CLUSTAL format seed alignment for MF_02123

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FGD_AMYMU         -------MLKVGYKASAEQFGPRDLVEYAVRAEEVGLDSVWVSDHFLPWRHEGGHAPWAL
FGD_KRIFD         ------MSIRIGYKASAEQFGPRDLVEYAVRAEELGLDSVTVSDHFLPWRHEGGHAPFAL
FGD_MYCS2         -----MAELKLGYKASAEQFAPRELVELAVLAESAGMDSATVSDHFQPWRHEGGHAPFSL
FGD_MYCFO         -----MAELKLGYKASAEQFAPRELVELAVLAEAAGMDSATVSDHFQPWRHEGGHAPFSL
FGD_MYCGI         -----MAELKLGYKASAEQFAPRELVELAVAAEEHGMDSATVSDHFQPWRHEGGHAPFSL
FGD_MYCTU         -----MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSL
FGD_MYCLB         -----MAELRLGYKASAEQFAPRELVELGVAAEAHGMDSATVSDHFQPWRHQGGHASFSL
FGD_MYCA1         -----MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHEGGHAPFSL
FGD_MYCA9         ----MARELKLGYKASAEQFAPRELVELAVATESHGFDSATVSDHFQPWRYNGGHAPFSL
FGD_RHOE1         ----MVQGLKLGLKASAEQFGPRDLVELGVMAEEHGLDSVTVSDHFQPWRHNGGHAPFSI
FGD1_RHOJR        ------MVIKFGYKASAEQFGPRELVELGVLAEAHGMDSATVSDHFQPWRHEGGHAPFSL
FGD_RHOE4         ----MAQELKLGYKASAEQFGPRELVELAVLAEQHGMDSVAVSDHFQPWRHNGGHAPFSL
FGD2_RHOJR        ----MTQQLKLGYKASAEQFGPRELVELAVLAEKHGMDSATVSDHFQPWRHNGGHAPFSL
FGD_NOCFA         -----MGDLELGFKASAEQFGPRELVDIAVLAEEHGMDSATVSDHFQPWRHKGGHAPFSL
FGD_GORB4         ----MAQELKLGFKASAEQFDPRELVEIAVAAEEHGMDSVAVSDHFQPWRHNGGHAPFSL
FGD_TSUPD         -----MAKLQLGYKASAEQFGPRELVEIAVAAEAAGMDSVAVSDHFQPWRVNGGHAPFSL
FGD_SEGRD         ----MSLPIKLGYKASAEQFNPRELVEYTVAAERHGFDSVVVSDHFQPWRYTGGHAPWAL
Q2PC85_STRAH      ------MGLKIGYKASAEQFAPRELVEYAVSAEGHGLDSVWISDHLQPWRHEGGHAPFSL
FGD_INTC7         -------MLKVGWKASAEQFGPRELVDHTVRAEQLGFDSVFISDHFQPWRHRAGHAPFAM
FGD_KINRD         MVDTHGQPLKLGYKASAEQFAPGKLADFAVQAEEQGLDSVWISDHFQPWRHVDGHAPSAL
FGD_MICTS         ----MTIPLRFGYKASSEQFGPNELLDFGVLAEEMGFDSVFLSDHLQPWMHDGGHAPNAL
FGD_NAKMY         ---MTPPPIRFGYKASAEQFGPSELADLAVAAEEHGFDSVFISDHLQPWRHDGGHAPASL
FGD_BEUC1         -------MLRLGYKASAEQFAPRDLLAYTVLAEQAGFDSVFVSDHLQPWRHTGGHAPAAL
