CLUSTAL format seed alignment for MF_01200_A

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRF_METJA      -----------MPKLMLALDVL---DRDRALKIVEDVKDYVDAIKVGYPLVLSTGTEIIK
PYRF_METTH      MRSRRVDVMDVMNRLILAMDLM---NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIA
PYRF_ARCFU      -----------MKQLILALDVM---DGEKAMEIAKKVAEHVDRIKVNYPLVLSAGVGIMK
PYRF_METTE      --------------MILALDVT---DRDEALKIAEDVWEFVDAIKVGYPLILTTGLGIIR
PYRF_PYRAB      -------------MIVLALDVY---DEDRALKIAEETKDYVAMIKVNWPLIIGSGLDIIR
PYRF_PYRHO      -------------MIVLALDVY---EGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIR
PYRF_THEAC      ---------MSESRLVVALDLT---DKDRALEIARSIGRQVFAIKINWPLVLAGSGSIIG
PYRF_THEVO      ----------MDKRIIVALDVK---EKKKAIDIAESLSDIVFAFKINWPLVLYSSPEVIG
PYRF_SULSO      ---------MLKSRVILAMDK------PLSYQVLKEMENELYGIKVGLPLVLDLGVDKTR
PYRF_SULTO      --------------MILSLDR------QIPLSTLSEINKYIHKVKIGYPLILE-NIEYLD
PYRF_AERPE      --MDPPAVGEAVKRVIVALDPARRGDVDRLLDMARLVCGVGAGIKVGLPMLALGGSEALA
                              :::::*                       .*:. *::   .     

PYRF_METJA      EI-KKLCN-KEVIADFKVADIPATNEKIAKITLKY-ADGIIVHGFVGED-SVKAVQDVAK
PYRF_METTH      EF-RKRFG-CRIIADFKVADIPETNEKICRATFKAGADAIIVHGFRGAD-SVRACLNVAE
PYRF_ARCFU      RL-SEI---KPVIADFKIADVPYTSSLIARIAFENSAESVIVHGFVGSD-TLREVCRVAE
PYRF_METTE      EL-AEF---APVIADFKVADIPNTNRLICDQVFEAGADAVIVQGFTGRD-SLDACIEIAS
PYRF_PYRAB      KL-KDRTG-LKIIADLKLADIPNTNKLIARKVYEAGADYIIVHPFVGRD-SVEAVNELG-
PYRF_PYRHO      RL-KEETG-VEIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRD-SVMAVKELG-
PYRF_THEAC      EI-ARV---SRVVCDFKIADIPNTNSIIAKFARDQGAWGIISHSFTGLE-SLRSVVEASG
PYRF_THEVO      EI-SQY---GKVICDFKVADIPYTNSLITERVRDLGAWGIISHSFLGEE-SLKSVVNAAK
PYRF_SULSO      ELLIGLDV-EEIIVDFKLADIGYIMKSIVER-LSF-ANSFIAHSFIGVKGSLDELKRYLD
PYRF_SULTO      DI-VKLHW-DEIIFDLKLADIDNTMVLIVSKFINY-ADSFIAHSFIGIEGALDKLSEFLK
PYRF_AERPE      EAARLCKGGGLRVLDLKLADIGYIMRLAAES-LSRGFDAAIAHAFVGYEGGLVELKKTLD
                            : *:*:**:                   * : * * .  :        

PYRF_METJA      KLNKKVIMVTEMSHPGAVQFLQPIADKLSEMAKKLKVDAIVAPSTRPERLKEIKEIA--E
PYRF_METTH      EMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQD
PYRF_ARCFU      EFGGKVYAVTELSSPGGEEFMSAVSLKIVEKAKEAGCHGLIAPSTRIERLREIRKAAG-D
PYRF_METTE      EYRKDVFVVSEMSHPGGAEFLQPAAESIAKMALEAGAFGLVAPATRPERVRKIRRIIGDK
PYRF_PYRAB      E----IILVVEMSHPGALEFINPLTDKFIELANDVEPFGVIAPGTRPERVKYIRERLKEG
PYRF_PYRHO      E----IIMVVEMSHPGALEFINPLTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKEG
PYRF_THEAC      DT--KVFSVVAMSHPGS-DLINDNYRKLMDISERAGVYGYIAPGNKLSDLSEIRKRT--K
PYRF_THEVO      GM--HVFSVVAMSHPGS-DMINSNAMQLMKLSIECGVYGFVAPANKIDDLRMIRSAT--D
PYRF_SULSO      ANSKNLYLVAVMSHEG---WSTLFADYIKNVIREISPKGIVVGGTKLDHITQYRRDFE-K
PYRF_SULTO      NQNKSLYLVLSMSHKG---WNDEFYPYLKNIAKTIDPKGFVVGATRPNMIRIVRNDFR-D
PYRF_AERPE      GLGARLVLVVSMSHPGSREVLDPCLDKLLAVARRVEPWGVVAPATRPEVVARVRETLP-T
                     :  :  :*  *           :            :  ..: . :   :      

PYRF_METJA      LPVITPGVGAQGGKIEDILNILDENDYVIVGRAIYQSQNPKEEA----KKYKEMLNK---
PYRF_METTH      SFLISPGVGAQGGDPGETLRFADA---IIVGRSIYLADNPAAAAAGIIESIKDLLNP---
PYRF_ARCFU      MEILCPGIGAQKGSI-EAVKYADG---IIVGRGIYASGNPAEEA----RKLRRVLKI---
PYRF_METTE      LTIISPGVGAQGGKASDVIAAGTD--WVIVGRSIYKAESPKEAAREIAEEIQAELRGEY-
PYRF_PYRAB      VKILTPGIGAQGGKAKEAIEAGAD--YVIVGRSIYNAPNPREAA----REIYDEIRGE--
PYRF_PYRHO      IKILAPGIGAQGGKAKDAVKAGAD--YIIVGRAIYNAPNPREAA----KAIYDEIRGV--
PYRF_THEAC      KTIMSPGIGSQGGRASDAIKAGAD--LVIVGRSIYESADPVTAAEAINEEIAKAVEQN--
PYRF_THEVO      RVIISPGIGAQGGDPYTAVLNGSD--YLIVGRSVYESDKPELEVSKLQQTAERAIEDRER
PYRF_SULSO      MTIVSPGMGSQGGSYGDAVCAGAD--YEIIGRSIYNAGNPLTALRTINKIIEDKVMKCKG
PYRF_SULTO      KIIISPGVGAQGAMIGDAICNGAD--YEIIGRSIYESKDPVTETKKIIETQEVKINECKR
PYRF_AERPE      TVILSPGVGAQGGKPGDAICLGGA-DYEIVGRMVAGSPDPVSALRGVAEYIAARCPEKLL
                  :: **:*:* .     :         *:** :  : .*        .           

PYRF_METJA      ---------
PYRF_METTH      ---------
PYRF_ARCFU      ---------
PYRF_METTE      ---------
PYRF_PYRAB      ---------
PYRF_PYRHO      ---------
PYRF_THEAC      ---------
PYRF_THEVO      LKNS-----
PYRF_SULSO      AIFRKK---
PYRF_SULTO      TEN------
PYRF_AERPE      HSSTGNGPS