CLUSTAL format seed alignment for MF_00747

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACEK_XANAC       -------------------------------MNHPSLPPQSERRALAIAQAVYEAFEDYH
ACEK_XANC5       -------------------------------MSHPPLPPQSERRALAIAQAVYEAFEDYH
ACEK_XANCP       -------------------------------MNQQPLPPQSERRALAIGRAVYEAFQDYH
ACEK_XANC8       -------------------------------MNQQPLPPQSERRALAIGRAVYEAFQDYH
ACEK_ANADE       ------------------------------------MLDERGALARGAAEAIRAGYEAYQ
ACEK_BORBR       -------------------------MIYSGDVQRIEPAPVAGPAPLDVAHLILAGFDRHY
ACEK_BORPA       -------------------------MIYSGDVQRIEPAPVAGPAPLDVAHLILAGFDRHY
ACEK_BURCA       --------------------------------MNHFPKLLSSQIGFDVAQTMLEYFDRHY
ACEK_BURCH       --------------------------------MNHFPKLLSSQIGFDVAQTMLEYFDRHY
ACEK_BURL3       --------------------------------MNHFPKLLSSQIGFDVAQTMLENFDRHY
ACEK_BURCM       --------------------------------MNHFPKLLSSQIGFDVAQTMLENFDRHY
ACEK_BURMA       --------------------------------MNHFPKLLSSQIGFDVAQTILENFDRHY
ACEK_BURPS       --------------------------------MNHFPKLLSSQIGFDVAQTILENFDRHY
ACEK_BURP1       --------------------------------MNHFPKLLSSQIGFDVAQTILENFDRHY
ACEK_BURTA       --------------------------------MNHFPKLLSSQIGFDVAQTILENFDRHY
ACEK_PARXL       --------------------------------MNHFPKLLSSQIGFDVAQTMLEGFDRHY
ACEK_CUPNH       --------------------------------MSHFPKLLSSQIAFDVARTMLDGFDKHY
ACEK_CUPNJ       --------------------------------MSHFPKLLSSQIAFDVARTMLDGFDKHY
ACEK_CUPMC       --------------------------------MSHFPKLLSSQIAYDVARTMLDGFDKHY
ACEK_RALSO       --------------------------------MSHFPKLLSSQIAFDVARTMLDGFDKHY
ACEK_POLSJ       ----------------------------------MFPQRLDSTIAYDIAKAMMDGFNRHY
ACEK_POLNA       ----------------------------------MFPQRLDSTVAYAIAKAMIDGFNRHY
ACEK_RHOFT       ----------------------------------MFPTRLDSSLAYDIAKAMMDGFNRHY
ACEK_ACIAC       ----------------------------------MFPRRLDSPAAYGIAQAMMDGFDRHY
ACEK_ACISJ       ----------------------------------MFPERLDAPQAYDIAKAMMDGFNRHY
ACEK_METPP       -------------------------------MAGSFVTTLNDPRAFDIAQALLDGFNRHY
ACEK_AZOSB       ---------------------------------MDAQVG-DNPVAQAIAHALVEGFNKHY
ACEK_AROAE       ---------------------------------MDASVG-ENPVAQSIAQAMIEGFNKHY
ACEK_DECAR       ---------------------------------MKISVGLYGTNAHQIALAMIQGFNKHY
ACEK_IDILO       ----------------------------------------MTISPETLAKSILDGFHSHY
ACEK2_PSEHT      ------------------------------------------MQPRHIAELILTGFKKHY
ACEK_COLP3       ---------------------------------------MKDELALTIANTIINGFERHF
ACEK_ECOL6       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_ECOL5       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_ECOK1       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_ECOUT       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_ECOLI       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_SHIBS       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_ECO57       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_SHIDS       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_SALCH       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_SALTY       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_SALTI       ---------------------------------------MPRGLELLIAQTILQGFDAQY
ACEK_YERPE       ---------------------------------------MVAKLEQLIAQTILQGFDAQY
ACEK_YERPA       ---------------------------------------MVAKLEQLIAQTILQGFDAQY
ACEK_YERPN       ---------------------------------------MVAKLEQLIAQTILQGFDAQY
ACEK_YERPS       ---------------------------------------MVAKLEQLIAQTILQGFDAQY
ACEK_YERE8       ---------------------------------------MVTKLEQLIAQTILQGFDAQY
ACEK_PHOLL       ---------------------------------------MGIDSAHLIAQTILQGFDAQY
ACEK_PECAS       ---------------------------------------MTRDLEKLVAQTILQGFDAQY
ACEK_PHOPR       ---------------------------------------MTAAMEQLVAHTILQGFDAMY
ACEK_AERHH       ---------------------------------------MQQPLEQAVAETILQRFESFY
ACEK_PSEAE       --------------------------------------MVQSAPASEIAALILRGFDDYR
ACEK_PSEAB       --------------------------------------MVQSAPASEIAALILRGFDDYR
ACEK_PSEF5       --------------------------------------MSQSWPAADIARMILDGFDDYR
ACEK_PSEPF       --------------------------------------MPQQWPATDIARLILDGFDDYR
ACEK_PSEPK       --------------------------------------MSQPWPAVEIARMILAGFDDYR
ACEK_PSEE4       --------------------------------------MSQPWPAAEIARVILDGFDDYR
ACEK_PSEA6       ------------------------------------MNNTHSSVLNKVAYLILHGFDKSY
ACEK1_PSEHT      --------------------------MPDTITNKLQNSTVQDVIATKLARAVFAGFEAMF
ACEK_RHOP2       MTATR-----HPF-ASDIDAATRIAEPDFDLLDALVRTDDPDDQAHTLARVVLAAFDNYY
ACEK_RHOPS       MTADA-----HLFSASDLEAATRIAEPDFELLDALIRTDDPDDQAHTLARVALSAFDNYY
ACEK_RHOPA       MTATASHTRARPLGASEIEHATRIAEPDFDLLDALYRTDDPDDQARLLARVVLSAFDNYY
                                                                 .      :.   

ACEK_XANAC       ARFSEITACAKQRFETRDWSGAREDAVARIALYDQYIAECMLRLRAVLLGQAHDR-----
ACEK_XANC5       ARFSEITARAKQRFETRDWSGAREDAVARIALYDQYIAECMLRLRAVLLGQAHDR-----
ACEK_XANCP       AQFSQITARARQRFETRDWSGAREDAVARIALYDHYISECMLRLRAVLLGQAHDR-----
ACEK_XANC8       AQFSQITARARQRFETRDWSGAREDAVARIALYDHYISECMLRLRAVLLGQAHDR-----
ACEK_ANADE       AERARITARARGRFEARDWAGAQRDARERLDLRDGVVHRTVGEVRAELGGAVQDR-----
ACEK_BORBR       ALFRYSAQRAKSLFESGDWHGMQRLSRERIEYYDMRVRECATQLDSALRGSDARTADGSR
ACEK_BORPA       ALFRYSAQRAKSLFESGDWHGMQRLSRERIEYYDMRVRECATQLDSALRGSDARTADGSR
ACEK_BURCA       RIFREAAVDAKTLFERGDWHGLQRLARERITSYDERVKECVEVLEDEYDAE---------
ACEK_BURCH       RIFREAAVDAKTLFERGDWHGLQRLARERITSYDERVKECVEVLEDEYDAE---------
ACEK_BURL3       RIFREAAVEAKTLYEHGDWHGLQRLARERITSYDDRVKECVEVLEDEYDAE---------
ACEK_BURCM       RIFREAAVDAKTLYERADWHGLQRLARERITSYDDRVQECVEVLQDEYDAE---------
ACEK_BURMA       RIFREAAVEAKDLFERADWHGLQRLARERITSYDDRVRECVELLEDEYDAE---------
ACEK_BURPS       RIFREAAVEAKDLFERADWHGLQRLARERITSYDDRVRECVELLEDEYDAE---------
ACEK_BURP1       RIFREAAVEAKDLFERADWHGLQRLARERITSYDDRVRECVELLEDEYDAE---------
ACEK_BURTA       RIFREAAVEAKDLFERSDWHGLQRLARERITSYDDRVRECVELLEDEYDAE---------
ACEK_PARXL       RIFRDAAIHAKTLFEQADWHGLQKLARDRITSYDERVEECVELLEDEYDAE---------
ACEK_CUPNH       RLFREVSHQAKLKFEAGDWHGLQQIQRDRIAFYNERVRESSVILEDEYDAE---------
ACEK_CUPNJ       RLFREVSRQAKVKFEAGDWHSLQQMQRDRIAFYNERVRETSVILEDEYDAE---------
ACEK_CUPMC       RLFREVSIEAKARFEVGDWHGLQQLQRDRIAFYNQRVHETIVTLQDEYDAE---------
ACEK_RALSO       RLFREVSVRAKALFEAGDWQGLQQLQRDRIAYYDERVREASVILEDEYDAE---------
ACEK_POLSJ       QLFRTESARAKHRFETADWHGQQRAQRERIEFYDLRVREASTRLEREFKAG---------
ACEK_POLNA       RLFRTESARAKHRFETADWHGQQRAQRERIEFYDLRVREASIRLEREFKAG---------
ACEK_RHOFT       RLFRTESARAKHRFETADWHGQQRAQRDRIEFYDLRVRECFMRLAREFKAD---------
ACEK_ACIAC       RLFRAESARAKHRFETSDWSGQQRAQRERIEFYDLRVKECVRRLEKEFSAG---------
ACEK_ACISJ       RLFRAESARAKHRFETADWHGQQRAQRERIEFYDLRVRECVRRLDKEFNAG---------
ACEK_METPP       KLFRQTSAEAKQRFEAADWHGQQRAQRERIEFYDLRVDEAAERLENEFRAS---------
ACEK_AZOSB       RIFRGTSRRAKEYFEAGDWRAQLDAVRDRVQFYDDRVDETVRRLLEEFDAD---------
ACEK_AROAE       RIFRETSRRAKESFEAAEWQAQIDAVRERVQFYDERVDEAVRRLHEEFDAD---------
ACEK_DECAR       TLFRQTSREAKTRFEQADWLGVHKAVKERIRFYDDRVDECVERLRNQFDAA---------
ACEK_IDILO       RRFQVLTQGARERFLKRDWTAVVSAASERIHYYDHQVGTTAKKVERR-VGTEL-------
ACEK2_PSEHT      LLFQKTTAKAPLAFAKRDWQAINDISRLRISHYDDRVNETTATLRQQ-QTEQL-------
ACEK_COLP3       AIFTEITQSARNRFQQCQWNEIHRSARARTNFYDERVKETFNDIKEDFNISSL-------
