CLUSTAL format seed alignment for MF_01220_A

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRH_METAC      ----MLIVLSLGGSILAK--NLDSDRFLK--YANVLRDISKKHTLL-VITGGGEAARNYI
PYRH_METMA      ----MLIVLSLGGSILAK--NLDPDRFLK--YANALRDISKKHTLL-VVTGGGEAARDYI
PYRH_HALSA      ----MRVVVSIGGSVLAP--GLDADQVDA--HADAINELTDAGCEVGAVVGGGGVARDYI
PYRH_METTH      ----MRIVITIGGSIIIS--EFSHEMFRA--YADILNSLRDEHDLF-VVVGGGRPARDYI
PYRH_THEAC      --MNESIVISLGGSVISG-DPIDADYMKS--FARILEASK--YRRVGIVTGGGRTARSYI
PYRH_THEVO      --MNESIVISLGGSVISG-DPIDADYLQS--FAKILASSK--FKRIGIVTGGGKTARSYI
PYRH_PICTO      ---MKRVVISLGGSIISM-EKLNLEFMEE--FSRMLGNIKG-YDGFGIVVGGGKLARTYI
PYRH_PYRAB      ----MRIVFDIGGSVLVP-SKPDVEFIDK--LSYELTKV-SEDHEIAIVVGGGKTAREYI
PYRH_PYRHO      ----MRIVFDIGGSVLVP-EKPDVDFITK--LGYELTKI-SEDHEIAIVVGGGKVAREYI
PYRH_PYRFU      ----MRIVFDIGGSVLVP-ENPDIDFIKE--IAYQLTKV-SEDHEVAVVVGGGKLARKYI
PYRH_METJA      ----MRIVFDLGGSVVMPKEGAKAEKIME--YANIFKKIKDEGHEVAIVVGGGKTAREYI
PYRH_ARCFU      ----MKVVLSLGGSVLSN----ESEKIRE--FAKTIESV-AQQNQVFVVVGGGKLAREYI
PYRH_METKA      ----MYSVVALGGSVVNV---DKPERIKE--TAEILRNGLDSGLKICVVVGGGPTARRYI
PYRH_CENSY      -MAKKRIVIKLSGSAFGG---DDGKVLRE--YAAFLSGISGSWQPV-VVAGGGRVARQYI
PYRH_SULSO      ---MMNIILKISGKFFDEDNVDNLIVL-----RQSIKELADNGFRVGIVTGGGSTARRYI
PYRH_SULTO      ----MKLVLKISGKFFDEENIENFISL-----RNTIKNIVNEGHRLAIVSGGGSTARKYI
PYRH_IGNH4      ---MKTLVLKISGKFVSPYDTPLVEGY-----AKTLEALRRKY-KLAVVVGGGSVARKYI
PYRH_STAMF      --MSNTLVIKITGKLFDT-NASLIKKY-----VEIFKDLSGKY-KLAIITGGGGLARKYI
PYRH_PYRAE      ----MALVIKLSGRVFED--EELVFKY-----AGVIRNLSGK---VAVVTGGGEVARRYI
PYRH_AERPE      ---MESVVVKISGSLVHPPRLDYLTRL-----RDVLWGLVDGGFRVAVVVGGGGLARSYI
PYRH_THEPD      MGEAALAVVKLGGSLLFEDEGSLKEGYVRGFLRELREYLAESNGRVVVVVGGGRYARNYI
                       :. : *  .                             .  : ***  ** **

