFEGR----
C7NIE3_KYTSD          ----REEIQGSPS------------GMNPRWLVPTMVGLMVLGVLWVVVYYVTQGE----
D7BLR3_ARCHD          ----RDRQEHP------APEIKR----SPKWWAPLMVTLALIGLLVVVMAYVSHGQ----
A6W3X8_KINRD          ARSRRGRKGQPDAVAEADRAVKRKNQLTPRWWIFLMVGLMVAGLLWIVVFYLSSAL----
G8S4M3_ACTS5          -----RPAVTAAS-----------KKPSPVWLPALAVALIVVGIAWLVVYYLSSQQYP--
I0GWY5_ACTM4          -----RPAAAGAS-----------KKPSPAWIPFTAVALIVIGIAWLVVYYLSSQQWP--
F4F971_VERMA          -----RPAATAAT-----------RKPSPIWLPVTAVSLIVFGIGWLVVYYLSEQEYP--
D3Q1H5_STANL          -----RPKTPEST-----------HQPSPTWVPVLAVILIVLGIGWLVTFYLTEGSFP--
A0LQT0_ACIC1          -----SPK----------------KRVSPPWLAPTMVACLIVGVIWLVIGYVTQYTFP--
CRGA_STRAW            ----KQATNIKLGS--------------RGWVAPVMLAMFLIGLAWIVVFYVTDGS----
C9ZAJ0_STRSW          ----KQATNIKLNS--------------RGWVAPVMLAMFLIGLAWIVVFYVTDGS----
CRGA_STRCO            ----KQATSIKLTS--------------RGWVAPVMLAMFVIGLAWIVVFYVTDGS----
H2K3T2_STRHJ          ----KQAQAIKLTN--------------RAWVAPVMLAMFLIGLAWIVVFYVTDGS----
F2RD30_STRVP          ----KQATNIKLTN--------------RSWVAPVMLALFAIGLVWIVVFYVTDGS----
B1VPG8_STRGG          ----KQATAIKLTN--------------RSWVAPVMLALFLIGLAWIVVFYVTEGD----
E2PWL1_STRC2          ----RQATAIKLTN--------------RSWVAPVMLGLFLIGLAWIVLFYVTEGE----
F8JSE2_STREN          ----KTAT-FKLHSG-------------RRWVAPLMLALFLIGLAWIVIFYVTTGS----
D7C8W8_STRBB          ----KQATNISLHSG-------------RRWVAPLMLAMFLIGLAWIVMFYVTTGD----
E4MZF6_KITSK          -----TATAVKISSG-------------RSWVAPLMLVFFLVGLVWIVTYYVTSGN----
C7QFQ9_CATAD          -----KKQPIKLDTG-------------NRVVLPLMVGCFVLGLLWIVIYYLSNMT----
A1SCN5_NOCSJ          LFLLGLVVAAHPSTP----------LGRGRGVVVGMLGCFLIGLLWISAYYVFSNDL---
C7Q8N0_CATAD          -------MNDK---------------PSPPWFGALILGSLTTATIWILTYTLSP------
                                                                .        .        