                          :..* ***:*** * .*    * :*  *:**. :***: **    ***. ::

FGD_AMYMU         AWMPAVAERTKRVQIGTSVLTPTFRYNPAVIAQAFATMSLLSNGRVILGVGSGEALNEIA
FGD_KRIFD         AWMAAVGERTNRVLIGTSVLTPTFRYNPAVIAQAFATMGLLYPGRIMLGVGTGEALNEIA
FGD_MYCS2         AWMTAVGERTKNLVLGTSVLTPTFRYNPAVIAQAFATMGCLYPGRIFLGVGTGEALNEIA
FGD_MYCFO         AWMTAVGERTQRLVLGTSVLTPTFRYNPAVIAQAFATMGCLYPGRVFLGVGTGEALNEIA
FGD_MYCGI         AWMTAVGERTTRLQLGTSVLTPTFRYNPAVIAQAFATMGCLYPDRIFLGVGTGEALNEIA
FGD_MYCTU         SWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIA
FGD_MYCLB         SWMTAVGERTNRILLGTSVLTPTFRYNPAVIGQAFATMGCLYPNRVFLGVGTGEALNEVA
FGD_MYCA1         AWMTAVGERTTRITLGTSVLTPTFRYNPAVVAQAFATMACLYPGRIFLGVGTGEALNEIA
FGD_MYCA9         AWMTAVGERTQRLQLGTSVLTPTFRYNPAVTAQAFATMGCLYPGRIFLGVGTGEALNEIA
FGD_RHOE1         AWMTAVGERTQRLQLGTSVMTPTFRYNPAVVAQAFATMGCLYPGRVMLGVGTGEALNEIA
FGD1_RHOJR        AWMTAVGERTSRLQLGTSVMTPTFRYNPAVVAQAFATMGCLYPGRIMLGVGTGEALNEIA
FGD_RHOE4         AWMTAVGERTERVQIGTSVMTPTFRYNPAVIAQAFATMGCLYPGRIMLGVGSGEALNEIA
FGD2_RHOJR        SWMTAVGERTKRLQLGTSVLTPTFRYNPAVIAQAFATMGCLYPGRIMLGAGTGEALNEIA
FGD_NOCFA         AWMAAVGARTERIKLGTSVLTPTFRYNPAVIAQAFATMGCLYPGRVMLGVGTGEALNEIA
FGD_GORB4         AWMAAVGERTKRVQIGTSVMTPTFRYNPAVIAQAFASMGCMYPGRIMLGVGTGEALNEYA
FGD_TSUPD         AWMAAVGERTERVKIGTSVMTPTFRYNPAVIAQAFASMACMYPDRIFLGVGSGEALNEYA
FGD_SEGRD         AWLGAVGERTSRVQIGTSVLTPTFRYNPAIIAQAFATFGMLYPGRVFLGVGTGEALNEQA
Q2PC85_STRAH      SWLSAVGERTERVQLGTSVLTATFRYNPAVVAHASATLGVLYPGRIALGIGSGEALNEVA
FGD_INTC7         SWLAAAGERTERVTLGTSVMTPTFRYNPAVVAQAFGTLGALNPGRIILGIGTGEALNEVA
FGD_KINRD         VWLPWVAAKTSRVQLGTSVLTPTLRYNPAVIAQAFATLGCLAPGRAILGIGTGEALNETA
FGD_MICTS         PWLGALGARTERVIIGTSVLTPTFRYHPGVIAQVFATLGVMYPGRVVLGVGTGEALNEVT
FGD_NAKMY         PWLGAVGARTQRVILGTSVLTPTIRYHPGVIAQAFATLGSMYPGRIVLGVGTGESLNEVP
FGD_BEUC1         PWLGAAAASTERVLLGTSVLTPTLRYHPGVVAQAFATLGCLAPGRVTLGVGSGESMNEAP
                   *:   .  * .: :****:*.*:**:*.: .:. .::. :  .*  ** *:**::** .