ACEK_ECOL6       GRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_ECOL5       GRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_ECOK1       GRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_ECOUT       GRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_ECOLI       GRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_SHIBS       GRFLEVTSGAQQRFEQADWHAVQLAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_ECO57       GRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_SHIDS       GRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITN-GQSTD-----
ACEK_SALCH       GRFLEVTSGAQQRFEQADWHAVQQAMKSRIHLYDHHVGLVVEQLRCITD-GKSTD-----
ACEK_SALTY       GRFLEVTSGAQQRFEQADWHAVQQAMKSRIHLYDHHVGLVVEQLRCITD-GKSTD-----
ACEK_SALTI       GRFLEVTSGAQQRFEQADWHAVQQAMKSRIHLYDHHVGLVVEQLRCITD-GKSTD-----
ACEK_YERPE       GRFLEVTAGAQHRFEQADWHAVQQAMKKRIHLYDHHVGLVVEQLKYITD-QRHFD-----
ACEK_YERPA       GRFLEVTAGAQHRFEQADWHAVQQAMKKRIHLYDHHVGLVVEQLKYITD-QRHFD-----
ACEK_YERPN       GRFLEVTAGAQHRFEQADWHAVQQAMKKRIHLYDHHVGLVVEQLKYITD-QRHFD-----
ACEK_YERPS       GRFLEVTAGAQHRFEQADWHAVQQAMKKRIHLYDHHVGLVVEQLKYITD-QRHFD-----
ACEK_YERE8       GRFLEVTAGAQHRFEQADWHAVQQAMKKRIHLYDSHVGLVVEQLKHITD-QRCFD-----
ACEK_PHOLL       GRFLEVTSGAQQRFEQADWHAVQQAMKKRINLYDHHVGLVVEQLKCIHS-AFGYD-----
ACEK_PECAS       GRFLEVTAGAQQRFEQADWPAVQQAMKQRIHLYDHHVGLVVAQLRCITG-IRCDD-----
ACEK_PHOPR       GRFLDVTAGAQERFEQQDWSSVHLALKKRISFYDHHVGLVTSQIQIMLG-ERYAN-----
ACEK_AERHH       SRFLEITQGSKSRFENSDWLGVQLAGRERIRLYDHHVGATTALIKQMMG-ATLPS-----
ACEK_PSEAE       EQFREITDGARARFEQAQWQEAQRASAQRINLYEEKVAETVAGLRAGLADSELLD-----
ACEK_PSEAB       EQFREITDGARARFEQAQWQEAQRASTQRINLYEEKVAETVAGLRVGLADSELLD-----
ACEK_PSEF5       EHFRQITDGARQRFEQAQWQQAQKASAARINLYEEKVGETVARLHQAFSTESLMD-----
ACEK_PSEPF       EHFRRITDGARERFEQARWQDTQTASAARINLYEEKVGETVARLREYFEPDTLMD-----
ACEK_PSEPK       DHFQRITLGARQRFEQARWQDIQQAAAARINLYEEKVAEVNGWLRQAFAAEVLLD-----
ACEK_PSEE4       EHFRRITLGARERFEQARWQDIQRAAAARINLYEEKVAEVNGWLRKGFEGQVLLD-----
ACEK_PSEA6       RWHSRITRDAQQRFEQALWQETQKAVKERIAIYERTLADAVGEIYQQVFPHQE-------
ACEK1_PSEHT      ATFLNITLGAQSRFEQRQYHEVQSAMRERLQVYERQVKSVSEAVKVIAYAELSCP-----
ACEK_RHOP2       AVSRRIPALAQAAFEARDWAATVRLSKIRLGLYTACIDQLVPLLKAGLPELANDE-----
ACEK_RHOPS       AVSRRIPALAKAAFYARDWPATVRLSKIRIGLYTACIDQLVPLLKAGLPELANDE-----
ACEK_RHOPA       AVSRRIPALAQAAFEARDWPVTVRLSKIRIGLYTACIDQLVPLLKAGLPELTTDE-----
                       .  :   :    :         *       :      :                

ACEK_XANAC       ------------ALWMRARDRYAALLSGLIDQELYKTFYNTLTRRYFGTHGVDADIEFIA
ACEK_XANC5       ------------ALWMRARDHYAALLSGLIDQELYKTFYNTLTRRYFGTHGVDADIEFIA
ACEK_XANCP       ------------ALWMRARTHYAELLTGLIDQELYKTFYNTLTRRYFRTQGVDAQIEFIA
ACEK_XANC8       ------------ALWMRARTHYAELLTGLIDQELYKTFYNTLTRRYFRTQGVDAQIEFIA
ACEK_ANADE       ------------EVWRRAKEAFEAVAAARPDAEIAGSFFNSVTRRVLTTVGVDPAIEFLA
ACEK_BORBR       ANGSAALSEAQTAFWQAVKQEFVGLLADHRQPECAETFFNSVSCRILHRDYFHNDFLFVR
ACEK_BORPA       ANGSAALSEAQTAFWQAVKQEFVGLLADHRQPECAETFFNSVSCRILHRDYFHNDFLFVR
ACEK_BURCA       --------NIDDEVWQQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRSYFSNDFIFVR
ACEK_BURCH       --------NIDDEVWQQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRSYFSNDFIFVR
ACEK_BURL3       --------NIDDEVWQQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRSYFSNDFIFVR
ACEK_BURCM       --------NIDDEVWQQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRSYFSNDFIFVR
ACEK_BURMA       --------NIDNEVWPQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRAYFNNDFIFVR
ACEK_BURPS       --------NIDNEVWPQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRAYFNNDFIFVR
ACEK_BURP1       --------NIDNEVWPQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRAYFNNDFIFVR
ACEK_BURTA       --------NIDHDVWPQIKLHYIGLLTSHRQPECAETFFNSVCCKILHRAYFNNDFIFVR
ACEK_PARXL       --------NIDDEVWQQIKLHYIGLLTTHRQPECAETFFNSVCCKILHRSYFSNDFIFVR
ACEK_CUPNH       --------NIEDEIWQQIKLHYIGLLTNHHQPELAETFFNSVCTRILHRSYFNNDFIFVR
ACEK_CUPNJ       --------NIEDEIWQQIKLHYIGLLTNHHQPELAETFFNSVCTRLLHRSYFNNDFIFVR
ACEK_CUPMC       --------DIEDEIWQQIKLHYIGLLTNHHQPELAETFFNSVFTRIQHRSYFNNDFIFVR
ACEK_RALSO       --------NIDDEIWRQIKLHFIGLLTNHHQPECAETFFNSVCTRILHRSYFNNDFIFLR
ACEK_POLSJ       --------EQSMDVWHQVKLHYIGLLVNHHQPELAETFFNSVTTKILHRSYFQNDFIFVR
ACEK_POLNA       --------EQPMDVWHQVKLHYIGLLVNHHQPELAETFFNSVTTKILHRSYFQNDFIFVR
ACEK_RHOFT       --------EQPMEVWQQVKLHYIGLLVDHHQPELAETFFNSVTTKILHHSYFQNDFIFVR
ACEK_ACIAC       --------AQPMDVWHQVKLHYIGLLVGHRQPELAETFFNSVTTKILHRTHFHNDFIFVR
ACEK_ACISJ       --------ALPMDVWHQIKLHYIGLMVNHLQPELAETFFNSVTTKILHRTHFHNDFIFVR
ACEK_METPP       --------SLSEETWQQVKLYYIGLLINHHQPELAETFFNSVTTKILHRSYFRNDFIFVR
ACEK_AZOSB       --------SLDDATWQQVKLHFIGALINHKQPELAETFFNSVGCKILHRTYFNNDYIFAR
ACEK_AROAE       --------SLDDSTWQQLKLQYIGILMRHKQPELAETFFNSVCCKILHRTYFNNDYLFAR
ACEK_DECAR       --------SIDDTTWQQVKLLYIGLLLNHKQPELAETFFNSVTTKILHRNYFHNDFIFVR
ACEK_IDILO       ----------DEGLWLATRQRYQQLLKFHPQAELAETFYNSVFCRVFDRAYFNNDYIFVE
ACEK2_PSEHT      ----------DEQLWLEVKKLYQHFLCFHPQAELAETFYNSVFCRLYHRRYFHNDFIFVE
ACEK_COLP3       ----------DDALWQRVKAVYSDLLINHKQPELAETFYNSVFCHLFERKYYHNDYIYVE
ACEK_ECOL6       -----------AAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_ECOL5       -----------AAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_ECOK1       -----------AAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_ECOUT       -----------AAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_ECOLI       -----------AAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_SHIBS       -----------AAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_ECO57       -----------AEFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_SHIDS       -----------AEFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_SALCH       -----------ADFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_SALTY       -----------ADFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_SALTI       -----------ADFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIF
ACEK_YERPE       -----------VEFLARVKEIYTGLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVF
ACEK_YERPA       -----------VEFLARVKEIYTGLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVF
ACEK_YERPN       -----------VEFLARVKEIYTGLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVF
ACEK_YERPS       -----------VEFLARVKEIYTGLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVF
ACEK_YERE8       -----------VNFLTRVKEIYTGLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVF
ACEK_PHOLL       -----------EEYIAKVKVVYTGLLPDYPRFEIAESFFNSVYCRLFEHRNLTPDKLFIF
ACEK_PECAS       -----------ADFLARMKHIYTGLLPDYPRFEIAESFFNSVYCRLFNHRELAPDKLFVF
ACEK_PHOPR       -----------RSFLMAVKSSYENLLLDYPRYEIAESFFNSVYCRIFEHRNINRDKLFVH
ACEK_AERHH       -----------QALLKQVKGAFSDLLPKCENFEVAESFFNSVYRRIFRHRNIRDENLYIH
ACEK_PSEAE       -----------VERWPIIKSAYIAQIDLRLDDELAETWFNSIFCGLFSHDNISDGTMFVH
ACEK_PSEAB       -----------VERWPIIKSAYIAQIDLRLDDELAETWFNSIFCGLFSHDNISDGTMFVH
ACEK_PSEF5       -----------VSQWPLVKSAYISLIDLRFDDELSETWYNSIFCGLFSHDLISDGCMFIH
ACEK_PSEPF       -----------VTCWPLVKSAYISIIDLRFDDELSETWYNSIFCSLFSHDLISDGCMFIH
ACEK_PSEPK       -----------VEQWPLVKNAYIHLIDPRLDDELAETWYNSLFCSLFSHDLISDGCMFIH
ACEK_PSEE4       -----------VEQWPLVKNAYIRLIDPRLDDELSETWYNSLFCSLFSHDQISDGCMFIH
ACEK_PSEA6       ----------NNQFWFDLKTRYQKILSDHPQYELAETFYNSVLGRIFKHQKINDEMMFIM
ACEK1_PSEHT      ------------QTWQLAKNIYGNMVKNHENEPIAHTFFNSTFGAIWDDKKIRTVHLFVL
ACEK_RHOP2       ------------QLWARAEAELLAAIAERYEADFAFAFWQSLRRKLVSDEWRPVSYDTGP
ACEK_RHOPS       ------------QVWVRAEAELLAAIAGRYEADFAFAFWQSLRRKLVSDEWRPVSYDTGP
ACEK_RHOPA       ------------QLWPTAEAELLAAIEGRYEADFAFAFWQSLRRKLVSDEWRPVSYDAGS
