CLUSTAL format seed alignment for MF_00037

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURB_AGRFC       ------------------MRQVDGVKLLGRLGDGVNELRGRLTPD----------APMDR
MURB_RHIME       ------------------MKQVNGQKLLDSLGSGVAAIRGRLTPD----------APMDR
MURB_BRUSU       -------------------MMESGEALLKKLDGRLSGLRGRLTPD----------TGMDK
MURB_RHILO       ---------------------MHGQALIDRLGDRLAGLRGRLTPN----------AEMDK
MURB_CAUCR       ----------------------------MTWKTQLPTARGKLLID----------EALAP
MURB_ZYMMO       ----------------------MTTATSSNISSKLPSIRGEIEAN----------APLAP
MURB_RICCN       -------------------------------MLILPIVKGEYKKD----------YNLKH
MURB_RICPR       -------------------------------MSILPIIKGEYKKD----------YNLKH
MURB_HELPY       ----------------------------------------MLETT----------IDFSR
MURB_HELPJ       ----------------------------------------MLETT----------IDFSR
MURB_CAMJE       -------------------------------------------MI----------IDFKK
MURB_AQUAE       ---------------------------------------MLFLKN----------VPLQN
MURB_FUSNN       ---------------------------------------MKIFTN----------QEMKN
MURB_NOSS1       MKISQAVGNACTVPASSVETHNNNPSKESKIIYLPGTNC-EIKSQ----------ALLSA
MURB_THEEB       ----------------------------MTLACLPQTQC-PLQRQ----------VSLAK
MURB_SYNY3       ---------------MIISPATRPTPMETPAIALAGTGT-IIQPE----------TSLAE
MURB_SYNE7       ---------------------------MTGAVSLLET----LQQA----------VPLAG
MURB_BACHD       --------------------------MEQLVESLRALQVGEVRVN----------ESLAH
MURB_BACSU       --------------------------MEKVIQELKEREVGKVLAN----------EPLAN
MURB_CHLMU       ---------------------------------MTNAFPFSVQES----------VPLNR
MURB_CHLTR       ---------------------------------MTDSFPFSVQES----------VPLSR
MURB_CHLPN       -----------------------------MKEAAPMHFPFPVRRS----------VWLNR
MURB_BORBU       -------------------------MPKSLNNFLKKIN--IKPQT----------KNLAN
MURB1_CORGL      -------------------MNDFKKVSESLETALRNEFDFRFATE----------VSLKE
MURB_CLOAB       ----------------------MDYFQDFIAALSNFIKKDNLKID----------VPMKN
MURB_CLOPE       ----------------------MNQYMEFYKLLGEFYNEEDITVD----------SPMSE
MURB_STRA3       ----------------------------MIKTIQKELEGLDIRFD----------EPLKK
MURB_STRP1       --------------------------------MITELHGIDIREN----------EPLKH
MURB_STRP8       --------------------------------MITELHGIDIREN----------EPLKH
MURB_STRP3       --------------------------------MITELHGIDIREN----------EPLKH
MURB_STRMU       ---------------------------MMLNEMNKSLEGVDIRIN----------EPLKK
MURB_STRPN       --------------------------MSVREKMLEILEGIDIRFK----------EPLHS
MURB_LACLA       ---------------------------MIKETDLENIPDLLVKFN----------EPLSK
MURB_LISIN       -----------------------------MNNLQAQFPHIAIKLN----------EPLSK
MURB_LISMO       -----------------------------MNNLQTKFPHIAIKLN----------EPLSK
MURB_STAAM       -----------------------MINKDIYQALQQLIPNEKIKVD----------EPLKR
MURB_STAAW       -----------------------MINKDIYQALQQLIPNEKIKVD----------EPLKR
MURB_STAES       -----------------------MNKNDILRGLESILPKDIIKVD----------EPLKR
MURB_OCEIH       ----------------------MKVSHHLYDQLSRITSEENVMVD----------ELIRN
MURB_CALS4       ------------------------MAEILVDKLKEILKEGKLYLN----------EPMKR
MURB_THEMA       -------------------------------------------MF----------EKLSC
MURB_BORPE       --------------------------MSTVPARIEP--VAPLAP---------------Q
MURB_RALSO       ------------------------------MALLDP--HYPLG----------------R
MURB_PSEAE       -----------------------------MSLELQE--HCSLK----------------P
MURB_NEIMA       ------------------------------MQPIRY--RTDLT----------------P
MURB_NEIMB       ------------------------------MQPIRY--RTDLT----------------P
MURB_XANAC       ----------------------MSDAVQT-GWQLSE--QAPLR----------------T
MURB_XANCP       ----------------------MSAASPL-RWQLIE--HAPLR----------------A
MURB_XYLFA       ----------------------MSLQINTPDWILHA--NAPLR----------------D
MURB_BUCAI       ----------------------------MHKKKYFS--SQSLK----------------D
MURB_BUCAP       ----------------------------MYKKKK-S--YQSLK----------------N
MURB_BUCBP       ------------------------------MKTY----YTSLK----------------K
MURB_WIGBR       ---------------------------------------MKTK----------------I
MURB_ECOLI       -----------------------------------M--NHSLK----------------P
MURB_ECO57       -----------------------------------M--NHSLK----------------P
MURB_ECOL6       -----------------------------------M--NHSLK----------------P
MURB_SALTI       -----------------------------------M--THSLK----------------P
MURB_SALTY       -----------------------------------M--THSLK----------------P
MURB_YERPE       --------------------------------MSNQ--RSSLK----------------H
MURB_HAEIN       --------------------------------------MQNLQ----------------P
MURB_PASMU       --------------------------------------MQNLQ----------------P
MURB_VIBCH       -------------------------------MQIQL--GANLK----------------P
MURB_VIBVU       -------------------------------MQIKQ--NISLK----------------P
MURB_SHEON       ---------------------------------MSF--PYSLK----------------S
MURB_MYCLE       -------------------------MKRSAVGSFFA--GAHVAE----------AVSLAP
MURB_MYCTU       -------------------------MKRSGVGSLFA--GAHIAE----------AVPLAP
MURB2_CORGL      -------------------------MDSSLAQEIAAIDGVELDS----------EVTFAD
MURB_STRCO       -----------------MRTRRDVPADRSGRSRVSRHPGLSVPSRTLEPVQELHDAPLAP
MURB_LEPIN       -------------------------MSPVLSESQLRDFKHTLESSK---IPFRSEVRLGI
MURB_DEIRA       ----------------------------------MSRSGARVER-----------VPLAR
                                                                             