FGD_AMYMU         VSGR--EWPEFKERFARLRESIKLIRELWTSDNVNFKGDYYELVDAKIYDRPEQPVPVYI
FGD_KRIFD         VSGR--EWPEFKERFARLREAVDLIRDLWTKEGVSSDGPFYPTVDASIYDRPETPVKVYV
FGD_MYCS2         TGYAG-EWPEFKERFARLRESVRLMRELWLGDRVDFDGEYYRTKGASIYDVPEGGIPVYI
FGD_MYCFO         TGYIG-QWPEFKERFARLRESVKLMRELWLGDRVDFDGEYYKLRGASIYDVPEGGIPVYI
FGD_MYCGI         TGYEG-EWPEFKERYARLRESVRLMRELWLGDRVDFEGEYYKTKGASIYDVPEGGIPIYI
FGD_MYCTU         TGYEG-AWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYI
FGD_MYCLB         TGYQG-AWPEFKERFARLRESVRLMRELWRGDRVDFDGDYYQLKGASIYDVPEGGVPIYI
FGD_MYCA1         TGYQG-EWPEFKERFARLRESVRLMRELWRGDRVDFDGEYYRLKGASIYDVPDGGVPIYI
FGD_MYCA9         TGYIG-EWPEFKERFARLRESVRLMRELWTGERVDFEGEYYRTQGAAIYDVPEGGIPVYI
FGD_RHOE1         TGFKG-EWPEFKERFARLRESVQLMRDLWTGDRVDFEGEYYSTKGASIYDVPEGGIPVYI
FGD1_RHOJR        TGFAG-EWPEFKERFARLREAVALMRELWLGDRVDFEGNYYKTVGASIYDVPEGGIPVYI
FGD_RHOE4         TGFQG-EWPEFKERFARLRESVRLMRELWLGDRVDFEGEYFTTRGASIYDVPEGGIPVYI
FGD2_RHOJR        TGYTG-QWPEFRERYARLRESVQLMRDLWTGERTDFKGEYYSTTGASIYDVPECGIPVYI
FGD_NOCFA         TGYQG-EWPEFKERFARLREAVELMRALWTGDRVDFDGQYYRTVGASIYDVPEGGVPIYI
FGD_GORB4         AGFQG-EWPEFKERFARLREAIRLMRELWTGDEVNFDGEYYHTQGAYMYDVPEQPIPVYV
FGD_TSUPD         TGFQG-EWPEFKERFARLRESVRLMRELWSGEISNFDGDYYHTKDAVLFDIPERPVPVYI
FGD_SEGRD         VGLK--EWPEFKERFARLRESVELMRKLWTEERVNYEGEYYRTVDATVYDKPSEPIPVYV
Q2PC85_STRAH      VARI--TWPDFKERFARLREAVELIRRLWTEDRVTSEGQYHQTTSVSLYDRPQTPVPIYI
FGD_INTC7         VGAAGSPWPEFKERFARLREAVTLMRRLWTEERVTFEGDYYRTHDATIYDRPAEPIPVYV
FGD_KINRD         VGVT---FPETRERFARLREAVRLIKQLWSEERVTFEGEYYNLHDATVYDRPEQPVPIYV
FGD_MICTS         LGLE---WPEAPERFQRLKEAITIINELWAGERVTYEGTYYSVKDATIYDRPEQKVPIYI
FGD_NAKMY         LGLA---WPEQKERFARLKESVNLIHELWTGERVTFEGEYYRTDKATIYDRPADPVPIYI
FGD_BEUC1         LGLP---WPDGKERYARFREAIALIQALWAGERVTIDGTYYSARDATIYDRPDVPVPLYV
                   .     :*:  **: *::*:: ::. **  :    .* :.    . ::* *   : :*:

FGD_AMYMU         AAGGPVVAKYAGRAGDGFICTSGKGMELYTDKLMPAVKEGAEAAEKTVEDVDRTIEIKLS
FGD_KRIFD         AAGGPLVAKYAGRAGDGFIATSGKGMELYTEKLLPAVKEGAEKAGKTFEDVDRMLEVKVS
FGD_MYCS2         AAGGPVVAKYAGRAGDGFICTSGKGEELYAEKLIPAVKEGAAAADRDADAIDRMIEIKIS
FGD_MYCFO         AAGGPVVAKYAGRAGDGFICTSGKGEELYKDKLIPAVREGAEAAGRNAEDIDRMIEIKIS
FGD_MYCGI         AAGGPQVAKYAGRAGDGFICTSGKGEELYKEKLIPAMREGAEAAGKNPDDVDRMIEIKIS
FGD_MYCTU         AAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKIS
FGD_MYCLB         AAGGPEVAKYAGRAGEGFVCTSGKGEELYTEKLIPAVLEGAAVAGRDADDIDKMIEIKMS