CRGA_MYCTU            QAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCBO            QAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCBT            QAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCTA            QAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCA1            QAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCPA            QAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
H8IHK7_MYCIA          QAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCMM            QAPAALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCUA            QAPAALNWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCLE            QAPTALHWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
CRGA_MYCLB            QAPTALHWMAQLGPWNYAIAFAFMITGLLLTMRWH-------------------------
I4BC38_MYCCN          DAPTFLKWMANLNIWNYAIAFAFMITGLLLTMRWR-------------------------
CRGA_MYCSJ            DAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR-------------------------
CRGA_MYCSK            DAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR-------------------------
CRGA_MYCSS            DAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR-------------------------
A0QNF8_MYCS2          DTPSFLQWMADLGPWNYAIAFAFMITGLLLTMRWR-------------------------
F5YWB1_MYCSD          DTPAALNWMAELGPWNYAIAFAFMITGLLLTMRWR-------------------------
B1ME67_MYCA9          --AQHITWMLDLGPWNYAIAFAFMITGLLLTMRWR-------------------------
G8RME6_MYCRN          --QSAIPFMADLGPWNYAIAFAFMISGLLLTMRWR-------------------------
E4WB79_RHOH1          ---ENLSWMNDLGAYNFLIGFGFMVVGLIMTMRWR-------------------------
C1B7V2_RHOOB          ---DQLEWMNNLGAYNFLIGFGFMVVGLIMTMRWR-------------------------
C0ZLG5_RHOE4          ---DSITWMNDLGNYNFLVGFGFMVVGLVMTMRWR-------------------------
D0LA53_GORB4          DEGQALHWMANLNAWNFLIGFSLMVAGLLMTMKWR-------------------------
H6N358_GORPV          GPGQALHWMNNLGAWNFLIGFSMMVVGLLMTMKWR-------------------------
Q5Z3S3_NOCFA          ---EQISWMNDLNAWNFLIGFGLMVVGLIMTMRWR-------------------------
H6R5A6_NOCCG          ---DQISWMRDLDAWNFLIGFGLMVIGLIMTMRWR-------------------------
F6ERG8_HOYSD          ---EEIAWLNQLGPWNFLIGFGLWIVGLVMTLRWR-------------------------
D6ZB54_SEGRD          ---DALKWMADLQFWNLAIGFGLMVVGLLMTMRWH-------------------------
D5UPC7_TSUPD          APGKALNWMVELGPWNFAIGFGLMIVGLLMTMWWK-------------------------
C6WCG9_ACTMD          ---EKIPVMMDLGSWNFGIGFSLIIVGLLMTMRWR-------------------------
A4F5R6_SACEN          ---DKIPFMADLEAWNFAVGFAFMIIGLLMTMRWR-------------------------
G0G5P1_AMYMS          ---DKISWMADLGNWNFAGGFALMIAGLLMTMRWR-------------------------
C7MRQ7_SACVD          ---HKLDFMAELGSWNFAIGFALMITGLLMTMRWR-------------------------
F4CQF1_PSEUX          ---DNLALFSALGSWNFLIGFSLIVIGLLMTMRWR-------------------------
C8XIS1_NAKMY          ---ASIPFISGLGNWNFAIGFTLMIAGLLMTMRWR-------------------------
Q6NKH4_CORDI          ---QDISFMTELGPWNYGIGFGLFIIGLLMTMGWR-------------------------
V6V7I9_CORUL          ---EDIAFMMSLGAWNYGIGFGLFIVGLLMTMGWR-------------------------
CRGA_CORA7            ---ESIPFMQELGPWNYGIGFGLAIIGLLMTMGWR-------------------------
CRGA_CORGL            ---PQIPFMADLGAWNYGIGFGLMIIGLLMTMGWR-------------------------
CRGA_CORGB            ---PQIPFMADLGAWNYGIGFGLMIIGLLMTMGWR-------------------------