PYRH_METAC      GAARAMGA-DEVTCDYIGIDITRLNARLLIAALGPDGYPEIPTNYLEASKAINSGKVVVM
PYRH_METMA      GAARAMGA-DEVTCDYIGIEITRLNARLLISALGHDAYPEIPSNYPEASKAMTSGKVVVM
PYRH_HALSA      GTARELGA-NEIELDDIGVDVTRLNARLLIAALGGDAAPSPAEDYEDAGEAMRRGDIAVM
PYRH_METTH      GVARELGA-SEARCDDIGIDVTRLNARLLITALGDSAYPGVPENFREALEVAATGRIVVM
PYRH_THEAC      SVLRKLNV-NENVLDEIGIYATRMNALSMASLIPGSN-PTIPFTVEDAVNLMNTYRFVVM
PYRH_THEVO      SLLRSLGI-NENMLDEIGIYATRMNALSLASLLKGAN-PIIPSTVEEAVNLMSEYRFVVM
PYRH_PICTO      SDLRKYNV-NDNILDEIGINATRINALAMTTFLDDVN-SKIPTTVNDAAEMMHDYRYVVM
PYRH_PYRAB      EVASKFNA-NETFKDYLGIQITRANAMLLIAALKERAYPQVVTDFWEAWKAIQLKKIPVM
PYRH_PYRHO      EVASKFNT-NETFKDYLGIQITRANAMLLIAALKERAYPQVVSDFWEAWKAIQLKKIPVM
PYRH_PYRFU      EVAEKFNS-SETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVM
PYRH_METJA      EIGRELGA-SESFCDELGIMATRMNAMILITALGDYSIKKVPTSFEEAELILNLGKIPVM
PYRH_ARCFU      KRARELGA-SETFCDYIGIAATRLNAMLLISAIPSAA-KKVPVDFMEAEELSKLYRVVVM
PYRH_METKA      NVARNLGT-PETLLDEMGIAVTRLNAMLLGAALGLHD-LHVPETPVEAARIVRRNGVAVC
PYRH_CENSY      ANARSSGA-DETTLDEIGIGVSRLNARLLICALGAKAHPYPPATLKEVRHAVDGGLVVIA
PYRH_SULSO      KLAREIGI-GEAYLDLLGIWASRLNAYLVMFSLQDLAYMHVPQSLEEFIQDWSHGKVVVT
PYRH_SULTO      KIGRELGV-NEAHLDLLGIWASRLNAYLLTFILSDLSYMKVPENLEEFIEKWESEKVVIT
PYRH_IGNH4      ----ELAPPSKGLKDLIGIEVSRLNA-LLLSMHTPSAKKVIPKSASEVLELWDGEDILIV
PYRH_STAMF      GYAREIGVSSNYWLDMIGIRSAQLNAYLLISSLYPKAYPEPVNNLEELLRIMNNYEIAVL
PYRH_PYRAE      AIA-KRGGASNTFQDLLGIYASRLNA-LLLISLLKDAYPRVPANIEEFLEAWSGHRIVVT
PYRH_AERPE      DVLRRAGV-SEALLDEMGIESSRLNASLLAKLLYPRSQPYPLASLREVLEVFMTGLIPVS
PYRH_THEPD      QLGRRLGV-NEGVLDYLGILVSRLNAATMYAAFYNSPPLIPETLLDVHKLLASGLRVVFM
                          .   * :*:  :: **  :                             . 

PYRH_METAC      GGVTPGQTTDAVAAILAEYLRADLLTIATSIDGVYSSDPNCDPSAVKYDKISPEKLINIV
PYRH_METMA      GGVTPGQTTDAVASILAEYLRADLLTIATSIDGVYSSDPNCDPCAVKYEKISPEKLINIV
PYRH_HALSA      GGVVAGQTTDAVSAALAEYTDADLLLYATSVPGVFSADPNEDADAEHFTRMTAGELVDII
PYRH_METTH      GGTEPAHSTDAVGAILAETVEADLMINLTSVDGFYDRDPAKYPDARFYPEITASEMLEHL
PYRH_THEAC      GGTEPGHTTDTVAALLCERSATRTLINVTSVDGVYDMDPHRFANAKRFDRIGYREAIALS
PYRH_THEVO      GGTEPGHTTDTVAALLCERSDTDTLINITSVDGVYDLDPNKYKDARRFDTLGYREAITLS
PYRH_PICTO      GGTEPGHTTDTVAMLFAERINADVMINGTSVDGVYTEDPRKNRNAKKIDRMNYDDAIKLS
PYRH_PYRAB      GGTHPGHTTDAVSALLAEFLGADLLVVITNVDGVYTDDPRKNPNAKKLEKISARELVQIV
PYRH_PYRHO      GGTHPGHTTDAVSALLAEFLSADLLVVITNVDGVYTEDPKKNPNAKKIPKMKAKDLVDIV
PYRH_PYRFU      GGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIV
PYRH_METJA      GGTHPGHTTDAVAASLAEFINADLLVIGTNVDGVYDKDPNKYEDAKKFDKMSAKELVDLA
PYRH_ARCFU      GGTFPGHTTDATAALLAEFIKADVFINATNVDGVYSADPKSDTSAVKYDRLSPQQLVEIV
PYRH_METKA      GGTHPGHTTDAVAAMIAELLEGP-LVIVTNVDGVYDKDP-SEPGARKLRELRPEELEELA
PYRH_CENSY      GGLHPGQSTNGTAALIAEKVGAAQFLNATDVDGVYDRDPNKHSDARMLRKIGLGELRKML
PYRH_SULSO      GGFQPGQSTAAVAALVAEASSSKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDLRKIL
PYRH_SULTO      GGFQPGQSTATVAALVSEAIAADYLILATNVDGVYDKDPRYNKDAKLLSKLNTETLKKIL
PYRH_IGNH4      GGLQPGQSTNAVALVVAELVGADLVVNATTVDAVYDK-PPSQPGAKRIEKIKARELQRLL
PYRH_STAMF      GGLIPGQSTSSVALEVAEALGVSKVIDYSAIDKVYDKDPLKYPDAKPYDKISIAKLREIL
PYRH_PYRAE      GGFQPGQSTATVAALVAEAVGASALLNAANIDAVYSDDPRRNPNAQRLRELKYDEFEKII
PYRH_AERPE      GGFQPGQSTNAVAAVIAEALGARTLLNCLKGVEGVYSDEPSTPGARLLRRLTYRQLEDIL
PYRH_THEPD      GGLQPGQSTTTTAALVAESLNG-SLIIATDVEGIYTDDPKRNPAATLMERVSVEELRRMF
                **  ..::*  ..  ..*      .                   .     :         