                                   .                 :::::                   

ACEK_XANAC       LDIEPTDAITVPVARHTYAVSP--------GRLTDMLVRVLGDYAFAVPYAHRTRCAAAI
ACEK_XANC5       LDIEPTDAITVPVARHTYAVSP--------GRLTDMLVRVLGDYAFAVPYTHRTRCAAAI
ACEK_XANCP       LDIEPTDAITVPVARHTYAVSP--------GRLTEMLVRVLGDYPFEVPYAHRTRCAAAI
ACEK_XANC8       LDIEPTDAITVPVARHTYAVSP--------GRLTEMLVRVLGDYPFEVPYAHRTRCAAAI
ACEK_ANADE       ADAPPPRE---DPPQHRAFARE--------ATTEALLARILRAAPISAPFEDLARDARLA
ACEK_BORBR       PAIATDYLD----SRIPSYRVYYPVA----EGLHKSLIRMVADFGLAVPYADLPRDARLL
ACEK_BORPA       PAIATDYLD----SRIPSYRVYYPVA----EGLHKSLIRMVADFGLAVPYADLPRDA---
ACEK_BURCA       PAISTEYLENDEPAAKPTYRAYYPGT----DGLAVTLERIVTNFQLDPPFEDLTRDIGCV
ACEK_BURCH       PAISTEYLENDEPAAKPTYRAYYPGT----DGLAVTLERIVTNFQLDPPFEDLTRDIGCV
ACEK_BURL3       PAISTEYLENDEPAAKPTYRAYYPGT----DGLATTLERIVTNFQLEPAFDDLPRDIGCV
ACEK_BURCM       PAISTEYLENDEPAAKPTYRAYYPGT----DGLAATLERIVTNFQLEPPFEDLTRDIGCV
ACEK_BURMA       PAISTEYIENDEPAAKPTYRAYYPGS----EGLAATLERIVTNFQLNPPFEDLERDIACI
ACEK_BURPS       PAISTEYIENDEPAAKPTYRAYYPGS----EGLAATLERIVTNFQLNPPFEDLERDIACI
ACEK_BURP1       PAISTEYIENDEPAAKPTYRAYYPGS----EGLAATLERIVTNFQLNPPFEDLERDIACI
ACEK_BURTA       PAISTEYIENDEPAAKPTYRAYYPGS----EGLAATLERIVTNFQLNPPFEDLERDIACI
ACEK_PARXL       PAISTEYIENDEPAAKPTYRAYYPGK----DGLAATLERIVTNFQLEPPFEDLTRDVGCV
ACEK_CUPNH       PAISTEYIENEESPTRPTFRAYYPGSR---EGMAACFERVVHNFQLESPFEDLQRDIGYV
ACEK_CUPNJ       PAISTEYIENEESPTRPTFRAYYPGSR---QGMAECFERIVHNFQLETPFEDLRRDVGHV
ACEK_CUPMC       PAISTEYIENEESPIKPTYRAYYPGSR---EGMAACFERIVNNFQLERPFEDLKRDAGYV
ACEK_RALSO       PAISTEYIENEESPTKPTYRAYYPGSR---EGLGGCLERIVHNFQLDAPFEDLPRDIGYV
ACEK_POLSJ       PAVSTEYIENEEPTAQPTYRAYYPTR----DNLREIIVRLVRDFDLRLEFEDLERDAGYV
ACEK_POLNA       PAVSTEYIENQEPTAQPTYRAYYPTQ----GNMHETLVKLVEDFGLCREFEDLRRDAGYV
ACEK_RHOFT       PAVSTEYIENDESETSPTYRSYYPTH----DSLAEVLVQMVLDFDLRCPFADLDSDAARV
ACEK_ACIAC       PAISTEYLENDEPGARPTYRAYYPTP----ESLQETLVRVVDNFQLQGEFEDLARDAGRV
ACEK_ACISJ       PAVSTEYIESDDPGARPTYRAYYPSR----DNLHETVVRIVEHCALQRDFENLPRDAGHV
ACEK_METPP       PAVSTEYIENEEPDSLPTYRAYYPSRPGSAEGLRETLLRIVDNYQLQREFEDLGRDIDYV
ACEK_AZOSB       PAISTEYIE----SYPPVYSSYYPQD----GGLRATIRRIIEDFDWQRPFEDLDRDIDCI
ACEK_AROAE       PAVSTEYIE----SYPPVYSSYYPQD----EGLRTTVRRIIEDFDWQRPFANLDRDIDNI
ACEK_DECAR       PSISTENIEG---DDTQTYRSYYAKE----DGLRGTVLKIVKDFDWHRPFVDLEHDVEHV
ACEK_IDILO       TVLANHIPV----PVENECHSYFPVV----DGLEGTLTRVFEDIGLGGEFENFENDIEQL
ACEK2_PSEHT      ATLKDAPAV----PVEAEYRSYFPVV----DGLKPTIKQIINHFDFKAPFVNLERDIRLL
ACEK_COLP3       STAHRLDDK----TQPEIYTSYQPKE----LGLKQTICDIMNSHRTVIPFEDLDRDVDAL
ACEK_ECOL6       SSQPERRFRTIPRPLAKDFHPD--------HGWESLLMRVISDLPLRLRWQNKSRDIHYI
ACEK_ECOL5       SSQPERRFRTIPRPLAKDFHPD--------HGWESLLMRVISDLPLRLRWQNKSRDIHYI
ACEK_ECOK1       SSQPERRFRTIPRPLAKDFHPD--------HGWESLLMRVISDLPLRLRWQNKSRDIHYI
ACEK_ECOUT       SSQPERRFRTIPRPLAKDFHPD--------HGWESLLMRVISDLPLRLRWQNKSRDIHYI
ACEK_ECOLI       SSQPERRFRTIPRPLAKDFHPD--------HGWESLLMRVISDLPLRLRWQNKSRDIHYI
ACEK_SHIBS       SSQPERRFRTIPRPLAKDFHPD--------HGWESLLMRVISDLPLRLRWQNKSRDIHYI
ACEK_ECO57       SSQPERRFRTIPRPLAKDFHPD--------HGWESLLMRVISDLPLRLHWQNKSRDIHYI
ACEK_SHIDS       SSQPERRFRTIPRPLAKDFYPE--------HGWEALLMRVLSDLPLRLPWQNKSRDINYI
ACEK_SALCH       SSQPERRFRTIPRPLAKDFFPD--------HGWETLLMRILSDLPLRLPWQNKSRDIRYI
ACEK_SALTY       SSQPERRFRTIPRPLAKDFFPD--------HGWEPLLMRILSDLPLRLPWQNKSRDIRYI
ACEK_SALTI       SSQPERRFRTIPRPLAKDFFPD--------HGWEPLLMRILSDLPLCLPWQNKSRDIRYI
ACEK_YERPE       SSQPERRFREIPRPLARDFIPK--------GDLSGMLQMVLNDLSLRLHWENLSRDIDYI
ACEK_YERPA       SSQPERRFREIPRPLARDFIPK--------GDLSGMLQMVLNDLSLRLHWENLSRDIDYI
ACEK_YERPN       SSQPERRFREIPRPLARDFIPK--------GDLSGMLQMVLNDLSLRLHWENLSRDIDYI
ACEK_YERPS       SSQPERRFREIPRPLARDFIPK--------GDLSGMLQMVLNDLSLRLPWENLSRDIDYI
ACEK_YERE8       SSQPERRFREIPRPLARDFAPK--------GDLSGMLQVVLNDLPLRLPWENLPRDIGYI
ACEK_PHOLL       TSQPARRFRDIPRPLSRDFFPN--------DNLALMLRTILNDLPLRLPWENLERDIYYI
ACEK_PECAS       SSQPEKRFHEIPRPIAKTFVPT--------DGWQRMLEKLLGDVPLRLPWEDLPRDIDYI
ACEK_PHOPR       SSQ-ENRIPTYPTQLTRIYHAH--------SGLTSLFDRVLDDTPFTQVWEDKQRDTKLI
ACEK_AERHH       PFRSRGEHPDLSALLRIYRTDL--------AHLPQTLSQLLGDYSFTLPYEDKQRDIVDI
ACEK_PSEAE       TTRPSLRAHARAPY-TRTYRPG--------GDLRQALEKIFDDYRFDVPYDDRERDLERI
ACEK_PSEAB       TTRPSLRAHARAPY-TRTYRPG--------GDLRQALEKIFDDYRFDVPYDDRERDLERI
ACEK_PSEF5       TTRPSLR-RARAAQ-TRSYKPQ--------GELATMLEQVFADYRFSEDYADLPGDLRRL
ACEK_PSEPF       TTRPSLR-RARAAQ-TRTYKPQ--------GQISGMLASIFADYRFSEAYADLPGDLLRL
ACEK_PSEPK       TTRPSMRGRERAAQ-TRTYRLD--------GSLRNLLRAVFADYPFDMPYGDLEGDLARL
ACEK_PSEE4       TTRPSMRVHERAAQ-TRTYALT--------DRLKGLLRAIFADYAFDVPYGDLEADLSRL
ACEK_PSEA6       PTRCYLAGLQRHLVVHSFDTSG---------TVRRMLEDIFSQYHFDIAFQDMQRDLQHL
ACEK1_PSEHT      KAKYRTQPRPYDSLVKRISLQH---------GFNSAIKTLITNQVFRVPFSNLNQDVATL
ACEK_RHOP2       AARPKATSAAILKTIATTLPIR-----------PAVIRDILDGAGLRGPWRDRDGDAALA
ACEK_RHOPS       AARPPAAIAAVVRTIAATLPIQ-----------PEVIRNVLDAAGFTGPWRDLDGDAALA
ACEK_RHOPA       TARRTTSPAAVLKTTATTLPIT-----------AEVIAGILDEAGFRVPWRDRDGDAALA
                                                     .  :.        : .        

ACEK_XANAC       AVRLLDDLAHWGE-------HPVRSVELLETVFYRERRAYLVGRVFGEHR------FSPC
ACEK_XANC5       AVRLLDDLAHWGE-------HPVRSVELLETVFYRERRAYLVGRVFGEHR------FSPC
ACEK_XANCP       AVRLLDDLAHWGE-------HPVRSVELLETVFYRERRAYLVGRLFGEHR------FSPC
ACEK_XANC8       AVRLLDDLAHWGE-------HPVRSVELLETVFYRERRAYLVGRLFGEHR------FSPC
ACEK_ANADE       ALELDAHVRGLPDR------QPIDAVELARPVFYRGKGAYLVGRIRRGRH------LTPL
ACEK_BORBR       ARAAVRQLRGQLPRHAGPRLASDCQIQVLGSLFFRNTGAYIVGRLINQGT------VYPF
ACEK_BORPA       ----------------GPRLASDCQIQVLGSLFFRNTGAYIVGRLINQGT------VYPF
ACEK_BURCA       MQAIDDEFGHFD-------EAPNFQIHVLSSLFFRNKSAYIVGRIINADR------VLPF
ACEK_BURCH       MQAIDDEFGHFD-------EAPNFQIHVLSSLFFRNKSAYIVGRIINADR------VLPF
ACEK_BURL3       MQAIHDEFGHFD-------EAPNFQIHVLSSLFFRNKSAYIVGRIINADR------VLPF
ACEK_BURCM       MQAITDEFGEFD-------AAPNFQIHVLSSLFFRNKSAYIVGRIINADR------VLPF
ACEK_BURMA       MQAIHDEFGAFD-------EAVNFQIHVLSSLFYRNKTAYVVGRIINGDR------VLPF
ACEK_BURPS       MQAIHDEFGAFD-------EAVNFQIHVLSSLFYRNKTAYVVGRIINGDR------VLPF
ACEK_BURP1       MQAIHDEFGAFD-------EAVNFQIHVLSSLFYRNKTAYVVGRIINGDR------VLPF
ACEK_BURTA       MQAIHDEFGAFD-------EAVNFQIHVLSSLFYRNKTAYIVGRIINGDR------VLPF
ACEK_PARXL       MQAIQDAFGVFD-------EAPNFQIHVLSSLFYRNKSAYIIGRIINGDL------LMPF
ACEK_CUPNH       VRAVSEHFGDLR-------IAPNFQVHTLSSLFFRNKSAFIIGRILNGDR------TFPL
ACEK_CUPNJ       VRGVEEHFGDFR-------IAPNFQIHVLSSLFFRNKTAFIIGRIVNADR------TYPL
ACEK_CUPMC       ARAITEHFGEFR-------IAPNFQVHTLSSLFFRNKTAFVIGRVINGDH------TYPL
ACEK_RALSO       VRAVGEHFGDFR-------IAPNFQIHVLSSLFFRNTAAYIIGRVINGDK------TYPL
ACEK_POLSJ       LEAVSERLSDVK-------LRANFQIQVLSGLFFRNKGAYVVGKIINGFN------EVPL
ACEK_POLNA       AEAMAARLGDVK-------LRANFQIQVLSGLFFRNKGAYVVGKIINGFG------EIPF
ACEK_RHOFT       QAAMVEQLGEVK-------LRANFQLQVLSGLFFRNKGCYIVGKLINGFN------EFPF
ACEK_ACIAC       AEVMRPRLGPAK-------WRANFQIQVLSSLFYRNKGAYLVGKVINGFQ------ELAF
ACEK_ACISJ       VQALQQRLGAVK-------LRTNFQVQVLSSLFFRNKGAYLVGKVINGYN------ELPF
ACEK_METPP       LQAFRNQFGDVK-------LSANFQIQVLASLFFRNKGAYIVGKVINGFR------ETGF
ACEK_AZOSB       MRAALAHLGEWPA------MEVNCQLQVLYSAFYRNKTAYIIGKVINGWQ------DYPF
ACEK_AROAE       LRAVHEHIGAWPD------MEVNCQIQVLYSAFYRNKTAYIIGKAINGYQ------EYPF
ACEK_DECAR       YHAVRHFLNGMPP------REVNFQIQVLGSAFYRNKAAYIIGKAINGAT------EYPF
ACEK_IDILO       RDKFFERATETDI------EAHNLRIDVLKSPFYRNKAAYIVGRVVTENN------HYPF
ACEK2_PSEHT      VKAFYKQAPDTHH------KAWQMRFDILHTPFYRNKAAYIVGRVVSQSG------VQPF
ACEK_COLP3       INTFRRKAHKTRV------KLEDLKFDILNFTFYRNKGAYLIGRVLSPAG------ETPF
