CLUSTAL format seed alignment for MF_00785

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CFBA_METAC      ------MTEKLGILAIGHGSKLPYNKEVVSQIADYIAQKHSDVVVRAGFMENSEPTLEEA
CFBA_METBF      ------MTEKLGILAIGHGSKLPYNKEVVTQIADYIARKHSDVVVRAGFMENSEPTLGEA
CFBA_METMA      ------MTEKLGILAIGHGSKLPYNKEVVTQIANYIAQKHSDVVVRAGFMENSEPTLEEA
CFBA_METTH      MDSNSNQKPKIGVLLVGHGSRLPYGEEVINGIAD-IYRQEADHPVAVGFMNMSRPSIPEA
CFBA_METJA      ---------MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQA
CFBA_METMP      ---------MEALVLVGHGSRLPHSKNVVMEVAEKIKARNIYDIVEVGMMEFNEPTIPQT
CFBA_METKA      ---------MVAVVLVGHGSRLPYSRQVVEKIAEYVEEMGDFETVEVGFMELCEPTVQEA
CBIX_SULSO      ---------MLGVLLVLHGSKIPEWKDVGIKYAEYLSKY--FSLVEFGFLEFNKPTLSEA
CBIX_SULTO      ---------MYGVLLVLHGSKIKEWQDVAIQYANLLRKY--FDLVEYGFIEFNQPSITEA
CBIX_ARCFU      --------MRRGLVIVGHGSQLNHYREVMELHRKRIEESGAFDEVKIAFAARKRRPMPD-
                           .:: : ***::   .::     . :        *  .:    . .: : 

CFBA_METAC      IAGFAGTGVTKIAAVPVFLASGVHITKDIPGILSLDEK----------GCGILNIDGK--
CFBA_METBF      IEGFSGTGVTKIAAVPVFLASGVHITKDIPRILSLDEN----------GCGTLEIDGK--
CFBA_METMA      IEGFSGTGVTKISAVPVFLASGVHITKDIPEILSLDKE----------GCGILEIDGK--
CFBA_METTH      INELAAMGVEKIIVTPVFLAHGVHTKHDIPHILGLDNG----------AEGHHHHEHEHE
CFBA_METJA      VKKAIEQGAKRIIVVPVFLAHGIHTTRDIPRLLGLIEDNHEH-HHEHSHHHHHHHHHEHE
CFBA_METMP      IKKVIDAGAKKVIVTPVFLAPGNHTERDIPKILGIYEGDDEGGHHHHHDHEHHHHHHDTT
CFBA_METKA      VKKAAESGVDKIVVVPVFLAHGVHTKRDIPKMLGLEPEWDDD---EDDHDHHHHHHRDYT
CBIX_SULSO      LSNLLAKGADKIVVVPLLFATGTHFRRDIPRLLGIDNDEKKI------------------
CBIX_SULTO      AKKLASNGVDTIIVVPLLFAAGTHFKRDIPKQL----EEI--------------------
CBIX_ARCFU      -EAIREMNCDIIYVVPLFISYGLHVTEDLPDLLGFPRG-----------RGIKEGEFE--
                       .   : ..*:::: * *  .*:*  *                           

CFBA_METAC      ------DVPLCYAKPLGADELIADLVFKRVQEAL-------
CFBA_METBF      ------TVPLCYANPLGADELIADLVFKRVQEAL-------
CFBA_METMA      ------EVPLCYAKPLGADELIAELVFKRVQESL-------
CFBA_METTH      HEEFEFDGEIVYTEPLGADPRIAEIIRDRVKSAI-------
CFBA_METJA      KLEIPEDVEIIYREPIGADDRIVDIIIDRAFGR--------
CFBA_METMP      AVEIPEGVELVYRKPMGADDRIIDIVLDRANGL--------
CFBA_METKA      PVDV--DAEIVYAEPLGADPRIAEIVIDRIKEALGEE----
CBIX_SULSO      -RYMGREIEITIADPLGFDEKIGEVLVKRVNETYNKNY---
CBIX_SULTO      -----KGVKIMIAEPIGVDERIAEILKERVEEVLRSSTRS-
CBIX_ARCFU      ------GKKVVICEPIGEDYFVTYAILNSVFRIGRDGKGEE
                         :   .*:* *  :   : .