MURB_AGRFC       VTWFRAGGLAEVMFQPHDTDDLIA-----FLKILPE-DV-----PLTVVGVGSNLLVRDG
MURB_RHIME       VTWFRAGGLAELMFQPHDTDDLVA-----FLKLVPE-EV-----PVMVVGVGSNLLVRDG
MURB_BRUSU       ITWFRAGGPAQVLFQPSDEEDLSA-----FLKAVPE-EI-----PLLVVGIGSNLLVRDG
MURB_RHILO       ITWFRAGGLAEVFFQPADEEDLAA-----FLRAVPE-EI-----PLTIVGVGSNLLVRDG
MURB_CAUCR       FTWFRVGGPADVVFLPADEQDLSD-----FLKGLDP-SV-----PVMAIGVGSNLLVRDG
MURB_ZYMMO       LTWFRVGGNAEWLVSPYDTEDLSD-----FLKKIDP-SM-----PVRVLGIGSNVIIRDG
MURB_RICCN       LTWFKVGGNAEIFFKPLDSEDLKS-----FLIQNKQ-KL-----PIKTFGAGSNIIIRDG
MURB_RICPR       LTWFKVGGNAEIFFKPFDFADLKS-----FLIQNKQ-KL-----PITTFGSGSNIIIRDG
MURB_HELPY       YSSVKIGTPLKVSVLEN----------------DDEISQ-----EHQIIGLANNLLIAPS
MURB_HELPJ       YSSVKIGAPLKVSVLEN----------------DNEISQ-----EHQIIGLANNLLIAPD
MURB_CAMJE       YSSVRIGNEFEVLVL------------------DQICDF-----DGFLIGGANNLLVSPK
MURB_AQUAE       LTTIKIGGRVSFYAEPSDLKEISL-----CIDFSKSRDI-----PLFVLGNGSNTIFGDV
MURB_FUSNN       YSNMRVGGKAKKLIILEPKEE--I-----IDVYNDKENT-----DIFILGNGTNILFTDE
MURB_NOSS1       FTSYRVGGAAELYVAPRNIEALQA-----SLRYAQEHNL-----RVTTLGAGSNLLVSDR
MURB_THEEB       FTTLNVGGCAEWLVEPRTIPELQA-----AYIWAQEEGL-----PITVLGAGSNLLVSDR
MURB_SYNY3       FTTYRVGGKAEWYAAPRCLEDLVA-----VLDWFQGQDL-----PLTFLGAGSNLLISDQ
MURB_SYNE7       FTSFRVGGLAQFYDEPASVEAIAT-----AWQWARLADF-----PVTFLGAGSNLLISDR
MURB_BACHD       HTTWKIGGPADVFVIPNDIEGLKN-----TMKLIQETGC-----KWRVIGRGSNILVSDK
MURB_BACSU       HTTMKIGGPADVLVIPSSVDAVKD-----IMDVIKKYDV-----KWTVIGRGSNLLVLDE
MURB_CHLMU       FSTFRIGGPARYFKELVSVDEALK-----VFSFLHTSPI-----PYIIIGKGSNCLFHDQ
MURB_CHLTR       FSTFRIGGPARYFKELTSVSEALT-----VFSYLHTHPL-----PYIIIGKGSNCLFDDQ
MURB_CHLPN       YSTFRIGGPANYFKAIHTIEEARE-----VIRFLHSINY-----PFLIIGKGSNCLFDDR
MURB_BORBU       YTTYKIGNISKLFLTPKNIKEAEN-----IFKAAIEEKI-----KLFILGGGSNILVNDE
MURB1_CORGL      ISRWRIGGPAAVFAEPSSINEICA-----LLAFMKNRPE-----PVVVVGGTSNILFDSD
MURB_CLOAB       HTSFKVGGPVDVLVMPEKYEEINR-----IIELCEKYDV-----NYYIIGNGSNLLVRDG
MURB_CLOPE       HIYFRVGGPADILVTPVNEEQVVN-----TLKLCREYNV-----PYFILGNGSNILVKDG
MURB_STRA3       YTYTKVGGPADYLAFPRNRLELSR-----IVKFANSQNI-----PWMVLGNASNIIVRDG
MURB_STRP1       YTYTKVGGPADFLAFPRNHYELSR-----IVAYANKENM-----PWLVLGNASNLIVRDG
MURB_STRP8       YTYTKVGGPADFLAFPRNHYELSR-----IVAYANKENM-----PWLVLGNASNLIVRDG
MURB_STRP3       YTYTKVGGPADFLAFPRNHYELSR-----IVVYANKENM-----PWLVLGNASNLIVRDG
MURB_STRMU       YTYTKVGGPADFLAFPRNRYELAR-----IVKFANQNNL-----PWMVLGNASNLIVRDG
MURB_STRPN       YSYTKVGGEADYLVFPRNRFELAR-----VVKFANQENI-----PWMVLGNASNIIVRDG
MURB_LACLA       YTYTKVGGPADILAFPATIEALTE-----LLVKAKSTDT-----AVTVLGNASNLIVRDG
MURB_LISIN       YTYTKTGGNADVFVMPKTIEETKE-----IVTYCHQNKL-----PLTILGNGSNLIIKDG
MURB_LISMO       YTYTKTGGAADVFVMPKTIEEAQE-----VVAYCHQNKI-----PLTILGNGSNLIIKDG
MURB_STAAM       YTYTKTGGNADFYITPTKNEEVQA-----VVKYAYQNEI-----PVTYLGNGSNIIIREG
MURB_STAAW       YTYTKTGGNADFYITPTKNEEVQA-----VVKYAYQNEI-----PVTYLGNGSNIIIREG
MURB_STAES       YTYTETGGEADFYLSPTKNEEVQA-----IVKFAHENSI-----PVTYLGNGSNIIIREG
MURB_OCEIH       HTYTKLGGKADVYITPESYSEVQD-----IIKLANKEDV-----PFTMLGNGSNLIVKDG
MURB_CALS4       HTSFKIGGPADVLAVPGSRDELIN-----LIAYLRQEKI-----PFFILGNGTNLLVSEK
MURB_THEMA       HTSIKIGGRVKYLVLPNDVFSLER-----AITVLK--DL-----PFQIMGLGTNLLVQDE
MURB_BORPE       AQDLRCFNTLGLASHAPAFVALTEPSQLPALSALAPRFR-----QLVVLGGGSNVVLPA-
MURB_RALSO       HNTFRFEAAARYAAHVRAAQDIAE-----ALTDPRARGL-----PVLVLGGGSNIVLTR-
MURB_PSEAE       YNTFGIDVRARLLAHARDEADVRE-----ALALARERGL-----PLLVIGGGSNLLLTR-
MURB_NEIMA       YNTFGLRAQARAFIALEHADGLRD-----IVRLPEFNRD-----TVLWLGGGSNILLME-
MURB_NEIMB       YNTFGLRAQARAFIALEHADELRD-----IVRLLEFDRD-----TVLWLGGGSNILLMQ-
MURB_XANAC       LNTFHVEATARWLLNVQAPEALPQ-----ALAAPEIAGQ-----PLLVLGSGSNVLLAG-
MURB_XANCP       LNTFHVDATARWLLNIHAPEALPD-----ALAAPQIAGQ-----PLLVLGSGSNVLLAG-
MURB_XYLFA       LNTFHIQAQARWLLEIIHPTALPQ-----ALTHPHIVGL-----PILVLGSGSNVLLAA-
MURB_BUCAI       LNTFAIDVTAKKIIFVKTIQSLID-----ISKICQLSNI-----PYIILGEGSNVLFLE-
MURB_BUCAP       LNTFSINVTAKKIIFVKTIQSLMK-----IWKTCNLSNI-----PYIILGEGSNVLFLE-
MURB_BUCBP       FHTFKINVFAKKIIIVKTIKTLIK-----TWKKCNQENL-----PFLLLGKGSNVLFTK-
MURB_WIGBR       FNTFSISVKAKKIISVYSEIELLQ-----SWQKAS-AKD-----PVLFLGSGSNTLFLE-
MURB_ECOLI       WNTFGIDHNAQHIVCAEDEQQLLN-----AWQYATAEGQ-----PVLILGEGSNVLFLE-
MURB_ECO57       WNTFGIDHNAQHIVCAEDEQQLLN-----AWQHATAEGQ-----PVLILGEGSNVLFLE-
MURB_ECOL6       WNTFGIDHNAQHIVCAEDEQQLLN-----AWQHATAEGQ-----PVLILGEGSNVLFLE-
MURB_SALTI       WNTFGIDHCAKHIVCAENEQQLLS-----AWQQATREGL-----PVMILGEGSNVLFLE-
MURB_SALTY       WNTFGIDHCAKHIVCAENEQQLLS-----AWQQATREGL-----PVMILGEGSNVLFLE-
MURB_YERPE       LNTFALPAYASNVISAGSVETLIA-----AWHESKAKRQ-----PVLLLGEGSNVLFIK-
MURB_HAEIN       FHTFHIQSNAREIIEAHSIEQLQQ-----VWANSKSENL-----PTLFLGQGSNVLFLD-
MURB_PASMU       FHTFSLPVQAQKIIEITDIEQLKQ-----QWAACQTNKL-----PVLLLGQGSNVLFLR-
MURB_VIBCH       YHTFGIEQLAAQLVVAESIDDLKA-----LYCSAEWASL-----PKLIIGKGSNMLFTC-
MURB_VIBVU       YHTFAIEQCSHYLVEVGSVDELVD-----IYANPDFREL-----PKLILGSGSNVLFTQ-
MURB_SHEON       FNTFGVTQSCLSLIEVRSKAELQA-----ICLPLYQSKQ-----PMLVLGGGSNIVFTD-
MURB_MYCLE       LTTLRVGPVAQRVITCASTEQVVD-----VIRQLDAPAGGRGAGPLLIFAGGSNLVIADT
MURB_MYCTU       LTTLRVGPIARRVITCTSAEQVVA-----ALRHLDSAAK-TGADRPLVFAGGSNLVIAEN
MURB2_CORGL      LTTLRIGGKPRSAVRCQTTEALVS-----AIKLLDDASL-----PLLIVGGGSNLVVADG
MURB_STRCO       LTTFRLGGPATRLLTATTDAEVIA-----AVREADDTGT-----PLLLIGGGSNLVIGDK
MURB_LEPIN       LSSFKIGGVCPVIVEPEISSQVSE-----ILHIFSKFDI-----PWKILGGGSNLLISDH
MURB_DEIRA       YTTLGVGGESEMWFVETHEQ------------LAEAMSA-----PYRILGGGSNLVVSDS
                                                                 ..  .* :.   