ACEK_ECOL6       VRHLTETLGTDN------LAES--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_ECOL5       VRHLTETLGTDN------LAES--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_ECOK1       VRHLTETLGTDN------LAES--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_ECOUT       VRHLTETLGTDN------LAES--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_ECOLI       IRHLTETLGTDN------LAES--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_SHIBS       IRHLTETLGTDN------LAES--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_ECO57       IRHLTETLGPEN------LSKS--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_SHIDS       IRHLTETLGPEN------LSES--HLQVANELFYRNKAAWLVGKLITPSG------TLPF
ACEK_SALCH       IAHLTETLGEDA------LPRC--HVQVANELFYRNKAAWLVGKLTTPDG------TLPF
ACEK_SALTY       IAHLTETLGEDA------LPRC--HVQVANELFYRNKAAWLVGKLTTPDG------TLPF
ACEK_SALTI       IAHLTETLGEDA------LPRC--HVQVANELFYRNKAAWLVGKLTTPDG------TLPF
ACEK_YERPE       VMAIRQAFTDEQ------LASA--HFQIANELFYRNKAAWLVGKLRLNGD------IYPF
ACEK_YERPA       VMAIRQAFTDEQ------LASA--HFQIANELFYRNKAAWLVGKLRLNGD------IYPF
ACEK_YERPN       VMAIRQAFTDEQ------LASA--HFQIANELFYRNKAAWLVGKLRLNGD------IYPF
ACEK_YERPS       VMAIRQAFTDEQ------LASA--HFQIANELFYRNKAAWLVGKLRLNGD------IYPF
ACEK_YERE8       ATALRQNFTDEQ------LATA--RFQVANELFYRNKAAWLVGKLRLADE------VYPF
ACEK_PHOLL       TDYLQQTFPVGE------LLQA--TFQIANELFYRNKAAWLVGKIRIGGQ------VYPF
ACEK_PECAS       VTYLQSTFSAEQ------LEQA--TLQVANELFYRNKAAWLAGKLSLPDG------VFPF
ACEK_PHOPR       INHLKQELGAAF------NDET--SLELIREPFYRNKAAYLIGKITLNHDGQYQ--TIPL
ACEK_AERHH       QRHLAENGPAIL------HDEPF-AIELLKEVFYRNKGAYLVGLIRVKGQ------VFPF
ACEK_PSEAE       DALLHSNLPDWV------CKDPDLAIELIGSVFYRNKGAYLVGRLFTPDE------QWPL
ACEK_PSEAB       DALLHSNLPDWV------CKDPDLAIELIGSVFYRNKGAYLVGRLFTPDE------QWPL
ACEK_PSEF5       EAQLRENLPDWV------CKDPELTLELFSSVLYRNKGAYLVGRIFTHEE------QWPL
ACEK_PSEPF       EAQLRENLPDWV------CKDPELSVELFSSVLYRNKGAYLVGRIYTNDD------QWPL
ACEK_PSEPK       EEQLRECLPDWV------CKDPALAVELFVPVLYRNKGAYLVGRLYNSDE------QWPL
ACEK_PSEE4       EEQLRECLPDWV------CKDPQLKIELFTPVLYRNKGAYLVGRLYTPDE------QWPL
ACEK_PSEA6       DGALRARLNREQ-------LASVHTVEMLKPVFYRSKSAYLIGRICMPDE------TLPF
ACEK1_PSEHT      QATLTQGAKQQCRQVYELINLNDGYIEYAYSHFYRNKACYLIGRCIAKNGD-----NMPF
ACEK_RHOP2       AAAIEAALEPLGP-----RAGETAKIEIAESGFFRNRGACLVGRVRLRDRGDMPMRNLPL
ACEK_RHOPS       AAAIEAALEPLSP-----RAGETAKIEIAESGFFRNRGACLVGRIRLRDRGDMPPRNIPL
ACEK_RHOPA       AQAIETALEPLSP-----RPGEPVKIEIADSGFLRNRGACLVGRIKLRDRGDMPMRNLPL
                                          ..     : *   . : *                 

ACEK_XANAC       VIALINDD--------------------AGLRAEAVLTRRSDVAQLFSNSRSYFQADLST
ACEK_XANC5       VIALINDE--------------------AGLRAEAVLTRRSDVAQLFSNSRSYFQADLST
ACEK_XANCP       VIALVNDD--------------------AGLRAEAVLTRRSDVAQLFSNSRSYFQADLTT
ACEK_XANC8       VIALVNDD--------------------AGLRAEAVLTRRSDVAQLFSNSRSYFQADLTT
ACEK_ANADE       VLALAHGD--------------------RGVALDAVLFTEEDVSIVFGFTRSYFHVALER
ACEK_BORBR       AVALRRNP-------------------AGQVCLDALLLGADDLSTLFSFTRAYFLVDMET
ACEK_BORPA       AVALRRNP-------------------AGQVCLDALLLGTDDLSTLFSFTRAYFLVDMET
ACEK_BURCA       AVPIRHVR-------------------PGVLALDTVLLRRDLLQIIFSFSHSYFLVDMGV
ACEK_BURCH       AVPIRHVR-------------------PGVLALDTVLLRRDLLQIIFSFSHSYFLVDMGV
ACEK_BURL3       AVPIRHVR-------------------PGVLSLDTVLLRRDQLMIIFGFSHSYFLVDMGV
ACEK_BURCM       AVPIRHVR-------------------PGLLALDTLLLRRDLLQIIFSFSHSYFLVDMGV
ACEK_BURMA       AVPIRHAR-------------------AGILALDTVLLRRDQLKIIFSFSHSYFLVDMNV
ACEK_BURPS       AVPIRHAR-------------------AGILALDTVLLRRDQLKIIFSFSHSYFLVDMNV
ACEK_BURP1       AVPIRHAR-------------------AGILALDTVLLRRDQLKIIFSFSHSYFLVDMNV
ACEK_BURTA       AVPIRHAR-------------------AGVLALDTVLLRRDQLKIIFSFSHSYFLVDMNV
ACEK_PARXL       AVPLRHVK-------------------PGVLALDTVLLKRDQLLIIFSFSHSYFLVDMEV
ACEK_CUPNH       AIPIVHGP-------------------SGKLTLDTVLLKKEQLLILFSFTHSYFMVDMEI
ACEK_CUPNJ       AIPIVHGP-------------------SGKLTLDAVLLKKVQVLILFSFTHSYFMVDMEI
ACEK_CUPMC       VVPIIHAA-------------------SGKLVLDTVLLHREQILILFSFAHAYFMVDMEI
ACEK_RALSO       AVPIMRGA-------------------DGQLRLDTVLLRPEQLLILFSFTHSYFMVDMEI
ACEK_POLSJ       ALPILHSK-------------------SGKLVIDAALFGEDDLLILFSFARAYFMVDMGI
ACEK_POLNA       ALPILHRQPAPGQVLPADGKGISSQSDAGKLVIDAALFGEDDLLILFSFARAYFMVDMGI
ACEK_RHOFT       ALPVLYGR-------------------AGQLVIDAVLFGEDDLLMLFSFARAYFMVDMEI
ACEK_ACIAC       ALPILHGT-------------------DGRYVIDAALFGEDDLQMLFSFARAYFMVDMEI
ACEK_ACISJ       ALPILHGE-------------------DGRLLIDAVLFGENDLQMLFSFARAYFMVDMEI
ACEK_METPP       ALPVLHNS-------------------RELLTIDTALFGEDELLLLFSFARAYFLVDMEI
ACEK_AZOSB       TLAVRHGA-------------------SGRLVIDTILLDPWRISVLFSLSRAYFMVDMEV
ACEK_AROAE       ALAVRHNP-------------------AGRLEADTILLDPWRISVLFSLSRAYFLVDMEV
ACEK_DECAR       TIPVLQNE-------------------AGQLYLDTILLDAWRIGLLFSLSRAYFMVDMEV
ACEK_IDILO       IVPVLINS-------------------QGKLYVDAFITRSDRMATIFGFARSYFMVETEA
ACEK2_PSEHT      IIAVLHHE-------------------DKGLYLDALLTKSSQMRVIFGFARAYFMVETHA
ACEK_COLP3       IIAVLNNE-------------------KGGLYIDALLTSSESMAVVFGFARAYFFVDCEH
ACEK_ECOL6       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_ECOL5       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_ECOK1       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_ECOUT       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_ECOLI       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_SHIBS       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYA--
ACEK_ECO57       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_SHIDS       LLPIHQTD-------------------DGELFIDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_SALCH       LLPIHRTD-------------------EGELFVDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_SALTY       LLPIHRTD-------------------EGELFVDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_SALTI       LLPIHRTD-------------------EGELFVDTCLTTTAEASIVFGFARSYFMVYAPL
ACEK_YERPE       LLPIHHNE-------------------SGELFIDTCLTSKAEASIVFGFARSYFMVYVPL
ACEK_YERPA       LLPIHHNE-------------------SGELFIDTCLTSKAEASIVFGFARSYFMVYVPL
ACEK_YERPN       LLPIHHNE-------------------SGELFIDTCLTSKAEASIVFGFARSYFMVYVPL
ACEK_YERPS       LLPIHHNE-------------------SGELFIDTCLTSKAEASIVFGFARSYFMVYVPL
ACEK_YERE8       LLPIHHNE-------------------SGGLFIDTCLTSKAEASIVFGFARSYFMVYAPL
ACEK_PHOLL       LLPIHHNE-------------------SGGIFIDTCLTDYADASIVFGFARSYFMVYAPL
ACEK_PECAS       LLPIHHNE-------------------RGALFIDTCLTAQADASMVFGFARSYFMVYAPQ
ACEK_PHOPR       VLPVLNNS-------------------NKQLYVDACICHVNDASIIFGFARSYFMVYAPA
ACEK_AERHH       ILPLLSTG-------------------Q-SIYVDTVIFEPELASIVFGFARAYFMVYAPM
ACEK_PSEAE       VFPLLHRE-------------------DHGIQFDTVITDEAEVSIIFSFTRSYFMVDVPV
ACEK_PSEAB       VFPLLHRE-------------------GHGIQFDTVITDEAEVSIIFSFTRSYFMVDVPV
ACEK_PSEF5       VIPLLHRE-------------------GRGIQIDALITDEADVSIIFSFTRSYFMVDVPV
ACEK_PSEPF       VIPLLHRE-------------------GRGIQIDALITDEAEVSIIFSFTRSYFMVDVPV
ACEK_PSEPK       VIPLLHRE-------------------GHGIEADALITDEAEVSIIFSFTRSYFMADVPV
ACEK_PSEE4       VIPLLHRE-------------------GHGIEADALITDEAEVSIIFSFTRSYFMVDVPV
ACEK_PSEA6       VIPLSIAEAETSGE-------------KHKIVVEALLTERQDLSVVFSFARAYFMADTQH
ACEK1_PSEHT      AIAILNTP--------------------KGLKIDAVMMGADQLSLLFGFARTYFMVDTDQ
ACEK_RHOP2       LIALLNED--------------------DGLVVDAVLCDADELQYAFSSTLANYHATNPH
ACEK_RHOPS       LVALLNED--------------------DGLVVDAVLCDSDELQFAFSSTLANYHATNPR
ACEK_RHOPA       LIALLNEK--------------------DGLVVDAVLTDSDELQYAFSSTLANYHATNPR
                  ..:                             :: :         *. : : : .    