CRGA_COREF            ---PQIPFMNELDAWNYGIGFGLLIIGLLMTMGWR-------------------------
C4LLS1_CORK4          ---PQIPFMQDLNAWNYAIGFGLFVVGLLMTMGWK-------------------------
CRGA_CORJK            ---PEIPFMRDLNAWNYLIGFALLIVGLLMTMGWK-------------------------
CRGA_CORU7            ---PAIPLMVTLGPWNYLIGFGLFIVGLLMTMGWK-------------------------
G0H9U3_CORVD          ---GDIPLMRDLNAWNYLIGFGLLIAGLLMTMGWK-------------------------
F8E0M6_CORRG          ---DKIPFMSALNAWNYLIGFALMIIGLLMTMGWK-------------------------
I4EQ29_9ACTN          ---DRIGFMVSLGAWNFAIGFGAMVAGLVMSMRWR-------------------------
H6RJC5_BLASD          ---DQIPFMVTLQAWNFAIGFGAMVAGLIMSMRWR-------------------------
D2SGG1_GEOOG          ---ESIPFMSGLNAWNFAIGFGLMVAGLVMSMRWR-------------------------
D7GI16_PROFC          ---QQIPLMYALSNWNFVIGLGLIAGSFFVATLWK-------------------------
F5XIS0_MICPN          ---QHIPFMAALGNWNILIGMGAMAASFGIATLWK-------------------------
I6WZX9_PSEPQ          ---NYIGFMRALTEWNILIALGLIIACFSLMTLWK-------------------------
Q6ABC6_PROAC          ---NQIPGISDLGDWNILIGMGLMAAGFGVATLWK-------------------------
D2PQJ9_KRIFD          ---QDIPFMNDLGNWNLLIGMGLIAVGFVVSTQWI-------------------------
A8LCF9_FRASN          ---GGVLGMESLGGWNILIGFGFVVVGLAVSTQWR-------------------------
E3J3G6_FRAIE          ---GGVLGMEALGGWNILIGFGFVVIGLGVATQWH-------------------------
Q2J4K7_FRACC          ---GGVLGMEGLGGWNILIGFGFVVVGLAVSTQWR-------------------------
F8B2N4_FRADG          ---GDIPGMDSLGAWNILIGFGFVVVGLGVSTQWR-------------------------
D2AXI3_STRRD          --APTAPFIGDLANWNLLIGFVFIIFGVVLSTRWR-------------------------
D6Y259_THEBD          --APQTPGIETLGNWNLLVGFGLIILGVILSTRWR-------------------------
D1ADF7_THECD          --ATDVPLMSDLGNWNLGIGFGSIILGVILSTRWR-------------------------
J7L9G3_NOCAA          --GASVPYMQDWHNWNLLIGFSGIIIAVILSTRWH-------------------------
D7B8W7_NOCDD          --GSQIPYMQDWQNWNLLIGFSGIIVAVILSTRWH-------------------------
C7MH28_BRAFD          ---SAGQLPLPIGDWNLAVGFGVLMVGGGMLMFWK-------------------------
D6ZJS9_MOBCV          ---TAGINLLGLGNWNIAVGFGVIMVGFIMLMWWK-------------------------
CRGA_BIFLO            ----GSWPIPNIGAWNLGIGFALIMIGFLMTMGWR-------------------------
D6ZX97_BIFLJ          ----GSWPIPNIGAWNLGIGFALIMIGFLMTMGWR-------------------------
F9XZH6_BIFBU          ----GSWPIPNIGAWNLAIGFALIMIGFLMTMGWR-------------------------
E3EPK9_BIFBS          ----GTWPIPGIGAWNLAIAFAIIMVGFIMTMWWR-------------------------
S4I509_GARVA          -----SLPIPGIGAFNLLIAACLVMAGFLMTMCWR-------------------------
D2RCM1_GARV4          -----VLPIPGIGAWNLVIALVIVMTGFIMTMWWR-------------------------
D2Q6Y3_BIFDB          -----SYPIPNIGAWNLAIAVAIIMVGFLMTMWWR-------------------------
A0ZZD2_BIFAA          -----DYPIPHIGAWNLAIAFAIIMVGFIMTMWWR-------------------------
A0A0L7CUJ9_9BIFI      -----KYPIPGIGNWNLAVGFALIMIGFLMTVVWR-------------------------
F4H3V2_CELFA          ---SSRYPIPEIGQWNLAIGFVLIIAGFGMTTRWR-------------------------
F8A237_CELGA          ---GSSLLIPFLGGWNLAAGAAVIIAGFAMTTRWR-------------------------
D5UFI1_CELFN          ---GAALPVPGIGQWNLAVGFSIIIVGFGMLTRWR-------------------------
C5BUR3_BEUC1          ---QSNYPVPGIGNFNLAIGFAFILVGFVMTMRWR-------------------------
E6SEM0_INTC7          ---EYRYPISAIGVWNLAIGFALLMGGFIMTMRWR-------------------------
F6FQ79_ISOV2          ---GLGLPVPALGTWNLAVGFVLIIAGFALTTRWR-------------------------