MURB_AGRFC       GIPGVVVRLSAKGFGSVELAD--E--NRIKAGA----ICPDKHIAAMAMDNGIGGFHFYY
MURB_RHIME       GIPGVVIRLSAKGFGDLELAG--E--NRIKAGA----ICPDKNIAAMALDHGIGGFYFYY
MURB_BRUSU       GVPGFVVRLSAKGFGEVEQVC--D--TQLRAGA----AAPDKRVAAAALEAGLAGFHFYH
MURB_RHILO       GIPGFVIRLSAKGFGEAEIVS--P--IRIKAGA----ATPDKRVAALALEAGIGGFHFYH
MURB_CAUCR       GVDGVVIRL-GKGFNGVEALG--D--NRIKAGS----AVPDAILARKAAEAGIAGLEFYV
MURB_ZYMMO       GVSGVIIRL-PRRFSWVKREE--G--NRLRCGG----STLGMMISKVAAAESLTNLEFMR
MURB_RICCN       GIEGVVIKL-GQNFSNIEFV---D--NHLIVGS----SCLNYNLAKFCQANAISGFEFLV
MURB_RICPR       GIEGVVIKL-GQNFNKIEFL---D--NHLIVGS----SCLNYNLARFCQANAISGFEFLV
MURB_HELPY       AKNLALLGKNYDYI---CDKG--E---CVEIGG----AANASKIFNYFRANDLEGLEFLG
MURB_HELPJ       VKNLALLGKNYDYI---CDKG--E---WVEVGG----AANASKIFNYFRANDLEGLEFLG
MURB_CAMJE       PKNIGILGDGFNFIQ-ILDRN--KDFIHLRIGC----KTKSSKMYRFAKENNLKGFEYLS
MURB_AQUAE       RGLVVNLKNLKGFKV-KEIKG--K--FFVEAFS----GTPLKDLIRFSVKENVKSFYKLL
MURB_FUSNN       YMDKIFVCTKKLNKI-EDLGK--N---LVKVET----GANLKDLTDFMKDKNYTGIESLF
MURB_NOSS1       GISGLVIATRHLRYTHFDHQT--G---QVTIAA----GESIPSLAWEIAKLGWQGFEWAV
MURB_THEEB       GVPGLVISTKHLRYLTTDLET--G---QLTVGA----GYPLPKLAHHTAKLGWRGLEWVV
MURB_SYNY3       GLAGLVLSTRYLRQSKFDEEQ--G---LITVAA----GEPIAKVGWQAAKRGWQGLEWAV
MURB_SYNE7       GLPGLVLNLRRLQGATFDLAT--G---CVEVAA----GEPIPRLAWAAARQGWSGLEWAV
MURB_BACHD       GLRGVTIKLDKGLD-HLEVNG--E---SITVGA----GFPVVKLATVISRQGLAGLEFAA
MURB_BACSU       GIRGVVIKLGAGLD-HLELEG--E---QVTVGG----GYSVVRLATSLSKKGLSGLEFAA
MURB_CHLMU       GFNGLVLYNNIQGQ--TFLSD--T---QIKVLS----GVSFSLLGRQLSSKGFSGLEFAV
MURB_CHLTR       GFDGLVLYNNIQGQ--EFLSD--T---QIKVLS----GSSFALLGKRLSSQGFSGLEFAV
MURB_CHLPN       GFDGFVLYNAIYGK--QFLED--A---RIKAYS----GLSFAALGKATAYNGYSGLEFAA
MURB_BORBU       REIDFPIIYTGYLN-KIEIHE--N---KIVGEC----GADFESLCKIALDNSLSGLEFIY
MURB1_CORGL      GFGGLVIKLGENFS-NFIIEG--S---RIRAQA----GASVPQLVRAVATEGLEGIVHAG
MURB_CLOAB       GLRGVAIKLLKLNK--LQIGN--N---KIIAGC----GVPLGYLSRKARDKSLTGLEFAC
MURB_CLOPE       GISGVVIKFNKLNK--ITTEG--N---CVTAQS----GALLKDVSKAALENNLRGFEFAC
MURB_STRA3       GIRGFVIMFDKLST--VTVNG--Y---VIEAEA----GANLIETTRIARYHSLTGFEFAC
MURB_STRP1       GIRGFVIMFDKLNA--VHLNG--Y---TLEAEA----GANLIETTKIAKFHSLTGFEFAC
MURB_STRP8       GIRGFVIMFDKLNA--VHLNG--Y---TLEAEA----GANLIETTKIAKFHSLTGFEFAC
MURB_STRP3       GIRGFVIMFDKLNA--VHLNG--Y---TLEAEA----GANLIETTKIAKFHSLTGFEFAC
MURB_STRMU       GIRGFVIMFDKLNA--VTVDG--Y---VIEAEA----GSNLIETTKVAQYHSLTGFEFAC
MURB_STRPN       GIRGFVILCDKLNN--VSVDG--Y---TIEAEA----GANLIETTRIALRHSLTGFEFAC
MURB_LACLA       GIRGLVILLEKLES--VKVAG--Y---TIEAQA----GAKLKEVTQVAQANSLTGFEFAC
MURB_LISIN       GIRGVIVHLDLLQS--IERKN--T---QIIAMS----GAKLIDTAKFALDESLSGLEFAC
MURB_LISMO       GIRGVILHLDLLQT--IERNN--T---QIVAMS----GAKLIDTAKFALNESLSGLEFAC
MURB_STAAM       GIRGIVISLLSLDH--IDVSD--D---AIIAGS----GAAIIDVSRVARDYALTGLEFAC
MURB_STAAW       GIRGIVISLLSLDH--IEVSD--D---AIIAGS----GAAIIDVSRVARDYALTGLEFAC
MURB_STAES       GIRGIVLSLLSLNH--IETSD--D---AIIAGS----GAAIIDVSNVARDHVLTGLEFAC
MURB_OCEIH       GIRGIVMNLQKLAS--IWREE--D---KIIAQS----GARIIDASRTALAESLAGLEFAC
MURB_CALS4       GIRGVVVKLSSLRN--VIVEG--T---KIIAEA----GASLSYIANVALVHELTGFEFAS
MURB_THEMA       DLDIAVLKTERLNQ--IEIKG--E---KVLVES----GTPLKRLCLFLMEAELGGLEFAY
MURB_BORPE       SIDGLVAQVRLPGVRLVGQCA--D--AWVVE---AAAGENWHGFVTACVDNGWDGLENLA
MURB_RALSO       DFDGLVLLMEIPGVQVGRATL--D--GRAVHTVTAGAGESWHGLVARTVADGLPGLENLA
MURB_PSEAE       DVEALVLRMASQGRRIVSDAA--D--SVLVE---AEAGEAWDPFVQWSLERGLAGLENLS
MURB_NEIMA       DYAGLVVHMENKGIREIARSD--G--MVLIE---AQAGEIWHDFVLHAVALGLNGLENLS
MURB_NEIMB       DYAGLVVHMENKGIREIARSD--G--MVLIE---AQAGEIWHDFVLHTVALGLSGLENLS
MURB_XANAC       DPPGCVLCFDNRETSIIAHRA--D--HAIVR---AGAGVNWHALVLYALQQGLSGLENLA
MURB_XANCP       DPPGCVLCFDNRDITIIAHHA--D--HAIVR---AGAGVNWHGLVMYSLQQGLSGLENLA
MURB_XYLFA       NPEECVLRFVNREVTILEHRI--N--HALVR---AGAGMAWHDLVLWSLQQGLSGLENLA
MURB_BUCAI       NYVGVVIINRIKGIKIVEKKN--F--WLLHVF----SGEKWHNLVKLTLNLGILGLENLA
MURB_BUCAP       NYAGVVIINRIKGIRIEEKKK--N--WLLHVF----SGEKWHDLVKYTLRMGFFGLENLA
MURB_BUCBP       NYNGFVVVNRISGITIHEQKD--Y--WLLHVK----GGTKWNNLVKYTIQKKIYGLENLA
MURB_WIGBR       NYQGTIILNRIKGFHVKENNF--F--WNIHVC----SGELWHNIVTICVNKGISGLENLS
MURB_ECOLI       DYRGTVIINRIKGIEIHDEPD--A--WYLHVG----AGENWHRLVKYTLQEGMPGLENLA
MURB_ECO57       DYRGTVIINRIKGIEIHDEPD--A--WYLHVG----AGENWHRLVKYTLQEGMPGLENLA
MURB_ECOL6       DYRGTVIINRIKGIEIHDEPD--A--WYLHVG----AGENWHRLVKYTLQEGMPGLENLA
MURB_SALTI       NYAGTVILNRLKGIEVNETAD--A--WHLHVG----AGENWHQLVRYALDNNMPGLENLA
MURB_SALTY       NYAGTVILNRLKGIEVNETAD--A--WHLHVG----AGENWHQLVRYALDNNMPGLENLA
MURB_YERPE       NFSGTVLLNRIMGITSTEDSA--A--WYLHVG----AGENWHQLVCHSLQNNMPGLENLA
MURB_HAEIN       DFNGIVILNRLMGITHEQDAN--F--HYLHVN----GGENWHKLVEWSINNGIYGLENLA
MURB_PASMU       DFQGVVLLNRLMGIQHTQDAD--F--HYLHVN----GGENWHQLVAWSIQQGIFGLENLA
MURB_VIBCH       HYTGMIVVNRLNGIEHQQDDD--Y--HRLHVA----GGEDWPSLVSWCVEQGIGGLENLA
MURB_VIBVU       PFSGVVVVNRLSGKTLSEDES--F--YYIHAE----GGEDWPNLVEWCVQQGIGGLENLA
MURB_SHEON       DFNGTVVRVLSKGISVTEDVS--Y--FYLEIE----AGENWHELVEFTLNNHMAGLENLA
MURB_MYCLE       LADLTAVRLANAGITID--GN--L--VRAEA------GAVWDDVVVRAIEHGLGGLECLS
MURB_MYCTU       LTDLTVVRLANSGITID--GN--L--VRAEA------GAVFDDVVVRAIEQGLGGLECLS
MURB2_CORGL      DLDVIAVIIETDDVSINLTDG--L--LTADA------GAVWDDVVHLSVDAGLGGIECLS
MURB_STRCO       GFDGTALHIATRGFRLD--GT--T--LELAA------GEIWTDAVARTVEAGLAGVECLA
MURB_LEPIN       PDNFVTLRLSGKFKEFVSLGD--G---KFKIGA----ATNTTPTFRQISQLGYTGAEFLS
MURB_DEIRA       GVPERVLRLSGPLAERDLTPDPELSTPDLIVTGWVGGGVPLPGLIRALQKLGWSGLEGTV
                                                                       .     