ACEK_XANAC       VGDAVVFLRSLLTHKPVDELYTMLGRAKQGKTERYRTFFSHFQAHP-SEQLVHADGTPGM
ACEK_XANC5       VGDAVVFLRSLLTHKPVDELYTMLGRAKQGKTERYRTFFSHFQAHP-SEQLVHADGTPGM
ACEK_XANCP       VGDAVVFLRSLLTHKPIDELYTMLGRAKQGKTERYRTFFRHFQAHP-AEQLVHADGTPGM
ACEK_XANC8       VGDAVVFLRSLLTHKPIDELYTMLGRAKQGKTERYRTFFRHFQAHP-AEQLVHADGTPGM
ACEK_ANADE       PRAMVAFLSTLLPLKRRSELYTGLGYHKHGKAELYREVAQHLAEG--DDRFVPARGDRGL
ACEK_BORBR       PAAVVNFLASLLPRKPKAELYTMLGLQKQGKTLFYRDFLHHLTHS--RDAFDIAPGIRGM
ACEK_BORPA       PAAVVNFLASLLPRKPKAELYTMLGLQKQGKTLFYRDFLHHLTHS--RDAFDIAPGIRGM
ACEK_BURCA       PSAYVDFLCTIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIIAPGIKGL
ACEK_BURCH       PSAYVDFLCTIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIIAPGIKGL
ACEK_BURL3       PSAYVDFLCTIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIIAPGIKGL
ACEK_BURCM       PSAYVEFLCTIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIIAPGIKGL
ACEK_BURMA       PSAYVQFLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIVAPGIKGL
ACEK_BURPS       PSAYVQFLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIVAPGIKGL
ACEK_BURP1       PSAYVQFLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIVAPGIKGL
ACEK_BURTA       PSAYVQFLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDRFIIAPGIKGL
ACEK_PARXL       PSAYVEFLGTIMQGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHS--SDQFIIAPGIKGL
ACEK_CUPNH       PSAYVTFLRDIMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHS--SDKFIVAPGIRGL
ACEK_CUPNJ       PSAYVTFLRDIMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHS--SDKFISAPGIKGL
ACEK_CUPMC       PSAYVTFLRDLLPRKSRAEIYTSLGLQKQGKNLFYRDFLHHLQHS--SDKFISAPGIKGL
ACEK_RALSO       PSAYVTFLRDLMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHS--SDKFIIAPGIKGL
ACEK_POLSJ       PSAYVQFLRSMMPHMPRAEIYNALGLAKQGKTLFYRDFLHHLRHS--TDKFRIAPGIKGM
ACEK_POLNA       PSAFVQFLRSMMPRMPRAEIYNALGLAKQGKTLFYRDFLHHLRHS--TDKFRIAPGIKGM
ACEK_RHOFT       PSAYVQYLRSMMPRKPRNEIYNALGLAKQGKTLFYRDFLHHQRHS--TDKFRIAPGIKGM
ACEK_ACIAC       PSAYVQFLRSLMPRKPRAELYNALGLAKQGKTLFYRDFLHHLRYS--SDRFRIAPGIKGM
ACEK_ACISJ       PSAYVQFLRSLMPRKPRAELYTALGLAKQGKTLFYRDFLHHLRYS--TDKFRIAPGIKGM
ACEK_METPP       PSAYVQFLRSLMPRKPRWELYNALGLQKQGKNQFYRDFLYHLRHS--SDSFRIAPGIKGM
ACEK_AZOSB       PSGYVQFLRSIMPNKPRSELYTMLGLGKQGKTMFFRDLVAHLRHS--NDQFIIAPGIRGL
ACEK_AROAE       PSGYVHFLRSIMPNKHRSELYTMLGLGKQGKTMFFRDLIAHLRHS--NDQFIIAPGIRGL
ACEK_DECAR       PSGYVQFLRSILPAKPRSELYIMLGLGKQGKTMFFRDLIYHLHHS--EDKFIMAPGIRGL
ACEK_IDILO       PSALVRFLKDLMPHKTLAELYSSVGFHKQGKTEFYREFLHHLRRT--DDQLSAAPGVKGM
ACEK2_PSEHT      PCALVRFLNQLMPNKTIAELYNAIGFHKQGKTEFYREFLNHLTHS--NDEFTIAPGTPGM
ACEK_COLP3       PYALVNFLQGLMPHKTKADLYSAIGFHKQGKTQFYRDFLNHLDSS--DDQFELAAGIKGM
ACEK_ECOL6       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_ECOL5       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_ECOK1       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_ECOUT       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_ECOLI       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_SHIBS       --ALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_ECO57       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_SHIDS       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGC--NEQFIEAPGIRGM
ACEK_SALCH       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLCYLAES--DEKFIEAPGIRGM
ACEK_SALTY       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLCYLAES--DEKFIEAPGIRGM
ACEK_SALTI       PAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLCYLAES--DEKFIEAPGIRGM
ACEK_YERPE       PAAMVEWLREILPGKSTAELYTAIGCQKHGKTESYREYLAFIHQS--SEQFIIAPGVKGM
ACEK_YERPA       PAAMVEWLREILPGKSTAELYTAIGCQKHGKTESYREYLAFIHQS--SEQFIIAPGVKGM
ACEK_YERPN       PAAMVEWLREILPGKSTAELYTAIGCQKHGKTESYREYLAFIHQS--SEQFIIAPGVKGM
ACEK_YERPS       PAAMVEWLREILPGKSTAELYTAIGCQKHGKTESYREYLAFIHQS--SEQFIIAPGVKGM
ACEK_YERE8       PAAMVEWLREILPGKSTAELYMAIGCQKHGKTESYREYLTFVHQS--SEQFIIAPGVKGM
ACEK_PHOLL       PAALVEWLREILPAKSTSELYMAIGCQKHGKTEYYREYLAFITFS--KEQLIIAPGVKGM
ACEK_PECAS       PSALVAWLRDILPGKTTAELYLAIGCQKHSKTEYYREYLHYIAES--EEQFIIAPGVKGM
ACEK_PHOPR       PGALVRFLSNLIPNKTNAELYTAIGCQKHGKTELYREFLTHLDNS--DDQFVTAPGIKGM
ACEK_AERHH       PALFVLFLRQIMPHKPDYEIYNAIGCQKHGKTELYRHYQQHLAQS--REQFVIAPGIKGM
ACEK_PSEAE       PAELVAFLKRLLPGKHLAELYTSIGFYKQGKSEFYRALINHLATT--DDRFVMAPGVRGM
ACEK_PSEAB       PAELVAFLKRLLPGKHLAELYTSIGFYKQGKSEFYRALINHLATT--DDRFVMAPGVRGM
ACEK_PSEF5       PAEFIGFLKRILPGKHIAELYTSIGFYKHGKSEFYRALINHLAST--DDRFIMAPGVRGM
ACEK_PSEPF       PAEFIGFLKRILPGKHIAELYTSIGFYKHGKSEFYRALINHLANT--DDQFIMAPGVRGM
ACEK_PSEPK       PAEFVNFLKRILPGKHIAELYTSIGFYKQGKSEFYRALINHLASS--DDRFVMAPGVRGM
ACEK_PSEE4       PGEFVNFLKRILPGKHIAELYTSIGFYKHGKSEFYRALINHLANS--DDRFVMAPGVRGM
ACEK_PSEA6       PAEVVAFLHELLPHKKKFELYIALGLYKHGKTVFYRNFLAHLEES--NDQFSIAPGIRGL
ACEK1_PSEHT      PARYVDYLSVLMPHKQRFELFNAIGFIKHAKTEFYRYKVDTTKNSPASFKYVAAPGTPGM
ACEK_RHOP2       YHELARLLHELMPKRPLGTQYSCIGFHHLGKVAVMTEILAEHRRS--KEKLDTAPGFKGT
ACEK_RHOPS       YHELARLLHELMPKRPLGTQYSCIGFHHLGKVAVMNEILTEHRRS--KEKLATAPGFKGT
ACEK_RHOPA       YHELARLLYELMPKRPLGTQYSCIGFHHLGKVAVMSEILAEHRKT--KEKLATAPGFKGT
                        *  ::        :  :*  : .*                      * *  * 

ACEK_XANAC       VMVVFTLPSYPLVFKLIRDRFAYPKTMSR----AQVEGKYELVFQLDRIGRLLDAQPYRF
ACEK_XANC5       VMVVFTLPSYPLVFKLIRDRFAYPKTMSR----AQVEGKYELVFQLDRIGRLLDAQPYRF
ACEK_XANCP       VMVVFTLPSYPLVFKLIRDRFAYPKTMSR----AQVEGKYELVFQLDRIGRLLDAQPYRF
ACEK_XANC8       VMVVFTLPSYPLVFKLIRDRFAYPKTMSR----AQVEGKYELVFQLDRIGRLLDAQPYRF
ACEK_ANADE       VMCVFTLPGLDVIFKVIRDRFAPPKQTTR----REVMDRYRHVFRHDRAGRLVDAQEYEH
ACEK_BORBR       VMCVFTLPSYPYVFKLIKDRID-KDGMDH----ATVRRKYQMVKLHDRVGRMADTWEYSQ
ACEK_BORPA       VMCVFTLPSYPYVFKLIKDRID-KDGMDH----ATVRRKYQMVKLHDRVGRMADTWEYSQ
ACEK_BURCA       VMLVFTLPSFPYVFKIIKDHFPPPKETTR----AQIMEKYQLVKRHDRLGRMADTLEYSS
ACEK_BURCH       VMLVFTLPSFPYVFKIIKDHFPPPKETTR----AQIMEKYQLVKRHDRLGRMADTLEYSS
ACEK_BURL3       VMLVFTLPSFPYVFKIIKDHFPPPKETTR----AQIMEKYQLVKRHDRLGRMADTLEYSS
ACEK_BURCM       VMLVFTLPSFPYVFKIIKDHFPPPKETTR----EQIMEKYQLVKRHDRLGRMADTLEYSS
ACEK_BURMA       VMLVFTLPSFPYVFKMIKDHFPPPKDTTR----EQIMAKYLLVKRHDRLGRMADTLEYSS
ACEK_BURPS       VMLVFTLPSFPYVFKMIKDHFPPPKDTTR----EQIMAKYLLVKRHDRLGRMADTLEYSS
ACEK_BURP1       VMLVFTLPSFPYVFKMIKDHFPPPKDTTR----EQIMAKYLLVKRHDRLGRMADTLEYSS
ACEK_BURTA       VMLVFTLPSFPYVFKMIKDHFPPPKETTR----EQIMDKYLLVKRHDRLGRMADTLEYSS
ACEK_PARXL       VMLVFTLPSFPYVFKLIKDSFPPPKETTR----AQIKEKYQLVKRHDRLGRMADTLEYSS
ACEK_CUPNH       VMLVFTLPSYPYVFKVIKDFFPAPKETTR----ELVKSKYQLVKQHDRVGRMADTLEYSD
ACEK_CUPNJ       VMLVFTLPSYPYVFKVIKDFYPAPKETTR----ELIKSKYQLVKQHDRVGRMADTLEYSN
ACEK_CUPMC       VMLVFTLPSFPYVFKVIRDFFPAPKETTR----ELVKSKYQLVKQHDRVGRMADTLEYSD
ACEK_RALSO       VMLVFTLPSYPYVFKVIKDYFPPPKETTR----ELIKSKYQLVKQHDRVGRMADTLEYSD
ACEK_POLSJ       VMLVFDLPSFPYVFKVIKDYYPPQKDTSR----EQIKGKYLLVKQHDRVGRMADTQEYSE
ACEK_POLNA       VMLVFDLPSFPYVFKVIKDYYPPQKDTTR----EQIKGKYLLVKQHDRVGRMADTQEYSE
ACEK_RHOFT       VMLVFDLPSFPYVFKVIKDFYPPPKDTTR----EQIKAKYLLVKQHDRVGRMADTLEYSE
ACEK_ACIAC       VMLVFDLPSFPFVFKVIKDYYPPQKDTTR----EQIKGKYLLVKQHDRVGRMADTLEYSE
ACEK_ACISJ       VMLVFDLPSFPYVFKLIKDQFPAPKDTTR----EQVQGKYLLVKQHDRVGRMADTLEYSL
ACEK_METPP       VMLVFDLPSFPFVFKVIKDFYPPQKDTTR----ELIQSKYQLVKTHDRVGRMADSLEYSN
ACEK_AZOSB       VMLVFTLPSYPYVFKIIKDVFGSSKNMDR----ATVKRKYLMVKQVDRVGRMADTLEFSY
ACEK_AROAE       VMLVFTLPSYPYVFKIIKDVFGASKNMDR----ATVKRKYLMVKQVDRVGRLADTLEFSY
ACEK_DECAR       VMLVFTLPSYPYVFKLIKDVFGSSKEMDR----ATVKKKFMMVKQVDRVGRMADTLEFSN
ACEK_IDILO       VMTVFTLPSFPYVFKVIKDRLGGTKEFGR----QTVIDRYRMVKRHDRVGRMADTLEFVD
ACEK2_PSEHT      VMMVFTLPSFGYVFKVIKDKFGESKPFGR----DTVLKRYQLVKKHDRVGRMADTIEYSN
ACEK_COLP3       VMSVFTLPSYPYVFKIIKDKFSPSKNITK----KDVKGKYRLVKLHDRVGRMADTMEYSE