FGD_MYCA1         AAGGPAVAKYAGRAGDGFICTSGKGEELYKDKLIPAVKEGAAINDRNVDDIDKMIEIKIS
FGD_MYCA9         AAGGAVVAKYAGRAGDGFICTSGKGEELYSGKLIPAVREGAALAERSFDDIDRMIEIKIS
FGD_RHOE1         AAGGPVVARYAGRAGEGFICTSGKGMDLYTEKLIPAVKEGAEKAARNFADIDRMIEIKIS
FGD1_RHOJR        AAGGPVVARYAGRSGDGFICTSGKGMELYTEKLMPAVAEGAEKADRDVAEIDKMIEIKIS
FGD_RHOE4         AAGGPVVARYAGRAGDGFICTSGKGMELYTEKLLPAVAEGAAKAERDVADIDKMIEIKIS
FGD2_RHOJR        AAGGPVVARYAGRAGDGFICTSGKGMELYTDKLMPAVSEGATKAERDVTSIDKMIEIKIS
FGD_NOCFA         AAGGPLVARYAGRAGDGFICTSGKGMELYTDKLMPAVAEGAAKAGRSVDSIDRMIEIKIS
FGD_GORB4         AAGGPVVARYAGRAGDGFICTSGKGADLYQEKLIPAVKEGAEKAERDFEAIDRMIEIKIS
FGD_TSUPD         AAGGPVVAKYAGRAGDGMICTSGKGMDLYTEKLIPAAKEGAELGGRDFDALDKMIEIKIS
FGD_SEGRD         SAGGAVVARYAGRAGDGFICTSGKGAELYTETLLPAVQEGADKVGRDAGGIDKLIEIKLS
Q2PC85_STRAH      AAGGPVMAKYVGRKSDGFICTSGKGMELYTEKLLPAVEAGADQEGRDHNAIDKMIEIKLS
FGD_INTC7         AAGGPLVARYAGRSGDGFICTSGKGRELYADQLLPAVDEGLSRSSRTRDDIDRMIEIKLS
FGD_KINRD         AAGGPGVTKYAGRAGDGYICTSGKGMDLYSETLLPALREGLEASGRTEGQIDRTIEIKLS
FGD_MICTS         GASGPAATRLAGRIAEGYITTSGKDPELYTEKLLPALDDGLSKAGRTRDDVDTLMEVKVS
FGD_NAKMY         GASGPAATRLAGRIADGFITTSGKAPSLYTDTLLPALRDGVEKAGRRLDELDTLMEMKVS
FGD_BEUC1         AASGPSATRLAGRVGDGFICTSGKGRELYTETLLPALAEGAAKSDRTLADLDLMIEMKVS
                  .*.*.  :: .** .:* : ****  .**   *:**   *     :    :*  :*:*:*

FGD_AMYMU         YDRDHEKALENTRFWAPLSLSAEQKHSVSSAEEMERLADELPIDQVAKRWIVASDPDEAV
FGD_KRIFD         YDRDPEAALENTRFWAPLSLTPEQKHSVDSATEMERLADELPIEQVAKRWIVASDPEQAV
FGD_MYCS2         YDTDPELALENTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQVAKRWIVASDPDEAV
FGD_MYCFO         YDPDPELALENTRFWAPLSLTPEQKHSIDDPIEMEKAADALPIEQVAKRWIVASDPDEAV
FGD_MYCGI         YDTDPELALENTRFWAPLSLTAEQKHSIDDPMEMEKAADELPIEQVAKRWIVASDPDEAV
FGD_MYCTU         YDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAV
FGD_MYCLB         YDPDPEQALSNIRFWAPLSLAAEQKHSIDDPIEMEKVADALPIEQVAKRWIVVSDPDEAV
FGD_MYCA1         YDPDPELALENTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQVAKRWIVASDPDEAV
FGD_MYCA9         YDPDPDKALENTRFWAPLSLTPEQKHSIHDPIEMERAADELPIEQVAKRWIVASDPDEAV
FGD_RHOE1         YDTDPAAALENTRFWAPLSLTAEQKHSIDDPIEMEAAADALPIEQVAKRWIVSSDPDEAV
FGD1_RHOJR        YDTDPELALENTRFWAPLSLTPEQKHSIDDPIEMERAADALPIEQVAKRWIVASDPDEAV
FGD_RHOE4         YDTDPEAALENTRFWAPLSLTPEQKHSIEDPIEMEAAADALPIEQVAKRWIVASDPDDAV
FGD2_RHOJR        YDTDPEAALENTRFWAPLSLTQEQKHSIEDPIEMEAAADALPIEQVAKRWIVSSDPDDAV