MURB_AGRFC       GIPGSIGGALRMNAGANGGETRERVVEVYAVDR-QGNQHVLSNADMGYSYRHSGADAG--
MURB_RHIME       GIPGSIGGALRMNAGANSGETSERVVEVHAVDR-KGNRHVLSKAEMGYGYRHSGAAKE--
MURB_BRUSU       GIPGGVGGALRMNAGANGVETRERVVEVRALDR-KGEVHVLSNADMGYAYRHSSASPD--
MURB_RHILO       GIPGAIGGALRMNAGANGVETRERVVEVRALDR-KGNVQTMSNAEMGYAYRHSAAPVG--
MURB_CAUCR       GVPGTIGGAVIMNAGCYGAETVNVVKSVRVMNR-AGVVRELSVEDLHYTYRHSALQDGE-
MURB_ZYMMO       GIPGSIGGMIRMNAGAYGGDISKILIQVTLVRR-NGDIEIWPVEKLNFAYRYSELPED--
MURB_RICCN       GIPGTIGGGVAMNAGAYGSEFKDIVVQIEAIDF-AGNFLTFTNEEIGFKYRSNNLPKN--
MURB_RICPR       GIPGTIGGGVIMNAGAYGSAFQDIIVQVEALDF-SGNFLTFTNKEIGFKYRGNNLPKD--
MURB_HELPY       QLPGTLGALVKMNAGMKEFEIKNVLESACINN------QWLEKEALGLGYRSS---GF--
MURB_HELPJ       QLPGTLGALVKMNAGMKEFEIKNVLESACVNG------EWLEKEALGLDYRSS---GF--
MURB_CAMJE       KIPGTLGGLLKMNAGLKGECISQNLIKIATSQ------GEILRANINFDYRFC---PL--
MURB_AQUAE       GFPASVGGAVSMNAGAFGVEISDFLKEVYFVDW-EGKLQKAKRDELNFSYRKSPF-PK--
MURB_FUSNN       GIPGSIGGLVYMNGGAFGTEIFDKIVSIEVFDE-NHQIREIKKEDLKVAYRKTEIQDK--
MURB_NOSS1       GIPGTVGGAVVMNAGAHNSCIADILVSAQVLSP-DGTVETLTPEELGYAYRTSLLQGS--
MURB_THEEB       GIPGTVGGAVVMNAGAHGSCTAQRLVSAVILEP-DGTLAVVAARELGYAYRTSNLQET--
MURB_SYNY3       GIPGTVGGAVVMNAGAHNQCTAETLVEATVMRP-DGGLEVLTNEQLGFSYRTSNLQKHLG
MURB_SYNE7       GIPGTLGGAVVMNAGAQGGCMADILQSVQVIT--DQGLETWSREQLQYDYRHSVLQTG--
MURB_BACHD       GIPGSVGGAVFMNAGAHGSDISQILTKAHVLFP-DGTLRWLTNEEMAFSYRTSLLQKN--
MURB_BACSU       GIPGSVGGAVYMNAGAHGSDMSEILVKAHILFE-DGTIEWLTNEQMDFSYRTSVLQKKR-
MURB_CHLMU       GIPGTVGGAVFMNAGTALANTASSLVSVEIIDH-AGNLLSLSREELLFSYRTSPFQKK--
MURB_CHLTR       GIPGTVGGAVFMNAGTTLANTAFSLINVEIIDH-SGILLSIPREKLLFSYRTSPFQKK--
MURB_CHLPN       GIPGSVGGAIFMNAGTNESDISSVVRNVETINS-EGELCSYSVEELELSYRSSRFHRQ--
MURB_BORBU       GLPGTLGGAVWMNARCFGNEISEILKKITFIDD-KGKTICKEFKKEDFKYKISPFQNK--
MURB1_CORGL      GIPGTVGGLVVMNGGTQRRGIGEHVTKVLVTDA-EGSIRELNANELQFTYRNSVLKNS--
MURB_CLOAB       GIPGSVGGAVAMNAGAYNGEISNVVESVLVIDN-KGKMKRLYRDELQFGYRSSAILKH--
MURB_CLOPE       GIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDE-NCNIKNLTKEELELGYRSSIVMKK--
MURB_STRA3       GIPGSVGGAVFMNAGAYGGEIAHILLSAQVLTP-QGELKTIEARNMQFGYRHSVIQES--
MURB_STRP1       GIPGSIGGAVFMNAGAYGGEISHIFLSAKVLTP-SGEIKTISARDMAFGYRHSAIQET--
MURB_STRP8       GIPGSIGGAVFMNAGAYGGEISHIFLSAKVLTP-SGEIKTISARDMAFGYRHSAIQET--
MURB_STRP3       GIPGSIGGAVFMNAGAYGGEISHIFLSAKVLTS-SGEIKTISARDMAFGYRHSAIQET--
MURB_STRMU       GIPGSIGGAVFMNAGAYGGEISHILISAQVLTR-DGEIKTIEARDMRFGYRHSVLQDN--
MURB_STRPN       GIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTK-DGEIETLSAKDLAFGYRHSAIQES--
MURB_LACLA       GIPGSIGGAVFMNAGAYGGEISQVLVSCKVMDT-DGNISVLTASEMQFGYRHSVIRDK--
MURB_LISIN       GIPGSIGGALHMNAGAYGGEISDVLEAATVLTQ-SGELKKLKRSELKAAYRFSTIAEK--
MURB_LISMO       GIPGSIGGALHMNAGAYGGEISDVLEAATVLTQ-TGELKKLKRSELKAAYRFSTIAEK--
MURB_STAAM       GIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNE-QGSLIKLTTKELELDYRNSIIQKE--
MURB_STAAW       GIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNE-QGSLIKLTTKELELDYRNSIIQKE--
MURB_STAES       GIPGSIGGAVFMNAGAYGGEVKDCIDYALCVNE-KGDLLKLTTAELELDYRNSVVQQK--
MURB_OCEIH       GIPGSVGGALYMNAGAYGGEIKDVLESTIVVTK-EGDIRTLTAVELDLDYRTSNIPDK--
MURB_CALS4       GIPGTLGGAIVMNAGAYGSEMKDVVEKVEVLDE-NNNILILSNQEMKFSYRYSILQEK--
MURB_THEMA       GIPGSVGGAIYMNAGAYGGEIGEFVEAVEVLR--DGEKTWLSRNEIFFGYRDSTFKRE--
MURB_BORPE       LIPGTVGAAPVQNIGAYGVELADRFHSLTAWDVKGGRWVEMGAAECRFAYRDSFFKHQEP
MURB_RALSO       LIPGTVGAAPIQNIGAYGVEIKDRFHSLRAYDRHAGEFVTLDAADCAFGYRDSLFKRAGA
MURB_PSEAE       LIPGTVGAAPMQNIGAYGVELKDVFDSLTALDRQDGTLREFDRQACRFGYRDSLFKQ-EP
MURB_NEIMA       LIPGTVGASPVQNIGAYGVEAKDVIHSVRCFDLDTETFVTLSNADCRFAYRESLFKQEGK
MURB_NEIMB       LIPGTVGASPVQNIGAYGVEAKDVIHSVRCFDLDTETFVELANADCRFAYRESLFKQEGK
MURB_XANAC       LIPGTVGACPIQNIGAYGAQVGDFIHVVEAFDRHSQQFVRLDAADCAFGYRDSVFKQ-QP
MURB_XANCP       LIPGTVGACPIQNIGAYGAQVSDFIHVVEAYDRGTEQFVRLNPAECAFGYRDSVFKQ-QP
MURB_XYLFA       LIPGTVGACSIQNIGAYGVQVEEFVHIVEAYDQTEGQFVRLTASECEFAYRNSRFKR-EP
MURB_BUCAI       LIPGCIGSAAIQNIGAYGLEFKDVCQYVDILSLKDNTIKRIYKNSCKFSYRNSIFKDQYK
MURB_BUCAP       LIPGSVGSAAIQNIGAYGLELKNICQYVDVISLENGKTIRLKKKTCNFSYRSSIFKYKYN
MURB_BUCBP       LIPGTVGAAPIQNIGAYGVEFKDVCQYVDVLYLNNSKIVRINSNNCLFGYRDSIFKKKHN
MURB_WIGBR       WIPGYTGAAPIQNIGAYGVEFKQVCSYVDFIFLETGEKVRLSSQECNFGYRKSIFNSSKK
MURB_ECOLI       LIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQ
MURB_ECO57       LIPGCVGSSPIQNIGAYGVELQRVCAYVDCVELATGKQVRLTAKECRFGYRDSIFKHEYQ
MURB_ECOL6       LIPGCIGSSPIQNIGAYGVELQRVCAYVDCVELATGKQVRLTAKECRFGYRDSIFKHEYQ
MURB_SALTI       LIPGCVGSSPIQNIGAYGVELHRVCDYVDCVELETGKRLRLSAAECRFGYRDSIFKNEYQ
MURB_SALTY       LIPGCVGSSPIQNIGAYGVELQRVCDYVDCVELETGKRLRLSAAECRFGYRDSIFKNEYQ
MURB_YERPE       LIPGCVGSAPIQNIGAYGVELKQVCEYVDLLDMDKGTIQRISAEECQFGYRDSIFKHRYG