ACEK_ECOL6       VMLVFTLPGFDRVFKVIKDRFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_ECOL5       VMLVFTLPGFDRVFKVIKDRFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_ECOK1       VMLVFTLPGFDRVFKVIKDRFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_ECOUT       VMLVFTLPGFDRVFKVIKDRFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_ECOLI       VMLVFTLPGFDRVFKVIKDRFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_SHIBS       VMLVFTLPGFDRVFKVIKDKFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_ECO57       VMLVFTLPGFDRVFKVIKDKFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_SHIDS       VMLVFTLPGFDRVFKVIKDRFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_SALCH       VMLVFTLPGFDRVFKIIKDKFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_SALTY       VMLVFTLPGFDRVFKIIKDKFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_SALTI       VMLVFTLPGFDRVFKIIKDKFAPQKEMSA----AHVRACYQLVKEHDRVGRMADTQEFEN
ACEK_YERPE       VMLVFTLPSFDRVFKVIKDQFAPQKEVTQ----ARVLECYQLVKEHDRVGRMADTQEYEN
ACEK_YERPA       VMLVFTLPSFDRVFKVIKDQFAPQKEVTQ----ARVLECYQLVKEHDRVGRMADTQEYEN
ACEK_YERPN       VMLVFTLPSFDRVFKVIKDQFAPQKEVTQ----ARVLECYQLVKEHDRVGRMADTQEYEN
ACEK_YERPS       VMLVFTLPSFDRVFKVIKDQFAPQKEVTQ----ARVLECYQLVKEHDRVGRMADTQEYEN
ACEK_YERE8       VMLVFTLPSFDRVFKVIKDQFAPQKEVSQ----TRVLECYQLVKEHDRVGRMADTQEYEN
ACEK_PHOLL       VMLVFTSPSFDRVFKVIKDQFAPQKEVTQ----ERVQECYRLVKEHDRVGRMADTQEFEN
ACEK_PECAS       VMLVFTLPSFDRVFKVIKDRFAPQKEVSA----ERVMACYQLVKEHDRVGRMADTQEYEN
ACEK_PHOPR       VMSVFTLPSYDFVFKIIKDKFAPQKDISH----ATVKEKYKLVKEHDRVGRMADTQEYRH
ACEK_AERHH       VMSVFTLPSYDVVFKVIKDEFTPPKDVSH----EQVKAKYRLVKQHDRVGRMADTQEFTN
ACEK_PSEAE       VMSVFTLPGFNTVFKIIKDRFNPSKSVDH----ATVIQKYQLVKNHDRVGRLADTQQFAD
ACEK_PSEAB       VMSVFTLPGFNTVFKIIKDRFNPSKSVDH----ATVIQKYQLVKNHDRVGRLADTQQFAD
ACEK_PSEF5       VMSVFTLPGFNTVFKIIKDRFSPSKNVDR----ATVIEKYRLVKSVDRVGRMADTQEFAD
ACEK_PSEPF       VMSVFTLPGFNTVFKIIKDRFSPSKNVDR----ATVIEKYRLVKSVDRVGRMADTQEFAD
ACEK_PSEPK       VMSVFTLPGFNTVFKIIKDRFSPSKTVDR----ATVIDKYRLVKSVDRVGRMADTQEFAD
ACEK_PSEE4       VMSVFTLPGFNTVFKIIKDRFSPSKTVDR----ATVIEKYRLVKSVDRVGRMADTQEFAD
ACEK_PSEA6       VMAVFHLPSYGVVFKIIKDEFPESKKITR----QHVKDCYKLVKMTDRVGRMADTHEYVN
ACEK1_PSEHT      VMLVFTIAGSDHVYKVIKDKFSAPKTATK----AQVKEKYNFVKQADRVGRLVDTHEFRY
ACEK_RHOP2       VAIAFTMPSSAYVLKIIRDHPTDDYKFDYFDGLDAVLRKYNLVHEIDRAGSMLDNIIYSN
ACEK_RHOPS       VAIAFTMPCSAYVLKIIRDHPTDDYKFDYFDGLDAVLRKYNLVHEIDRAGSMLDNIIYSN
ACEK_RHOPA       VAIAFTMPSSAYVLKIIRDHPTDDYKFDYFDGLDEVLRKYNLVHEIDRAGSMLDNIIYSN
                 *  .*  .    : *:*:*                :   :  *   ** * : *   :  

ACEK_XANAC       LRFPKARFSPALLQELQTSCAMSLSED------GDDVLIALCYVQRRLRPLNLYLREQL-
ACEK_XANC5       LRFPKARFSPALLQELQTSCAMSLSED------GDDVLIALCYVQRRLRPLNLYLREQL-
ACEK_XANCP       LRFPKARFSPALLQDLQSSCAMSLSED------GDDVLIALCYVQRRLRPLNLYLREQL-
ACEK_XANC8       LRFPKARFSPALLQDLQSSCAMSLSED------GDDVLIALCYVQRRLRPLNLYLREQL-
ACEK_ANADE       LAFPAARFSPALLEELRTECGDGVRVA------GGEVAIRHLYAERRVTPLNLFVREAD-
ACEK_BORBR       VALPRSRFAPRLLEELRRLVPSLIEEN------GDTVVIRHVYIERRMMPLNLYLRHA--
ACEK_BORPA       VALPRSRFAPRLLEELRRLVPSLIEEN------GDTVVIRHVYIERRMMPLNLYLRHA--
ACEK_BURCA       VALPLARLDHALVRELEKEVPSLLEYE------DDKLVIKHLYIERRMTPLNLYLQNG--
ACEK_BURCH       VALPLARLDHALVRELEKEVPSLLEYE------DDKLVIKHLYIERRMTPLNLYLQNG--
ACEK_BURL3       VALPIARLDHALVRELEKEVPSLLEYE------DGNLVIEHLYIERRMTPLNLYLQNG--
ACEK_BURCM       VALPISRLDHALVRELEKEVPSLLEYE------DGNLVIKHLYIERRMIPLNLYLQNG--
ACEK_BURMA       VALPLARLDDALVRELEKEVPSLIEYE------GENLVIKHLYIERRMVPLNLYLQNG--
ACEK_BURPS       VALPLARLDDALVRELEKEVPSLIEYE------GENLVIKHLYIERRMVPLNLYLQNG--
ACEK_BURP1       VALPLARLDDALVRELEKEVPSLIEYE------GENLVIKHLYIERRMVPLNLYLQNG--
ACEK_BURTA       VALPLARLDDALVRELEKEVPSLIEYE------GDSLVIKHLYIERRMVPLNLYLQNG--
ACEK_PARXL       VALPVSRLDEALVRELEKEVPSLIEYD------GDSLVIRHMYIERRMVPLNLFLQNG--
ACEK_CUPNH       VAFPLSRFDEALVREFEQHAPSMIEYQR-GKDGGEEIVVRHVYIERRMTPLNIYLTEG--
ACEK_CUPNJ       VAFPLSRFDEDLVRELEHHAPSMIEYQR-GKDGGEEIVVRHVYIERRMTPLNIWLQEG--
ACEK_CUPMC       VAFPLSRFDDALVRELEQHAPSMIEYQR-SKQGEDEIVVRHVYIERRMTPLNIWLQEG--
ACEK_RALSO       VAFPLSRFDDALIKELEKHAPSMVEYQR-GADGSDEIVIRHVYIERRMTPLNIWLHEG--
ACEK_POLSJ       VAFPRARFDDELIAEIEKFAPSQLEISDRDRDGNTEVIIKHVYIERRMIPLNIYLQEAFD
ACEK_POLNA       VAFPRERFSDELIAEIEKFAPSQLEISDRDGDGQMEVIIKHVYIERRMIPLNIYLQEAFD
ACEK_RHOFT       VGFPRARFDDELIAELEKFAPSQLEISDRDGDGRIEVIIKHVYIERRMIPLNIYLQEAFD
ACEK_ACIAC       VAFPRERFEDDLIAEIEKFAPSQLEISDRDGDGNVEVILKHVYIERRMIPLNIYLQEAFD
ACEK_ACISJ       VAFPRERFSDELIEEIRRHAPSQIEISDRDGDGRQEVIIAHLYIERRMIPLNIHLQECFD
ACEK_METPP       VAFPRQRFEPELIEEIRHFCPSLLEE---EGDS---LVLKHLYIERRMIPLNIYLQEA--
ACEK_AZOSB       AALPLSRFHPELLEELRTLAPSAFEID------GDALVLKHFYIERRMTPLNIHLEKASD
ACEK_AROAE       AALPLSRFHPELLDELRALAPSSFEIE------GDSVIIKHLYIERRMTPLNIYLEHADD
ACEK_DECAR       VMFPLKRFNDEVLAELQQLAPSCFEVD------GDQLIIKHLYIERRMEPLNIHLDRMER
ACEK_IDILO       VALPLKRISADLLDEFKQTIANSISIEGD------TLVIHQLFVERRMTPLNLYLEYAND
ACEK2_PSEHT      VVFPLARFDSNLLQQLHQTIGSSMVIEGD------WLIIKHLYIERRMTPLNLFLENADD
ACEK_COLP3       VAFPKSRFNDELLAELQKVAPSIIRYEGEGE--EALIIIEHLYIERRMVPLNLYLMDALK
ACEK_ECOL6       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_ECOL5       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_ECOK1       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_ECOUT       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_ECOLI       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_SHIBS       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_ECO57       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_SHIDS       FVLEKRHISPALMELLLQEAAEKITDL------GEQIVIRHLYIERRMVPLNIWLEQVE-
ACEK_SALCH       FVLDKRQIDPALMALLRQEAPEKITDL------GEHIVIRHLYIERRMVPLNIWLEQVE-
ACEK_SALTY       FVLDKRQIDPALMALLRQEAPEKITDL------GEHIVIRHLYIERRMVPLNIWLEQVE-
ACEK_SALTI       FVLDKRQIDPALMALLRQEAPEKITDL------GEHIVIRHLYIERRMVPLNIWLEQVE-
ACEK_YERPE       FVIDKHRISPELLAELQHEVPEKLEDL------GDKIVIKHLYMERRMTPLNLYMEQAD-
ACEK_YERPA       FVIDKHRISPELLAELQHEVPEKLEDL------GDKIVIKHLYMERRMTPLNLYMEQAD-
ACEK_YERPN       FVIDKHRISPELLAELQHEVPEKLEDL------GDKIVIKHLYMERRMTPLNLYMEQAD-
ACEK_YERPS       FVIDKHRISPELLAELQHEVPEKLEDL------GDKIVIKHLYMERRMTPLNLYMEQAD-
ACEK_YERE8       FVIDKHRISAELLTELQREVPEKLEDL------GDQIIIKHLYMERRMTPLNLYIEQAN-
ACEK_PHOLL       FVIDKARISPELMEELQKEVPEKLEDL------GDKILIKHLYMERRMTPLNIYMEQVE-
ACEK_PECAS       FVIDKHRISPELLDELWREVPEKLEDL------GDQLVIRHLYMERRMTPLNLYLEQAN-
ACEK_PHOPR       FTFERHRFSDELLAELLAVAPSIIKVT------SDQIIISHLYMERRMIPFNIYVEQAN-
ACEK_AERHH       FEFPLDRISPELLAELKTVAPSALTLT------DDKLVIKHLYTERKMIPLNLYLDKAD-
ACEK_PSEAE       FRFPVSKFEPECLAELLEVAPSTVVME------GDVVLIRHCWTERRMTPLNIYLENAS-
ACEK_PSEAB       FRFPVSKFEPECLAELLEVAPSTVVME------GDVVLIRHCWTERRMTPLNIYLENAS-
ACEK_PSEF5       FRFPLSKFDPACLEELLEVAPSTVAVE------GQTVLIRHCWTERRMTPLNLYLEHAN-
ACEK_PSEPF       FRFPLSKFEPACLAELLEVAPSTVSLE------GETVLIRHCWTERRMTPLNLYLDNAN-
ACEK_PSEPK       FRFPRSKFEPDCLAELLEVAPSTVALE------GDTVLIRHCWTERRMTPLNLYLEQAT-
ACEK_PSEE4       FRFPQGKFDPECLAELLEVAPSTVSLE------GDTVLIRHCWTERRMTPLNLYLEHAS-
ACEK_PSEA6       FRLPRHRVEQALVDELLDCCASSIELT------DEEVIIKHLYIERKMTPLNIFLEQQP-
ACEK1_PSEHT      LAFDLSRFSEQLLQQMKEHIGSSLIIS------GKALILKHVYVERKMTPLNLYINDCD-
ACEK_RHOP2       VKLERTMFAPDLLDELLESGIDTVTLE------RGALVFRHLIVQIKLTPLPLYLTTAS-
ACEK_RHOPS       VKLARTMFAPDLLDELLEAGIGTVTLE------RDALVFRHLIVQIKLTPLPLYLTTAA-
ACEK_RHOPA       VKLDRAMFAPELLDELLEAGIGTVTLD------RGALVFRHLIVQIKLTPLPLYLANAS-
                   :    .    :  :       .            : .     : :: *: : :     

ACEK_XANAC       ----------------PEAAHAAALDYGQAIKDMARNNIFPGDMLLKNFGITRHQRAVFY
ACEK_XANC5       ----------------PEAAHAAALDYGQAIKDMARNNIFPGDMLLKNFGITRHQRAVFY
ACEK_XANCP       ----------------PAAAHAAALDYGQAIKDMARNNIFPGDMLLKNFGITRHQRAVFY
ACEK_XANC8       ----------------PAAAHAAALDYGQAIKDMARNNIFPGDMLLKNFGITRHQRAVFY
ACEK_ANADE       ----------------EWTARQAVLDFGCALRDLAATDTFPGDLLLKNFGVTRHGRVIFY
ACEK_BORBR       ---------------SDPLLEVAVREYGDAIRQLATANIFPGDMLYKNFGVTRLGRVVFY
ACEK_BORPA       ---------------SDPLLEVAVREYGDAIRQLATANIFPGDMLYKNFGVTRLGRVVFY