D1BTB2_XYLCX          ---GGGFPIPPLGAWNLAVGFALIITGFGLTTRWK-------------------------
C7QYJ3_JONDD          ---TLGLPLPWIGQWNIAVGFVIMLGGLGLATRWR-------------------------
D1BI18_SANKS          ---GAQLPIPPIGRWNILVGFMILLGGFGLSTRWK-------------------------
CRGA_TROW8            ------LPLPAVGTWNILIAFGIIMAGFAMMSRWK-------------------------
CRGA_TROWT            ------LPLPAVGTWNILIAFGIIMAGFAMMSRWK-------------------------
B8H7E3_PSECP          ------FPVQPWGSWNIVAGFGIAIVGFMMTTRWRS------------------------
F0M4P4_PSEPM          ------YPVQAWESWNIVAGFGIAIIGFLMTTRWRS------------------------
A0JQU7_ARTS2          ------LPVRDWGSWNIVAGFGIAIAGFLMTTRWRS------------------------
A1R0U3_PAEAT          ------LPIREWASWNIVAGFGIAIVGFLMTTRWRS------------------------
A9WTU9_RENSM          ----LVLPIPSVGAWNIAIGFGIAIVGFLMTTRWRS------------------------
B0RH81_CLAMS          ------FPIPDLGVGNILIGFGLILVGFLMTTRWR-------------------------
Q6AHM3_LEIXX          ------YPVPALGPWNILVGFGIAFIGFLMTTRWR-------------------------
E8N924_MICTS          ------FPIPGIGPWNLVIGFGIAFVGFLMTTRWR-------------------------
E1VRL3_GLUAR          ------YPIPNIGGWNIVVGFGIAMVGFFMTTGWK-------------------------
C5C837_MICLC          ------LPIVQIGGWNILVGFGIALVGFLMMSRWSE------------------------
D2NQ77_ROTMD          ------FPIPDLGMWNVSVGVGAMMVSMLMMTRWR-------------------------
E3H360_ROTDC          ------LPVPGIGMWNVTIGVGAMMVGMVMMTRWR-------------------------
C7NIE3_KYTSD          ------YPVGAWGYYNVAAGMGFLLAGFLVATRWQ-------------------------
D7BLR3_ARCHD          ------APVPGFGNGNLFIGIGLMLVGFLMTMGWK-------------------------
A6W3X8_KINRD          ------LPVPGWDNWNLVAGFGLVLVGFAMTTRWR-------------------------
G8S4M3_ACTS5          --------VESWRYWNLAVGFGCMVASLGILSRWR-------------------------
I0GWY5_ACTM4          --------VESWRYWNLAVGFGCMVASLGLLSRWR-------------------------
F4F971_VERMA          --------VMELGYWNLAVGFGAMVGSLILLSRWR-------------------------
D3Q1H5_STANL          --------VAPWGYWNLAVGFASLVASLLVLSRWR-------------------------
A0LQT0_ACIC1          ---G--MDVLGGQAGNLIEGFGLLVIGLGLATQWR-------------------------
CRGA_STRAW            ------LPIDALDNWNIVVGFGFIAAGFGVSTQWK-------------------------
C9ZAJ0_STRSW          ------LPIDALGNWNIVVGFGFIAAGFGVSTQWK-------------------------
CRGA_STRCO            ------LPIDSLGNWNIVVGFGFIAAGFGVSTQWK-------------------------
H2K3T2_STRHJ          ------LPVDSLDNWNIVVGFGFIAAGFGVSTQWK-------------------------
F2RD30_STRVP          ------MPIESLRNWNIVVGFGFIAAGFGVSTQWK-------------------------
B1VPG8_STRGG          ------LPVDALGNWNIVVGFGFIAGGFAVSTQWK-------------------------
E2PWL1_STRC2          ------LPIKSIGDWNIVVGFGFIAAGFGVSTQWK-------------------------
F8JSE2_STREN          ------MPIESWGNWNIVVGFGFIAAGFVVSTQWK-------------------------
D7C8W8_STRBB          ------MPVDSLGNWNIVVGFGFIAAGFVVSTQWK-------------------------
E4MZF6_KITSK          ------WPVGSWGNWNILAGFGFIAAGFGVSTQWK-------------------------
C7QFQ9_CATAD          ------YPVSALHGWNMAVGFGLIITGFIASMRWK-------------------------
A1SCN5_NOCSJ          ---SDIPVFNDLGQKNLFVGIAFMAVGFTFATRWE-------------------------
C7Q8N0_CATAD          -----LPGQHALGGWNYAIVGALLSTFIALSMRWHGDPLEKSRREARSARAERSGAGNST
                                     *                 *                          

CRGA_MYCTU            -----