MURB_HAEIN       LIPGCAGSAPIQNIGAYGVEFKDVCDYVEVLNLNTNETFRLDTEQCEFGYRESIFKHRYQ
MURB_PASMU       LIPGCAGSAPIQNIGAYGVEFKDVCDYVEVLNLHTNEIFRLSNEQCQFGYRDSIFKHAYA
MURB_VIBCH       LIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCLETGTVKRLTMEECQFGYRDSIFKHQLY
MURB_VIBVU       LIPGCAGSAPIQNIGAYGVEFKDVCQYVDILMLDDFSQRRLSAEECQFGYRDSVFKHALY
MURB_SHEON       LIPGTVGAAPIQNIGAYGVELCDICHWVEYLDLDSGLLLRLSVDECEFSYRESIFKGRLR
MURB_MYCLE       GIPGSAGATPVQNVGAYGAEVSDTITRVRLLERSSGSVRWVSACELRFGYRTSVFKQADP
MURB_MYCTU       GIPGSAGATPVQNVGAYGAEVSDTITRVRLLDRCTGEVRWVSARDLRFGYRTSVLKHAD-
MURB2_CORGL      GIPGSAGATPVQNVGAYGTEVSDVLTRVQLLDRTTHQVSWVDASELDLSYRYSNLKFTN-
MURB_STRCO       GIPGSAGATPIQNVGAYGQEVSATITEVTAYDRRSGETVALSNADCAFSYRHSRFKAEP-
MURB_LEPIN       TIPGWTGGAVIQNAGCYGGELFDLIESVEFLR--NGEMFVRKPSEIKYGYRFTEFLNQKD
MURB_DEIRA       GIPGQVGGSVWMNAGTRFGEMFDGLHTIEIVTP--DGVRQVTPDDLKWGYRQSGIPRG--
                  .*.  *.    *                                    *:         

MURB_AGRFC       ------LIFTGALFEGY------------------PE------DKAKIRADMDAVRHHRE
MURB_RHIME       ------LIFTHAIFEGY------------------AE------DKTKIRTDMDAVRQHRE
MURB_BRUSU       ------LIFTSVLFEGV------------------PG------ERDDIRRAMDEVQHHRE
MURB_RHILO       ------LIFTSAVFEGF------------------AE------DKATIKAAMDAVQNHRE
MURB_CAUCR       P-----VIVLDAIFEGT------------------PD------EPEAIKARMAEITARRE
MURB_ZYMMO       ------AIVTEALFQGQ------------------PG------DKDKIEAQMNKIIAERE
MURB_RICCN       ------LIILKAVFKIN------------------KG------DSENILLRMNEIKNARS
MURB_RICPR       ------LILLKAVFKVN------------------KG------DSQNILLKMNKINNTRS
MURB_HELPY       S-----GVVLRARFKKT------------------HG-------FREGVLKACQSMRKSH
MURB_HELPJ       N-----GVVLRARFKKT------------------HG-------FREGVLKACKSMRKSH
MURB_CAMJE       N-----THFFWAEFKLN------------------FG-------FDTLKDEALKNARSNQ
MURB_AQUAE       L-----GIVFKVVFEFE------------------RS-------KENILPKYEKIRRIRK
MURB_FUSNN       N-----WLVLSATFKFD------------------NG-------FDAARVKEIKELRESK
MURB_NOSS1       N-----RVVTQATFQLQ------------------PGF-----DPAYVTATTKQHKQMRL
MURB_THEEB       Q-----RLVLQATWQLE------------------PGH-----DPAQVKAETQKHLSDRL
MURB_SYNY3       D-----RLVVDATFKLT------------------PGF-----TREEIMGCTTRNLHQRK
MURB_SYNE7       H-----ACVVSAQLQLQ------------------PGF-----ERSQVLTTTSTNFRQRK
MURB_BACHD       D-----GICVEAIFSLT------------------RG------DKEDIKKKLQKNKDYRR
MURB_BACSU       P-----GVCLEAVLQLE------------------QK------DKESIVQQMQSNKDYRK
MURB_CHLMU       T-----AFIVSATFQLT------------------RD--------SQAAQRAKALIEERI
MURB_CHLTR       P-----AFIASATFQLT------------------KD--------PQAAKRAKALIEERI
MURB_CHLPN       Q-----EFILSATLQLS------------------KK--------QVSADHSKSILQHRL
MURB_BORBU       N-----FFILKIELNLK------------------KD------NKKIIEEKMNKNKQARI
MURB1_CORGL      E-----TTVLEVELLLK------------------PG------NAGELLAELETILDQRS
MURB_CLOAB       K-----YIALEVTFTLQ------------------KG------DREKIANRIDDLMRRRI
MURB_CLOPE       G-----YVVIEATVELE------------------SG------EYASIKDKIDDLTNRRE
MURB_STRA3       G-----DIVISAKFALK------------------PG------DHLMITQEMDRLTYLRE
MURB_STRP1       G-----DIVISAKFALK------------------PG------NYDTISQEMNRLNHLRQ
MURB_STRP8       G-----DIVISAKFALK------------------PG------NYDTISQEMNRLNHLRQ
MURB_STRP3       G-----DIVISAKFALK------------------PG------NYDTISQEMNRLNHLRQ
MURB_STRMU       Q-----EVVVSAKFSLK------------------PG------DYTIISQEMQRLNHLRA
MURB_STRPN       G-----AVVLSVKFALA------------------PG------THQVIKQEMDRLTHLRE
MURB_LACLA       N-----LVVLSAKFELQ------------------AG------DPTQIQNEMNRLNFLRE
MURB_LISIN       K-----YIVLDATFSLE------------------LE------DKNIIQAKMDELTALRE
MURB_LISMO       N-----YIVLDATFSLA------------------LE------EKNLIQAKMDELTAARE
MURB_STAAM       H-----LVVLEAAFTLA------------------PG------KMTEIQAKMDDLTERRE
MURB_STAAW       H-----LVVLEAAFTLA------------------PG------KMTEIQAKMDDLTERRE
MURB_STAES       H-----LVVLEAAFTLE------------------PG------KLDEIQAKMDDLTERRE
MURB_OCEIH       G-----YIVLEATFALK------------------KA------NSSDIKEVMDDLTYKRE
MURB_CALS4       E-----WIVLRAWISLE------------------RG------NYEEIKKKMEELNQRRK
MURB_THEMA       K-----LIITRVMMSFK------------------KE------KKETIKAKMDDYMRRRL
MURB_BORPE       G----AWVIGSVRFALP--RPWQPVLDYPDLQRH-AALD-GA--APTARAVYDAVCAIRR
MURB_RALSO       D----RYVIAEVTFALP--VDWQPDTHYAELARELAARD-IA--APAAQDIFDAVVAIRR
MURB_PSEAE       D----RWLILRVRLRLT--RRERLHLDYGPVRQRLEEEG-IA--SPTARDVSRVICAIRR
MURB_NEIMA       G----RYVIVSVVFALK--THFVPNLGYGDLAAAVAELSAGR--VPTAKDVSDAVCAIRN
MURB_NEIMB       G----RYVIVSVVFALK--THFVPTLGYGDLAAAVAELSAGR--VPTAKDVSDAVCAIRN
MURB_XANAC       E----RYLIVAVEFNLP--LLHELRLDYAGIREELASMG-AE--LAGAADVAQAVINIRR