ACEK_BURCA       ---------------SDADVEHGVKEYGNAVKELMKANIFPGDMLYKNFGVTRHGRVVFY
ACEK_BURCH       ---------------SDADVEHGVKEYGNAVKELMKANIFPGDMLYKNFGVTRHGRVVFY
ACEK_BURL3       ---------------SDSDVEHGVKEYGNAVKELMKANIFPGDMLYKNFGVTRHGRVVFY
ACEK_BURCM       ---------------TDAEIEHGVKEYGNAVKELMKANIFPGDMLYKNFGVTRHGRVVFY
ACEK_BURMA       ---------------SDAEIEHGVREYGNAVKELMQANIFPGDMLYKNFGVTRHGRVVFY
ACEK_BURPS       ---------------SDAEIEHGVREYGNAVKELMQANIFPGDMLYKNFGVTRHGRVVFY
ACEK_BURP1       ---------------SDAEIEHGVREYGNAVKELMQANIFPGDMLYKNFGVTRHGRVVFY
ACEK_BURTA       ---------------SDAEIEHGVREYGNAVKELIQANIFPGDMLYKNFGVTRHGRVVFY
ACEK_PARXL       ---------------NDEDIEHGIKEYGNAIKELMQANIFPGDMLYKNFGVTRHGRVVFY
ACEK_CUPNH       ---------------TDEQVEHGVIEYGNAVKELIAANIFPGDMLYKNFGVTRHGRVVFY
ACEK_CUPNJ       ---------------TDEQLEHGIIEYGNAIKELIAANIFPGDMLYKNFGVTRHGRVVFY
ACEK_CUPMC       ---------------TDEQVDHGILEYGNAVKELIAANIFPGDMLYKNFGVTRHGRVVFY
ACEK_RALSO       ---------------TDAQVEHGIIEYGNAIKELIAANIFPGDMLYKNFGVTRHGRVVFY
ACEK_POLSJ       AGVGEPA--------AKNQIERAVVEYGNAIKDLVAANIFPGDMLWKNFGITRHGKVVFY
ACEK_POLNA       FGVAEPA--------ARDQIERAVVEYGNAIKDMVAANIFPGDMLWKNFGITRHGKVVFY
ACEK_RHOFT       AGGANPDDTSPAALRAREQIERGVIEYGNALKDLVAANIFPGDMLWKNFGITRHGKVVFY
ACEK_ACIAC       AGPHDAR--------ARQQMERSVVEYGNAIKDLVAANIFPGDMLWKNFGVTRNGKVVFY
ACEK_ACISJ       TGLDKPE--------ARSALEHAVTEYGNAIKDMVAANIFPGDMLWKNFGITRNGKVVFY
ACEK_METPP       ---------------TPEQMKHAVIEYGNAIKDLVAANIFPGDMLWKNFGVTRHGKVVFY
ACEK_AZOSB       -----------------GEVEAAVHEYGNAIRELAIANIFPGDMLWKNFGVTRYGRVVFY
ACEK_AROAE       -----------------DQVEYAVREYGNAIRELATANIFPGDMLWKNFGVTRYGRVVFY
ACEK_DECAR       AN-------------NVERLEHVIREYGSAIREMAQANIFPGDMLWKNFGVTRFGRVVFY
ACEK_IDILO       EE-------------VDAAMDD----YGRALKEMMAANIFPGDMLLKNFGVTRHKRVVFY
ACEK2_PSEHT      AS-------------AADAIEE----YGQALKEMIAVNIFPGDMLLKNFGVSKHKRIIFY
ACEK_COLP3       NK-------------AQQKIDDALFGYGQAIKQLISADIFPGDMLLKNFGVTRHGRVIFY
ACEK_ECOL6       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_ECOL5       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_ECOK1       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_ECOUT       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_ECOLI       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_SHIBS       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_ECO57       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_SHIDS       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_SALCH       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_SALTY       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_SALTI       ----------------GQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_YERPE       ----------------DQQLKDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_YERPA       ----------------DQQLKDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_YERPN       ----------------DQQLKDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_YERPS       ----------------DQQLKDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_YERE8       ----------------DQQLKDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_PHOLL       ----------------ERKLKDVIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_PECAS       ----------------AQQLHDVIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_PHOPR       ----------------DDDLRDAVDEYGKAIKQLAAANIFPGDMLFKNFGVTRHKRVVFY
ACEK_AERHH       ----------------EQQTRLALEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFY
ACEK_PSEAE       ----------------EAQTREALNDYGLAIKQLAAANIFPGDMLLKNFGVTRHGRVVFY
ACEK_PSEAB       ----------------EAQTREALNDYGLAIKQLAAANIFPGDMLLKNFGVTRHGRVVFY
ACEK_PSEF5       ----------------EAQVREALEDYGLAIKQLAAANIFPGDMLLKNFGVTRHGRVVFY
ACEK_PSEPF       ----------------EAQVREALEDYGLAIKQLAAANIFPGDMLLKNFGVTRHGRVVFY
ACEK_PSEPK       ----------------EGQVLEALEDYGLAIKQLAAANIFPGDMLLKNFGVTRHGRVVFY
ACEK_PSEE4       ----------------EGQVLEALEDYGLAIKQLAAANIFPGDMLLKNFGVTRHGRVVFY
ACEK_PSEA6       ---------------DPALITSALNDLGLCIKQIAAAHIFAGDMLHKNFGITRGGRVIFY
ACEK1_PSEHT      ----------------SKALAQVMLDYGRAIKDLAGANIFPGDMLMKNFGVTRWGRVVFY
ACEK_RHOP2       ----------------AADARAAVINLGDCIKNNAAADIFNKDLDGRNYGVSRIRKVYLF
ACEK_RHOPS       ----------------AADARAAVINLGDCIKNNAAADIFNKDLDGRNYGVSRIRKVYLF
ACEK_RHOPA       ----------------AAESRAAVINLGDCIKNNAAADIFNKDLDGRNYGVSRIRKVYLF
                                            * .:::    . *  *:  :*:*:::  :  ::

ACEK_XANAC       DYDELCLITECNFRDWPTPATYEEQM-----------AAEPWFHVGPRDVFPERFALFMG
ACEK_XANC5       DYDELCLITECNFRDWPVPTTYEEQM-----------AAEPWFHVGPRDVFPERFALFMG
ACEK_XANCP       DYDELCLITECTFRDWPTPTSYEEQM-----------AAEPWFHVGPRDVFPERFALFMG
ACEK_XANC8       DYDELCLITECTFRDWPTPTSYEEQM-----------AAEPWFHVGPRDVFPERFALFMG
ACEK_ANADE       DYDELTRVTDCNFRDLPGAGPGDGDDGWGGGPDAGYDGGDPPFYVGPADVFPEELLPFLG
ACEK_BORBR       DYDEIQRMTEMNFRAIPPAPNEEAEL-----------SSEPWYAVGPNDVFPEEFGRFLL
ACEK_BORPA       DYDEIQRMTEMNFRAIPPAPNEEAEL-----------SSEPWYAVGPNDVFPEEFGRFLL
ACEK_BURCA       DYDEIEYLTDCNVRRVPPPRNEEDEL-----------SGEPWYTVGPHDIFPETYGPFLL
ACEK_BURCH       DYDEIEYLTDCNVRRVPPPRNEEDEL-----------SGEPWYTVGPHDIFPETYGPFLL
ACEK_BURL3       DYDEIEYLTDCNVRRVPPPRNEEDEL-----------SGEPWYTVGPHDIFPETYGPFLL
ACEK_BURCM       DYDEIEYLTDCNVRRVPPPRNEEDEL-----------SGEPWYTVGPHDIFPETYGPFLL
ACEK_BURMA       DYDEIEYLTDCNVRRVPPPRNDEDEM-----------SGEPWYTVGPHDIFPETYAPFLL
ACEK_BURPS       DYDEIEYLTDCNVRRVPPPRNDEDEM-----------SGEPWYTVGPHDIFPETYAPFLL
ACEK_BURP1       DYDEIEYLTDCNVRRVPPPRNDEDEM-----------SGEPWYTVGPHDIFPETYAPFLL
ACEK_BURTA       DYDEIEYLTDCNVRRVPPPRNDEDEM-----------SGEPWYTVGPHDIFPETYAPFLL
ACEK_PARXL       DYDEIEYLTDCNVRAVPAPRNEEDEM-----------SGEPWYSVGPHDIFPETYGTFLL
ACEK_CUPNH       DYDEIEYLTDCNIRDVPQPRNEEEEM-----------SGEVWYTVRPHDIFPETFRTFLL
ACEK_CUPNJ       DYDEIEYFTDCNVRRVPQPRNEEEEM-----------SGDIWYTVRPHDIFPETFRTFLL
ACEK_CUPMC       DYDEIEYLTDCNVRRVPAPRNEEEEM-----------SGEVWYTVRPHDIFPETYGTFLL
ACEK_RALSO       DYDEIEYLTDCNVRDVPQPRNEEEEM-----------SGEVWYSVGPHDIFPQTYGTFLL
ACEK_POLSJ       DYDEIEYITDCKFRRVPAPRNDEEEM-----------SGEVWYSVGPKDVFPETFAPFLL
ACEK_POLNA       DYDEIEYITDCKFRKVPTPRNEEDEM-----------SGEVWYSVGPKDVFPETFGPFLL
ACEK_RHOFT       DYDEIEYITDCNFRKVPQARNEEDEM-----------SGEVWYRVGPKDVFPETFAPFLL
ACEK_ACIAC       DYDEIEYLTDCHFRRVPAPRNEEDEL-----------SGEVWWAVGPRDVFPETFGPFLL
ACEK_ACISJ       DYDEIEYLTDCNFRRVPPPRCEEDEV-----------SGEVWWPVGPHDVFPETFGPFLL
ACEK_METPP       DYDEIEYLTDCNFRKVPEPRTEEEEM-----------SGDIWYSVGPKDVFPETFGPFLL
ACEK_AZOSB       DYDEIEYMTSMNFRRIPPAPHEDMEL-----------SGEPWYSAGPMDVFPEEFATFLL
ACEK_AROAE       DYDEIEFMTAMNFRRIPPAPYPEMEM-----------AAEPWYSAGPMDVFPEEFATFLL
ACEK_DECAR       DYDEIEYMTDIKFRQIPPAPDFETEM-----------SGEVWYAVSRNDVFPEEFATFLL
ACEK_IDILO       DYDEVRYLTDMSFRRLPE--------------------NDWEVSYAPDDVFPQQLAQFAV
ACEK2_PSEHT      DYDEVQYLTDMNFRALPKAKTYDDYL-----------MDEQSYSVAPQDVFPEQLCTFVM
ACEK_COLP3       DYDEIAYMNEINFRVKPKAVTEEQLY-----------AAEPWYSVMPGDMFPEELATFAL
ACEK_ECOL6       DYDEICYMTEVNFRDIPLPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_ECOL5       DYDEICYMTEVNFRDIPLPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_ECOK1       DYDEICYMTEVNFRDIPLPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_ECOUT       DYDEICYMTEVNFRDIPLPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_ECOLI       DYDEICYMTEVNFRDIPPPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_SHIBS       DYDEICYMTEVNFRDIPPPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_ECO57       DYDEICYMTEVNFRDIPPPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_SHIDS       DYDEICYMTEVNFRDIPPPRYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_SALCH       DYDEICYMTEVNFRDIPPARYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_SALTY       DYDEICYMTEVNFRDIPPARYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_SALTI       DYDEICYMTEVNFRDIPPARYPEDEL-----------ASEPWYSVSPGDVFPEEFRHWLC