PYRH_METAC      MA--IEMKAGSKSPVDPVAAKIIERCKLDALVMDARDPS-LLGEILGEEVAKKSPVSCGT
PYRH_METMA      MA--IEMKAGSKSPVDPVAAKIIERCKLDALVMDARNPD-LLVEVICGEAAKKSPVSCGT
PYRH_HALSA      AD--IEMNAGSSAPVDLLAAKLIERSGVRTIVLDGTDPRRIVDAVRFGEHDGTDVIPDGT
PYRH_METTH      RG--SDVRAGTYEFFDHTALHMIRRSGIRTMIVNGNDPENLLRAL--DGEIGTTVIPE--
PYRH_THEAC      TK--SSAGAGPNVFMDITALTIAMRSRIRVIVTSR-DIDNL-EKILKGDRAVSTFIDDDQ
PYRH_THEVO      TG--SSVGAGPNVFMDITALSIAMRSKIKVIVASR-DLNNL-KNILEGKPSVFTSIEEKA
PYRH_PICTO      IE--NSIGAGSNVFMDITSLSIAKRSGIKIFVINGLKIDEY-INILYNGTCNGTIIE---
PYRH_PYRAB      GK--STSKAGASTVIDPLAASIILRSGIKTYIIGKKDALR--LFDVIRGKHEGTTVEP--
PYRH_PYRHO      SR--EAGKAGVSTVIDPLAAKIIMRSGIKTYVIGKEDALK--LFDVIKGNHNGTIIEP--
PYRH_PYRFU      GK--GIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKD--LFRVIKGDHNGTTIEP--
PYRH_METJA      IS--SSLKAGSSSVVDLLAAKIIERAKLKVAVV-KGTPEE--LLNVSKGIINGTIIEG--
PYRH_ARCFU      SR--SSAKAGTNVVIDLLAAKIIERSKIKTYVI-LGTPEN--IMKAVKGEAVGTVIA---
PYRH_METKA      VR--AELKAGGSFVVDPLAAKMISRGQIVTHVVSWEDFRSRGLENVVRGRHNGTIIEG--
PYRH_CENSY      AR--EDSVAGGYDLMDLVALKVIERSRIRTRILRADVNVLKKAVRGTAAGTELVLPDS--
PYRH_SULSO      EG-SQSVQAGTYELLDPLAIKIVERSKIRVIVMNYRKLNR--IIDILKGEEVSSIIEPV-
PYRH_SULTO      ET-SQSVKAGTYELLDPLAIKIIERSKIKVIVMNYKRLNK--ILDIIHGKDIGSIIEPM-
PYRH_IGNH4      ESFDWKNEPGRYELMDSIALQIAERSKIPIAVIYGGEPER--IPSIVEEEAWGTLILP--
PYRH_STAMF      RQ---KQLPGEYALIDLRALDIAERSKITIIITHYKKPNT--IYDILRGENPGTIIYP--
PYRH_PYRAE      RS---SSLPGGYELMDVWSISILKRNCITTYVFDGRRPDH--VVAAARGENPGSKITC--
PYRH_AERPE      VKVS-SQRAGSYTLWDMVALSVARRSGLRIVFFDCSDPAN--IWGALKGEK-GSIVEG--
PYRH_THEPD      QR---EQVAGEYRMIDVLSLNVIQRSKVKVFVLKGDPPGN--IFRALRGERVAGTFIEA-
                        .*     *  :  :  *  :   .                            

PYRH_METAC      ------WITARK
PYRH_METMA      ------WITAKK
PYRH_HALSA      DNQMTYWADNQE
PYRH_METTH      ------------
PYRH_THEAC      RS----------
PYRH_THEVO      ------------
PYRH_PICTO      ------------
PYRH_PYRAB      ------------
PYRH_PYRHO      ------------
PYRH_PYRFU      ------------
PYRH_METJA      ------------
PYRH_ARCFU      ------------
PYRH_METKA      ------------
PYRH_CENSY      ------------
PYRH_SULSO      ------------
PYRH_SULTO      ------------
PYRH_IGNH4      ------------
PYRH_STAMF      ------------
PYRH_PYRAE      ------------
PYRH_AERPE      ------------
PYRH_THEPD      ------------