MURB_XANCP       D----RYLIVAVEFNLP--LLHELRLDYAGIRDELARMG-AE--LAGAADVAQAVINIRQ
MURB_XYLFA       N----RYLIAAVEFRLP--LLHELKLNYAGISEELEALQ-IT--LPEPRDVAQAVINLRR
MURB_BUCAI       N----EHAVIRVGIKLS--KKWRPILFSSLENYITPI-------NITAYKIFNIICKIRK
MURB_BUCAP       N----GYAVIAVGIKIK--KNWKPVIFSSLLKSKKIL-------EINAYKIFNIVCQIRK
MURB_BUCBP       P----NSIILSVGIKLP--KTWKPKISHLELQKLSFK-------NITSHQIFHYICKLRK
MURB_WIGBR       FF---NYAIVAIGLKLK--KKWKACLNYTDLSFLEKE-------YVSPKKIYNKIFYIRK
MURB_ECOLI       D----RFAIVAVGLRLP--KEWQPVLTYGDLTRLDPT-------TVTPQQVFNAVCHMRT
MURB_ECO57       D----RFAIVAVGLRLP--KEWQPVLTYGDLTRLDPT-------TVTPQQVFDAVCHMRT
MURB_ECOL6       D----RFAIVAVGLRLP--KEWQPVLTYGDLTRLDPS-------TVTPQQVFDAVCHMRT
MURB_SALTI       D----RVAIVAVGLRLS--KQWQPVLTYGDLTRLDPK-------TVTAQQVFDAVCHMRT
MURB_SALTY       D----RVAIVAVGLRLS--KQWQPVLTYGDLTCLDPK-------TVTAQQVFDAVCHMRT
MURB_YERPE       N----GFAIVSVGIKLM--KSWTPTLGYGDLIHMDPL-------TVTATDIFNSVCTMRR
MURB_HAEIN       Q----GYVITAVGLKLK--KDWQPILKYGSLVEFDPK-------TVTAKQIFDEVCHIRQ
MURB_PASMU       T----GYVIIAVGLKLS--KNWIPVLKYGSLANLEKS-------AVNAQQIFDEVCAIRR
MURB_VIBCH       Q----KAVVTAVGLKFA--KAWQPIIQYGPLKDLSS--------DCAIHDVYQRVCATRM
MURB_VIBVU       N----QCVVIAVGLKLP--KTWQANNSYGPLQEIAEH-------ELSPMSIFHKVCEVRR
MURB_SHEON       D----KAVITAVGLRLP--KTWQPRLAYGPLQSFAAD-------TVTPRDIFERVCEVRS
MURB_MYCLE       SGSQPPAVVLEVEFKLD-ASGQSAPLHYGELVATLDATSGQ---RANPHAVREAVLALRV
MURB_MYCTU       -GLAVPTVVLEVEFALD-PSGRSAPLRYGELIAALNATSGE---RADPQAVREAVLALRA
MURB2_CORGL      -R----AVVLAIELQLL-TDGLSAPLRFGELGRRLAISEAEPHPRRPVRMVRDAVLELRR
MURB_STRCO       ER----YVVLRVRFELENADGLSAPLRYAETARALGVEAGD---RVPLTAARETVLRLRA
MURB_LEPIN       S------IILGIEILLK------------------EG------NLEEIESSLKDKRDRRN
MURB_DEIRA       ------HVVSRVRLKLR---------------------------PSTPEAVLAKMEHADQ
                                                                             

MURB_AGRFC       TVQ------PIREQTGGSTFKNP-EGHSA-------------------------------
MURB_RHIME       TVQ------PIREKTGGSTFKNP-DGHSA-------------------------------
MURB_BRUSU       TVQ------PVREKTGGSTFKNP-EGTSA-------------------------------
MURB_RHILO       TVQ------PIREKTGGSTFKNP-EGTSA-------------------------------
MURB_CAUCR       TTQ------PIREKTGGSTFKNP-PGHSS-------------------------------
MURB_ZYMMO       ASQ------PVRSRTGGSTFKNP-EGYKA-------------------------------
MURB_RICCN       STQ------PIKERTGGSTFANP-EGRKS-------------------------------
MURB_RICPR       STQ------PIKERTGGSTFINP-EGRKS-------------------------------
MURB_HELPY       PK----------LPNFGSCFKNP-PNDHA-------------------------------
MURB_HELPJ       PK----------LPNFGSCFKNP-PNDYA-------------------------------
MURB_CAMJE       PS----------GASFGSIFKNP-KNDFA-------------------------------
MURB_AQUAE       EKQ------PINLPTSGSTFKNP-EGNFA-------------------------------
MURB_FUSNN       HPL------D--KPSLGSTFKNP-EGDFA-------------------------------
MURB_NOSS1       TTQ------PYNFPSCGSVFRNP-KPYSA-------------------------------
MURB_THEEB       RTQ------PYGFPNCGSVFRNP-QGWTA-------------------------------
MURB_SYNY3       STQ------PYDKPNCGSVFRNP-TPLYS-------------------------------
MURB_SYNE7       RTQ------PYHLPNCGSVFRNP-EPQKA-------------------------------
MURB_BACHD       DTQ------PWNHPTCGSVFRNP-LPEYA-------------------------------
MURB_BACSU       NTQ------PYSSPCAGSIFRNP-LPNHA-------------------------------
MURB_CHLMU       LKQ------PYEYPSVGCIFRNP-EGVSA-------------------------------
MURB_CHLTR       LKQ------PYEYPSAGCIFRNP-EGLSA-------------------------------
MURB_CHLPN       MTQ------PYTQPSAGCIFRNP-EGTSA-------------------------------
MURB_BORBU       NRG------HYLFPSGGSTFKNN-KAFLK---PS--------------------------
MURB1_CORGL      QKF------PEDLPNCGSTFLSD-PAMYSIVGPP--------------------------
MURB_CLOAB       EKQ------PLEYPSAGSTFKRP-VGHFA-------------------------------
MURB_CLOPE       SKQ------PLEYPSAGSTFKRP-EGYFA-------------------------------
MURB_STRA3       LKQ------PLEYPSCGSVFKRP-PGHFA-------------------------------
MURB_STRP1       LKQ------PLEFPSCGSVFKRP-PGHFA-------------------------------
MURB_STRP8       LKQ------PLEFPSCGSVFKRP-PGHFA-------------------------------
MURB_STRP3       LKQ------PLEFPSCGSVFKRP-PGHFA-------------------------------
MURB_STRMU       LKQ------PLEHPSCGSVFKRP-LGHFA-------------------------------
MURB_STRPN       LKQ------PLEYPSCGSVFKRP-VGHFA-------------------------------
MURB_LACLA       SKQ------PLEYPSCGSVFKRP-VGHFA-------------------------------
MURB_LISIN       AKQ------PLEYPSCGSVFKRP-PGHFA-------------------------------
MURB_LISMO       AKQ------PLEYPSCGSVFKRP-PGHFA-------------------------------
MURB_STAAM       SKQ------PLEYPSCGSVFQRP-PGHFA-------------------------------