ACEK_YERPE       DYDEICYMTEVNFRDIPPPRYPEDEM-----------ASEPWYSVSPNDVFPEEFRHFLC
ACEK_YERPA       DYDEICYMTEVNFRDIPPPRYPEDEM-----------ASEPWYSVSPNDVFPEEFRHFLC
ACEK_YERPN       DYDEICYMTEVNFRDIPPPRYPEDEM-----------ASEPWYSVSPNDVFPEEFRHFLC
ACEK_YERPS       DYDEICYMTEVNFRDIPPPRYPEDEM-----------ASEPWYSVSPNDVFPEEFRHFLC
ACEK_YERE8       DYDEICYMTEVNFRDIPPPRYPEDEM-----------ASEPWYSVSPNDVFPEEFRHFLC
ACEK_PHOLL       DYDEICYMTEVNFRDIPPPRYPEDEL-----------AGEPWYSVAPNDVFPEEFRHFLC
ACEK_PECAS       DYDEICYMTEVNFRKIPPPRYLEDEL-----------AAEPWYSVAPNDVFPEEFPHFLC
ACEK_PHOPR       DYDEISYMTEMNFRKIPEPRTPEDEM-----------SAEPWYSVGIYDVFPEEFRTFLL
ACEK_AERHH       DYDEICYMTECNFRQIPPPRYPEDEW-----------SAEPWYSVAPNDIFPEEFATFLL
ACEK_PSEAE       DYDEICYLTEVNFRYIPEPRFPEDEM-----------SSEPWYSVGPNDVFPEEFPRFLF
ACEK_PSEAB       DYDEICYLTEVNFRYIPEPRFPEDEM-----------SSEPWYSVGPNDVFPEEFPRFLF
ACEK_PSEF5       DYDEICFLTEANFRHIPAPRTPEDEM-----------ASEPWYSIGPHDVFPEEFPPFLF
ACEK_PSEPF       DYDEICFLTEANFRHIPAPRTPEDEM-----------ASEPWYSIGPLDVFPEEFPPFLF
ACEK_PSEPK       DYDEISFLTEVNFRHIPPPRYPEDEM-----------SGEPWYSIGPHDVFPEEFPPFLF
ACEK_PSEE4       DYDEISFLTEVNFRHIPPPRYPEDEM-----------SGEPWYSIGPHDVFPEEFPPFLF
ACEK_PSEA6       DYDEICYLTEREFRTLPKS----DDP-----------YAIDTLSVGPTDVFPEQFEHFIV
ACEK1_PSEHT      DYDEICPLTDCNFREVPQTQNALEEL-----------SSDSYFDIEPNDIFPSQFKVFFS
ACEK_RHOP2       DYDAVEPLTDVRVRGDDAPPGPEFEDG---------------VVFRP----ADMLGGLRI
ACEK_RHOPS       DYDAVEQLTEVKVRSTPPMPRAEDEDG---------------VVFRP----AQMLEGLRI
ACEK_RHOPA       DYDAVEPLTSVTVSRDGAAPG-EFDNG---------------MVFRP----QEMLEGLRI
                 *** :  ..   .                                       .       

ACEK_XANAC       LPSSQLEAVKHQHPELFDPRWWRDLQSRLRDDDYPDTPPYAESRRLA-------------
ACEK_XANC5       LPASQLEAVKHQHPELFDPRWWRDLQSRLREDDYPDTPPYAESRRLA-------------
ACEK_XANCP       LPSSQLEAVKHMHPELFDPQWWRDLQARLREDDYPDTPPYADAQKLA-------------
ACEK_XANC8       LPSSQLEAVKHMHPELFDPQWWRDLQARLREDDYPDTPPYADAQKLA-------------
ACEK_ANADE       LTGRLREVFLRAHGELLTGRWWRDIQARLRAGEIVDIFPYREEQRLRHAHP---------
ACEK_BORBR       GDPRVRQAFLRHHADLLAPQWWQACRARVAQGRIEEFFPYDTDRRLHPQAAPPPRTAA--
ACEK_BORPA       GDPRVRQAFLRHHADLLAPQWWQACRARVAQGRIEEFFPYDTDRRLHPQAAPPPRAAA--
ACEK_BURCA       GDPRVRSVFMKHHADFFDPALWQASKDKLMQGELPDFYPYDATLRFSVRYPARFGATGEN
ACEK_BURCH       GDPRVRSVFMKHHADFFDPALWQASKDKLMQGELPDFYPYDATLRFSVRYPARFGATGEN
ACEK_BURL3       GDPRVRDVFMKHHADFFDPALWQASKDKLIQGELPDFYPYDTALRFCTRYPARFGATDQN
ACEK_BURCM       GDPRVRAVFMKHHADFFEASLWQASKDKLLQGELPDFFPYDVSLRFSVRYPDRFDATPDA
ACEK_BURMA       GDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYEPALRFCIRYPERFAPGDAA
ACEK_BURPS       GDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYEPALRFCIRYPERFAPGDAA
ACEK_BURP1       GDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYEPALRFCIRYPERFAPGDAA
ACEK_BURTA       GDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYEPALRFCLRYPERFAPGDAA
ACEK_PARXL       GDPRVRRSFMQHHADFFDPALWQRHKDHLLKGELADFFPYDGSVRFCMRYPERFADAAGA
ACEK_CUPNH       GDTRVRAAFLRHHADFFDPAMWQSHKDRLLAGHVHDFFAYHSSERFIHRYSEAGSAQGTA
ACEK_CUPNJ       GNPRVREAFLRHHEDLFDPAMWQSHKDRLLAGHVHDFFAYPISERFINRYGTAAHGTPVA
ACEK_CUPMC       GDPRVRAAFMRHHPDFFDAAMWQHHKDRLLAGHVHDFFAYHSQERFIHRYGSGATGPATE
ACEK_RALSO       GDPRVREAFLRHHADFFDPAMWQAHKARLLSGQTHDFYAYDASERFVNRYGDSAPGNAAT
ACEK_POLSJ       GNDAVREVFMKHHGDLLDAEFWQSHQARIQAGHVHDVFPYEREKRFTRRHSPGRNDHELL
ACEK_POLNA       GNDAVREVFMKHHADLLDAAFWQRHQARIQAGHVYDVFPYDQQKRFAVMHGPARAG----
ACEK_RHOFT       GNPFVREVFMKHHAELLDAAFWQSHKERIQAGHVYDVFPYDQGKRFHPEISDAQVPSSI-
ACEK_ACIAC       GNDAVREVFMRHHADLLDPVFWQSHKERIQAGHMYDVFPYDPERRFGAGTGSPA------
ACEK_ACISJ       GNDSVREAFMRHHADLLDVEFWQSHKERIQAGHLYDVFPYDSARRFRCASPSSFQTQGDS
ACEK_METPP       GNPTVREVFMQHHAELLDPAFWQGRKDRIAGGYVHDVFPYDPHKRFRRPLGLGFGSLDAE
ACEK_AZOSB       GSPRVRKAFMKYHRDLLEPAFWQAAQQGVRDGHVEDFFPYPAELRFSVMFPATPVAAQD-
ACEK_AROAE       GAPRVRKAFLKHHRDLLDAKFWQDVQASIRKGYLEDFFPYPTELRFCNMWSNERGRAHQA
ACEK_DECAR       TSPQVRKIFIKYHKDLLSPRFWLEAQEKIRSGYVEDFFPYPQELRFINRQTDLTEEQ---
ACEK_IDILO       PQAKYRNKLLKRHPELIDSAYWCRVQKNIRKGELTDVFPYDADLRFTRRF----------
ACEK2_PSEHT      PNPIYKQFLMSTHPELIDVNFWKQAQQNIKNGQVSHIYPYPTAQRFIHHW----------
ACEK_COLP3       ANPSYLKAFKIHHEDLLTAAYWQQCQQDVANGIYKDVFPYPDKYRFCNLSFGSIKR----
ACEK_ECOL6       ADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVRFV---------
ACEK_ECOL5       ADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVRFV---------
ACEK_ECOK1       ADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVRFV---------
ACEK_ECOUT       ADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVRFV---------
ACEK_ECOLI       ADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVRYGEMLF-----
ACEK_SHIBS       ADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVRYGEMLF-----
ACEK_ECO57       ADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVRYGEMLF-----
ACEK_SHIDS       ADPRIGPLFEEMHADLFRTDYWRALQNRIREGHVEDVYAYRRRQRFSVLYGEMLF-----
ACEK_SALCH       ADPRIGPLFEEMHADLFRADYWRALQTRIKEGHVEDVYAYRRRQRFSVRYGAISSTANSS
ACEK_SALTY       ADPRIGPLFEEMHADLFRADYWRALQTRIKEGHVEDVYAYRRRQRFSVRYGAISSTANSS
ACEK_SALTI       ADPRIGPLFEEMHADLFRADYWRALQTRIKEGHVEDVYAYRRRQRFSVRYETDRRPDKAF
ACEK_YERPE       SDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN--------
ACEK_YERPA       SDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN--------
ACEK_YERPN       SDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN--------
ACEK_YERPS       SDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN--------
ACEK_YERE8       TDLKVRHFFEEMHSDLFHASYWRGLQQRIKDGHVEDVFAYRRKQRFSQRVIS--------
ACEK_PHOLL       TDSRIRRYFEEMHSDLFKADYWRALQERIRSGHVEDVFAYRRKQRFSQRTEIETYSIAKV
ACEK_PECAS       SDRHIRTLFEEMHGDLFCADYWRALQQRIREGHIEDVYAYRRRKRFSQRAEPLYITTEND
ACEK_PHOPR       INPKVKALFNELHSDLFEAKYWQSLQQNITHGQYEDVYPYRGVHRLRKT-----------
ACEK_AERHH       QKPQVRDIMMQLHKELFDANYWKMLQSNIKEGVFEDVYPYRRKKRFKFQRGG--------
ACEK_PSEAE       VDLNQRRLFAKLHGNLYDAKYWQGLQEQIREGKVIDVFPYRRQETPEQLLG---------
ACEK_PSEAB       VDLNQRRLFAKLHGNLYDAKYWQGLQEQIREGKVIDVFPYRRQETPEQLLG---------
ACEK_PSEF5       ADAGQRKLFDQLHGELYNADYWKGLQEAIRAGKVIDVFPYRRQGLEDE------------
ACEK_PSEPF       ADAAQRKLFDQLHGELYNADYWKGLQEAIRAGKVIDVFPYRRKGLDNE------------
ACEK_PSEPK       ADMGQRRLFSRLHGELYDADYWKGLQAAIREGKVIDVFPYRRKAR---------------
ACEK_PSEE4       ADIGQRRLFSRLHGELYDADYWKGLQEAIRAGKVIDVFPYRRKSR---------------
ACEK_PSEA6       GKKHLKQELKALHGEIMTAEYWQHMQAQSLKGDVPDFIPYNQAKRFVN------------
ACEK1_PSEHT      ANELAFNAFNSHHSDLFNAQFWQTCQQQVQQGYLPDVYPYKQSWRFK-------------
ACEK_RHOP2       DDPALRRAFRDAHPELMQPEYWQGMQRALRAGKVPRVMNYPAARRLRR------------
ACEK_RHOPS       DDPGLRRAFRDAHPELMQPDYWEGMQHALRAGKVPKVMNYPTSRRLRR------------
ACEK_RHOPA       DDPGLRRAFRDAHPELMQADYWEGMQQALRDGKVPKVMNYPASRRLRR------------
                         .   * ::     *   :     .       *                    

ACEK_XANAC       ------------------
ACEK_XANC5       ------------------
ACEK_XANCP       ------------------
ACEK_XANC8       ------------------
ACEK_ANADE       ------------------
ACEK_BORBR       ------------------
ACEK_BORPA       ------------------
ACEK_BURCA       -------DGAGDAQRAA-
ACEK_BURCH       -------DGAGDAQRAA-
ACEK_BURL3       -------DGAGDAQRAA-
ACEK_BURCM       GD----GDSAGNAQRAA-
ACEK_BURMA       D---------GGKLAAA-
ACEK_BURPS       D---------GGKLAAA-
ACEK_BURP1       D---------GGKLAAA-
ACEK_BURTA       E---------DGKRAAA-
ACEK_PARXL       ASNEQDAPDAGRSVRAA-
ACEK_CUPNH       AVP-----DPGPARRVA-
ACEK_CUPNJ       SF----------ARRVA-
ACEK_CUPMC       EP-----------RRAA-
ACEK_RALSO       PL-----------RRAAA
ACEK_POLSJ       THLPPEPMLTGLSGMTP-
ACEK_POLNA       ------------------
ACEK_RHOFT       ------------------
ACEK_ACIAC       ------------------
ACEK_ACISJ       T-----------------
ACEK_METPP       AVSLHPASATTQLGHNPI
ACEK_AZOSB       ------------------
ACEK_AROAE       A-----------------
ACEK_DECAR       ------------------
ACEK_IDILO       ------------------
ACEK2_PSEHT      ------------------
ACEK_COLP3       ------------------
ACEK_ECOL6       ------------------
ACEK_ECOL5       ------------------
ACEK_ECOK1       ------------------
ACEK_ECOUT       ------------------
ACEK_ECOLI       ------------------
ACEK_SHIBS       ------------------
ACEK_ECO57       ------------------
ACEK_SHIDS       ------------------
ACEK_SALCH       ------------------
ACEK_SALTY       ------------------
ACEK_SALTI       APPSGNVRRA--------
ACEK_YERPE       ------------------
ACEK_YERPA       ------------------
ACEK_YERPN       ------------------
ACEK_YERPS       ------------------
ACEK_YERE8       ------------------
ACEK_PHOLL       SA----------------
ACEK_PECAS       SGLCRYPA----------
ACEK_PHOPR       ------------------
ACEK_AERHH       ------------------
ACEK_PSEAE       ------------------
ACEK_PSEAB       ------------------
ACEK_PSEF5       ------------------
ACEK_PSEPF       ------------------
ACEK_PSEPK       ------------------
ACEK_PSEE4       ------------------
ACEK_PSEA6       ------------------
ACEK1_PSEHT      ------------------
ACEK_RHOP2       ------------------
ACEK_RHOPS       ------------------
ACEK_RHOPA       ------------------