FGD_NOCFA         YDTDPELALENTRFWAPLSLTAEQKHSITDPIEMEAAADALPIEQIAKRWIVASDPDQAV
FGD_GORB4         YDPDPQLALENTRFWAPLSLTPEQKHSVNSSTEMERLADELPIEQVAKRWIVASDPDEAV
FGD_TSUPD         YDPDPELALENTRFWAPLSLTAEQKHSVNSSAEMERLADELPIEQVAKRWIVASDPDEAV
FGD_SEGRD         YDPDPWLALNNTRFWSPLSLSAEQKHSLSDPKQMEEAADALPMEQIAKRWIVASDPDEVV
Q2PC85_STRAH      YDPDPDQALENCRFWAPLSLTPEQKAGVEDPVKLEKAADELPIGQVAKRWIVASTPDEAI
FGD_INTC7         YDRDPGAALHNVRFWAPLSLTAEQKHGVHDPVEMERLADELSDEQVAKRWIVTSDPGEAV
FGD_KINRD         FDEDPAQALENTRFWAPLSLTAEQKSSVHDPIEMARLADELPIEQVAKRWIVSSDPTEVA
FGD_MICTS         YHPDHDTALEKTRFWAPLALTAEEKMSVHDPIEMQRLANELPIERAASRFIVSTDPDEHV
FGD_NAKMY         FDTDRERAMQDTRFWAALALKPEQKAGVEDPLEMQRLADELPIEQAASRWIVSDDPDEHV
FGD_BEUC1         YDPDHARALEATRNWGALALTSEEKVGVEDPVEMERLADALPTERTASRWIVSDDPDEHV
                  :. *   *:   * *..*:*  *:* .: .. ::   *: *.  : *.*:**   * :  

FGD_AMYMU         AQIKPYLDAGLNHLVFHGPGHDQERFLTQFSEDVLPKLRALG----
FGD_KRIFD         KQFRPYLEAGFNHFVVHGPGHDQERFLTQFTEDVVPLLRKLG----
FGD_MYCS2         EKVGQYVKWGLNHLVFHAPGHDQRRFLELFKRDLEPRLRKLA----
FGD_MYCFO         EKVGQYVTWGLNHLVFHAPGHDQRRFLDLFKKDLEPRLRKLG----
FGD_MYCGI         AKVADYVDYGLNHLVFHAPGHDQRRFLELFQRDLEPRLRKLG----
FGD_MYCTU         EKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRRLG----
FGD_MYCLB         ARVGQYVTWGLNHLVFHAPGHNQRRFLELFEKDLAPRLRRLG----
FGD_MYCA1         AKVKDYVDWGLNHLVFHAPGHDQRRFLELFEKDLAPRLRRLG----
FGD_MYCA9         EKVADYVGWGLNHLVFHAPGHDQKRFLELFKTDLEPRLRKLG----
FGD_RHOE1         EMIKPYLDAGLNHLVFHAPGHDQKRFLDLFERDLAPRLRALA----
FGD1_RHOJR        AQIRPYLDAGLNHLVFHAPGHDQKRFLELFQRDLAPRLRGLA----
FGD_RHOE4         EQVKAYVDAGLNHLVFHAPGHDQRRFLELFERDLAPRLRALG----
FGD2_RHOJR        AQVKQYIDAGLNHLVFHAPGHDQKRFLELFDRDLAPRLRALG----
FGD_NOCFA         EQIKPYLDAGLNHLVFHAPGHDQRRFLDLFQRDLAPRLRALA----
FGD_GORB4         EKVKFYTDCGLNHLVFHAPGHDQRRFLENFEKDLAPRLRKLSV---
FGD_TSUPD         AAVKQYTDAGLNHLVFHAPGHDQRRFLDNFQRDLEPRLRALG----
FGD_SEGRD         EKIKFYTDLGLNHLVFHAPGHDQLRFLEVFERDLAPRLRSL-----
Q2PC85_STRAH      TQIKQYVDAGFNHLVFHGPGHDQERFLKTFAEQVLPGLRGLG----
FGD_INTC7         EQIRQYVDLGFNHLVVHAPGDDQARFLDQFSADVLPGLRGL-----
FGD_KINRD         AAVQGYVDAGFTHLVFHAPGQDQSRFLTQFSADVVPLLRP------
FGD_MICTS         ERIARYVDLGFRHLVFHDPGHDQEQFLRMYGEEILPRLRKRFA---
FGD_NAKMY         EKIRTYLDLGFRHLVFHAPGHDQQRFLALYGEQILPRLRALVGQG-
FGD_BEUC1         ERIWSYVEMGFTHLVFHDPRADQAAFLERYAEEILPRLRARERQVS
                    .  *   *: *:*.* *  :*  **  :  :: * **