MURB_STAAW       SKQ------PLEYPSCGSVFQRP-PGHFA-------------------------------
MURB_STAES       SKQ------PLEFPSCGSVFQRP-PGHFA-------------------------------
MURB_OCEIH       SKQ------PLEYPSCGSVFKRP-PGYFA-------------------------------
MURB_CALS4       EKQ------PLDYPSAGSTFKRP-PGYYA-------------------------------
MURB_THEMA       EKQ------PLDLPSAGSVFKRPREDFYV-------------------------------
MURB_BORPE       AK----LPDPAVVGNAGSFFKNPLVDAGTRQALLGRFPGLVSYP-------QPDGRYKLA
MURB_RALSO       RK----LPDPAEIGNAGSFFKNPIVDTATRDALLARFPGLVGYA-------QPDGSYKLA
MURB_PSEAE       EK----LPDPAVLGNAGSFFKNPLVDATQAERLRQAFPDLVGYP-------QADGRLKLA
MURB_NEIMA       SK----LPNPNVLGNVGSFFKNPVVSAEKAATLLQRHPDMPRYP-------QPDGSVKLA
MURB_NEIMB       SK----LPNPNVLGNVGSFFKNPVVSAEKAATLLQRHPDMPRYP-------QPDGSVKLA
MURB_XANAC       RK----LPDPDVLGNAGSFFKNPLLPSEQIAALQASFADMPVYPG------EHAGQGKLS
MURB_XANCP       RK----LPDPEVLGNAGSFFKNPLLPSEQIAALQASFADMPVFPG------EQPGQGKLS
MURB_XYLFA       RK----LPDPEVLSNAGSFFKNPYLPREQAEQLRQHHPTLPIYPG------ETPESNKLS
MURB_BUCAI       KK----LPDPKKIGNAGSFFKNPLIKKKKAQKLINLY-KVPNYP-------QKNGLVKIS
MURB_BUCAP       KK----LPNLKKLGNAGSFFKNPIITSKKTKKILSSYMKMPYYI-------QKNGFIKIP
MURB_BUCBP       KK----LPNPKKIGNAGSFFKNPIIKKNKAHKIICEYKDLPFYP-------EPHGMIKLS
MURB_WIGBR       EK----IPNPVYFGNAGSFFKNPLISSKQAKKILKNYPKAPCFK-------QLNGNVKFS
MURB_ECOLI       TK----LPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYP-------QADGSVKLA
MURB_ECO57       TK----LPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYP-------QADGSVKLA
MURB_ECOL6       TK----LPDPKVNGNAGSFFKNPVVSAETANALLAQFPTAPHYP-------QVDGSVKLA
MURB_SALTI       TK----LPDPKVNGNAGSFFKNPVVAADIAMELLERFPNAPHYP-------QADGSVKLA
MURB_SALTY       TK----LPDPKVNGNAGSFFKNPVVAADIAMELLERFPNAPHYP-------QADGSVKLA
MURB_YERPE       SK----LPDPMVTGNAGSFFKNPVVSAAIAEEIVHCYPNAPHYL-------QPDGSVKLA
MURB_HAEIN       SK----LPDPNEVGNAGSFFKNPVVSSEHFEEIKKHHENLPHFP-------QADGSVKLA
MURB_PASMU       SK----LPDPAEFGNAGSFFKNPVISKVDFDHLQQEYPDIPHFP-------QADGRVKLA
MURB_VIBCH       EK----LPDPAVMGNAGSFFKNPVISQQAFARLQIEHPDVVAYP--------AEQGVKVA
MURB_VIBVU       EK----LPDPKQIGNAGSFFKNPIIDKAHWQQLKAQFPNIVAYP--------AGEQMKVA
MURB_SHEON       EK----LPDPHILGNAGSFFKNPIISAAAYVELAQRFPNIVGYA-------QANGDVKLA
MURB_MYCLE       RKGMVLDAADHDTWSVGSFFTNPVVAPDVYRQLA----KMVDGPV--PHYPAQDG-VKLA
MURB_MYCTU       RKGMVLDPTDHDTWSVGSFFTNPVVTQDVYERLAGDAATRKDGPV--PHYPAPDG-VKLA
MURB2_CORGL      AKGMVVEHTDHDTWSAGSFFTNPIVDPALADAVF---EKVGEPTM--PRFPAGDGKEKLS
MURB_STRCO       GKGMVLDPEDHDTWSAGSFFTNPILTDEEFAAFRSRVAGRLGAAVEPPAFPAGEGRVKTS
MURB_LEPIN       SSQ------PENKKSAGSVFKNPKVFREDGKE--------------------------IK
MURB_DEIRA       ARK-----GQPKNKTPGCAFKNP-GGVSA-------------------------------
                                 *. *                                        

MURB_AGRFC       -WELIDEAGGRGLVIG----GAQMSSLHCNFMINTGH-ATGYDLEYLGETIRRRVFEKSG
MURB_RHIME       -WKLIDEAGCRGMMIG----NAQMSPLHCNFMINTGQ-ATGYELEYLGETVRQRVMEHSG
MURB_BRUSU       -WKEIDKAGCRGLRVG----GAQMSEMHCNFMINTGN-ATGHDLETLGETVRARVFENSG
MURB_RHILO       -WKEIDKAGCRGLMIG----GAQMSPMHCNFMINTGT-ATGYDLEYLGETVRARVLEHSG
MURB_CAUCR       -WKLVDEAGWRGKPYG----GAMFSPLHSNFLINTGE-ATAADLEGLGEAVRADVLAKTG
MURB_ZYMMO       -WELIDEAGCRGLKIG----DAEVSTKHANFLLNLGD-ATAADIENLGEEVRARVKAKFG
MURB_RICCN       -WELIDKAGLRGYRIG----GASMSEFHCNFMINNGD-ATAKDLEDLGDFVRQKVCEDSG
MURB_RICPR       -WELIDKAGLRGYRIG----GASISELHCNFMINNGN-ATAKDLEDLGNFVRQKVFEDSG
MURB_HELPY       -GRLLEGVGLRGYCLK----RVGFAKEHANFLVNLGG-AEFEEALDLIELAKARVLQEYG
MURB_HELPJ       -GRLLEGVGLRGYCLK----RVGFAKEHANFLVNLGG-AEFEEALDLIELAKTRVLQEYG
MURB_CAMJE       -GRLIEAVGLKGFSKG----DAMLSDKHANFLINKKN-ASFEDAFFLIELARKKVFEEFG
MURB_AQUAE       -GKLLEKAGLKGFRLK----NVGFSEKHANFLVNYGG-GTFSEVVDLINIAKERVYENFG
MURB_FUSNN       -ARLISECGLKGTIIG----NAQIAEKHPNFVLNLGN-ATFKDIIDILTLVKKSVLEKFG
MURB_NOSS1       -GWLIEQSGLKGYQIG----GAQVAHLHANFIVNRGG-AKANDIFCLIRHIQQEVQERWS
MURB_THEEB       -GWLIEQTGLKGYQIG----HAQVSEKHANFILNCGG-ATAMDVYHLIRYVQTAVADRWA
MURB_SYNY3       -ARLIEELGLKGYRIG----GAEVSQRHANFIVNIDN-AKAQDVFNLIFHVQGEVEKHYG
MURB_SYNE7       -GQLIEACGLKGYQIG----DAQVSELHANFILNCGA-ARAQDILSLIRHVQGTVGDHFG
MURB_BACHD       -GQLIEKAGLKGYQIG----GAQISTMHANFIVNTGD-AKAADVLALIHHVKDTIQKQYQ
MURB_BACSU       -GNLVEKAGLKGYQIG----GAKISEMHGNFIVNAGG-ASAKDVLDLIDHVKKTIREKYE
MURB_CHLMU       -GALIDQAGLKGLTIG----GGQISQKHGNFIINTGN-ASAADVLELIETIQKTLKQQ-G
MURB_CHLTR       -GALIDRAGLKGLKIG----GGQISEKHGNFIINTGN-ACTADILELIEIIQKTLKKQ-G
MURB_CHLPN       -GKLIDAAGLKGLAIG----GAQISPLHANFIINTGK-ATSDEVKQLIAIIQSTLKTQ-G
MURB_BORBU       -GQIIEECKLKGLSIG----GATVSKYHGNFIININN-ATSKDIKSLIEKVKAEVYLKTG
MURB1_CORGL      -GKAIEDAGLKGLRRG----SAEISMQHANFIVNHGD-ASDDDILWLISAVRKEVYSRTG
MURB_CLOAB       -AKLIEDSGLKGKGIG----GAQVSDKHSGFIINKND-ATAKDILDLIKFVQNTVKSKFN