CRGA_MYCBO            -----
CRGA_MYCBT            -----
CRGA_MYCTA            -----
CRGA_MYCA1            -----
CRGA_MYCPA            -----
H8IHK7_MYCIA          -----
CRGA_MYCMM            -----
CRGA_MYCUA            -----
CRGA_MYCLE            -----
CRGA_MYCLB            -----
I4BC38_MYCCN          -----
CRGA_MYCSJ            -----
CRGA_MYCSK            -----
CRGA_MYCSS            -----
A0QNF8_MYCS2          -----
F5YWB1_MYCSD          -----
B1ME67_MYCA9          -----
G8RME6_MYCRN          -----
E4WB79_RHOH1          -----
C1B7V2_RHOOB          -----
C0ZLG5_RHOE4          -----
D0LA53_GORB4          -----
H6N358_GORPV          -----
Q5Z3S3_NOCFA          -----
H6R5A6_NOCCG          -----
F6ERG8_HOYSD          -----
D6ZB54_SEGRD          -----
D5UPC7_TSUPD          -----
C6WCG9_ACTMD          -----
A4F5R6_SACEN          -----
G0G5P1_AMYMS          -----
C7MRQ7_SACVD          -----
F4CQF1_PSEUX          -----
C8XIS1_NAKMY          -----
Q6NKH4_CORDI          -----
V6V7I9_CORUL          -----
CRGA_CORA7            -----
CRGA_CORGL            -----
CRGA_CORGB            -----
CRGA_COREF            -----
C4LLS1_CORK4          -----
CRGA_CORJK            -----
CRGA_CORU7            -----
G0H9U3_CORVD          -----
F8E0M6_CORRG          -----
I4EQ29_9ACTN          -----
H6RJC5_BLASD          -----
D2SGG1_GEOOG          -----
D7GI16_PROFC          -----
F5XIS0_MICPN          -----
I6WZX9_PSEPQ          -----
Q6ABC6_PROAC          -----
D2PQJ9_KRIFD          -----
A8LCF9_FRASN          -----
E3J3G6_FRAIE          -----
Q2J4K7_FRACC          -----
F8B2N4_FRADG          -----
D2AXI3_STRRD          -----
D6Y259_THEBD          -----
D1ADF7_THECD          -----
J7L9G3_NOCAA          -----
D7B8W7_NOCDD          -----
C7MH28_BRAFD          -----
D6ZJS9_MOBCV          -----
CRGA_BIFLO            -----
D6ZX97_BIFLJ          -----
F9XZH6_BIFBU          -----
E3EPK9_BIFBS          -----
S4I509_GARVA          -----
D2RCM1_GARV4          -----
D2Q6Y3_BIFDB          -----
A0ZZD2_BIFAA          -----
A0A0L7CUJ9_9BIFI      -----
F4H3V2_CELFA          -----
F8A237_CELGA          -----
D5UFI1_CELFN          -----
C5BUR3_BEUC1          -----
E6SEM0_INTC7          -----
F6FQ79_ISOV2          -----
D1BTB2_XYLCX          -----
C7QYJ3_JONDD          -----
D1BI18_SANKS          -----
CRGA_TROW8            -----
CRGA_TROWT            -----
B8H7E3_PSECP          -----
F0M4P4_PSEPM          -----
A0JQU7_ARTS2          -----
A1R0U3_PAEAT          -----
A9WTU9_RENSM          -----
B0RH81_CLAMS          -----
Q6AHM3_LEIXX          -----
E8N924_MICTS          -----
E1VRL3_GLUAR          -----
C5C837_MICLC          -----
D2NQ77_ROTMD          -----
E3H360_ROTDC          -----
C7NIE3_KYTSD          -----
D7BLR3_ARCHD          -----
A6W3X8_KINRD          -----
G8S4M3_ACTS5          -----
I0GWY5_ACTM4          -----
F4F971_VERMA          -----
D3Q1H5_STANL          -----
A0LQT0_ACIC1          -----
CRGA_STRAW            -----
C9ZAJ0_STRSW          -----
CRGA_STRCO            -----
H2K3T2_STRHJ          -----
F2RD30_STRVP          -----
B1VPG8_STRGG          -----
E2PWL1_STRC2          -----
F8JSE2_STREN          -----
D7C8W8_STRBB          -----
E4MZF6_KITSK          -----
C7QFQ9_CATAD          -----
A1SCN5_NOCSJ          -----
C7Q8N0_CATAD          AGSAG