MURB_CLOPE       -GKLIQDSGLKGFSIG----GAAVSEKHSGFVINKGG-ATAKDVLDVIAHVQKTVKENFD
MURB_STRA3       -GQLISEAHLKGQRIG----GVEVSQKHAGFMVNIAE-GSAQDYENLIEHVINTVESTSG
MURB_STRP1       -GQLIMEANLKGHRIG----GVEVSEKHTGFMINVAD-GTAKDYEDLIAYVIETVENHSG
MURB_STRP8       -GQLIMEANLKGHRIG----GVEVSEKHAGFMINVAD-GTAKDYEDLIAYVIETVENHSG
MURB_STRP3       -GQLIMEANLKGHRIG----GVEVSEKHAGFMINVAD-GTAKDYEDLIAYVIETVENHSG
MURB_STRMU       -GQLIMEAQLMGHRIG----GVEVSTKHAGFMVNVAN-GSAKNYEDLIADVIHRVKENSG
MURB_STRPN       -GQLISEAGLKGYRIG----GVEVSEKHAGFMINVAD-GTAKDYEDLIQSVIEKVKEHSG
MURB_LACLA       -GQLIQEANLQGVRIG----GVEVSKKHAGFMVNVAN-GNATDYEKLIAHVIDKVKENSG
MURB_LISIN       -GKLIQDSGLQGHIIG----GAQVSLKHAGFIVNIGG-ATATDYMNLIAHVQQTVREKFD
MURB_LISMO       -GKLIQDSGLQGHIIG----GAQVSLKHAGFIVNIGG-ATATDYMNLIAYVQQTVREKFD
MURB_STAAM       -GKLIQDSNLQGHRIG----GVEVSTKHAGFMVNVDN-GTATDYENLIHYVQKTVKEKFG
MURB_STAAW       -GKLIQDSNLQGHRIG----GVEVSTKHAGFMVNVDN-GTATDYENLIHYVQKTVKEKFG
MURB_STAES       -GKLIQDSNLQGYRIG----GVEVSTKHAGFMVNVDN-GTATDYEALIHHVQKIVKEKFD
MURB_OCEIH       -GKLIQDSELQGTQIG----GAEVSKKHAGFIVNKNN-ASATEYINLIRHVQKTVSEKFG
MURB_CALS4       -GKLIEDAGLKGYSIG----GAKVSEKHSGFIINTGN-ATFYDVLNLIEYIQKVVKEKFG
MURB_THEMA       -GKAIESLGLKGYRIG----GAQISEKHAGFIVNAGS-ATFDDVMKLIDFVRKKVKEKYG
MURB_BORPE       AGWLIDQCGWKGRQLG----AAGVHDRQALVLVNRGG-AQARDIMALAAAIQGDVERRYG
MURB_RALSO       AGWMIDQCGFKGRQSG----AVGVYDKQALVLVHRGG-GSAVQLMTLAREIQDTVHARFG
MURB_PSEAE       AGWLIDKGGWKGFRDG----PVGVHAQQALVLVNHGG-ATGAQVRALAERIQEDVRRRFG
MURB_NEIMA       AGWLIDQCRLKGFQIG----GAAVHDRQALVLVNKNN-ASANDVRQLAQHIKFTVFARFQ
MURB_NEIMB       AGWLIDQCRLKGFQIG----GAAVHDRQALVLVNKNN-ASANDVRQLAQHIKFTVFARFQ
MURB_XANAC       AAWLIEQCGWKGKREG----DAGVSPDHALVLVNYGT-ATGAQLLDFARRIAESVRERYS
MURB_XANCP       AAWLIEQCGWKGKREG----DAGISEAHALVLVNHGS-ASGAQLLAFARQVAESVRERYS
MURB_XYLFA       AAWLIEQCGWKGIREG----DAGVAPQHALVLVNYGE-ATGAELLALARRIAASVQERFG
MURB_BUCAI       AAWLIENYKFKHLQIG----DAAIHKKQKLILINKKN-ATAQEIIKLAKIIHKCILKKFN
MURB_BUCAP       AAWLIEKYNFKNIQIG----DAAIYKKQKLILINLKK-ANSKDILKLAQIIQKCILKKFG
MURB_BUCBP       AGWLIEKCKLKNFSVG----NAKIYHKQALILINKNNLATSKNIIKLAKIIISKVKKKFD
MURB_WIGBR       AGWIIEACGLKGYKLG----KAAVYHKQASIIINTGS-ATGYEIAYLAKYIFCIVKKNFS
MURB_ECOLI       AGWLIDQCQLKGMQIG----GAAVHRQQALVLINEDN-AKSEDVVQLAHHVRQKVGEKFN
MURB_ECO57       AGWLIDQCQLKGMQMG----GVAVHRQQALVLINEDN-AKSEDVVQLAHHVRQKVGEKFN
MURB_ECOL6       AGWLIDQCQLKGTQIG----GAAVHRQQALVLINEHD-AKSEDVVQLAHHVRQKVGEKFN
MURB_SALTI       AGWLIDQCQLKGVTIG----GAAVHRQQALVLINAND-ATSKDVVALAHHVRQKVGEKFN
MURB_SALTY       AGWLIDQCQLKGVTIG----GAAVHRQQALVLINAND-ATSKDVVALAHHVRQKVGEKFN
MURB_YERPE       AGWLIDQCSLKGYQIG----GAAVHQQQALVLINQSE-ATGQDVIHLARYIRQQVAQRFS
MURB_HAEIN       AGWLIDQCNLKGFQIG----GAAVHKKQALVLINKNG-ATGQDVVKLAHHVRQTVAEKFG
MURB_PASMU       AGWLIDQCGLKGYQLG----GAAVHQQQALVLINQQD-ATSSDVVELAHHIRQKVAQRFA
MURB_VIBCH       AGWLIDQAGLKGHQIG----GAKVHPKQALVIVNTGD-ASAQDVLMLAADIQQRVFNCYG
MURB_VIBVU       AGWLIDQCDFKGVQVG----GAQVHPKQALVLTNAQS-CTAQDIIQLASLICDAVWDKYQ
MURB_SHEON       AGWLIEHAGLKGFVLG----NAGVHAKQALVLVNLGN-ATGQDICRLALHVIARVHDVFG
MURB_MYCLE       AGWLVERAGFGKGYPD-GAAPCRLSTKHVLALTNRGA-ATAEDVVTLARTVRNGVLEVFG
MURB_MYCTU       AGWLVERAGFGKGYPDAGAAPCRLSTKHALALTNRGG-ATAEDVVTLARAVRDGVHDVFG
MURB2_CORGL      AAWLIERAGFKKGHPG-AGAKASLSTKHTLALTNRGD-ARASDLVALAKEIRDGVLETFG
MURB_STRCO       AAWLIDKAGFTKGYGT---GPARISTKHTLALTNRGE-ATTEDLLALAREVVAGVHEAFG
MURB_LEPIN       AWELLDQAGLRGQIKG----GAQISPEHCNFIVNLGT-ATASDVHYLIDLVVDRVYQTSG
MURB_DEIRA       -GKLIDEAGLKGTQVG----NARIAPEHGNFIVNLGG-ATAADVHALLALIRERVGVPLE
                     :                  .   :   : :        :   .       :     

MURB_AGRFC       IRLEWEIKRLGLFMPGREVEPFLGA----------
MURB_RHIME       VKLEWEIKRVGNFMPGYEIREFLGRATA-------
MURB_BRUSU       IRLHWEIKRLGLFREGEQIEEFLGKII--------
MURB_RHILO       IRLQWEIKRIGNFRPGHAVQEFLGQLL--------
MURB_CAUCR       VQLDWEIKRIGRAG---------------------
MURB_ZYMMO       ITLEWEIKRIGHKLDGDKA----------------
MURB_RICCN       VKLEWEIKRIGRHP---------------------
MURB_RICPR       VELNWEIKRIGKYV---------------------
MURB_HELPY       IHLEEEVKILR------------------------
MURB_HELPJ       IHLEEEVKILR------------------------
MURB_CAMJE       TNLENEVIII-------------------------
MURB_AQUAE       IVLEEEVKLIESSGSDGWKVLGA------------
MURB_FUSNN       IKLEEEIIIVR------------------------
MURB_NOSS1       ILLEPEVKMLGEFQAA-------------------
MURB_THEEB       VWLHPEVKLIGNFA---------------------
MURB_SYNY3       ILLEPEVKMLGEFAR--------------------
MURB_SYNE7       VNLHPEVKLLGEFQDVI------------------
MURB_BACHD       MNMETEVELIGER----------------------
MURB_BACSU       IDMHTEVEIIGGNR---------------------
MURB_CHLMU       IALEKEVRIIPFQPNLGVS----------------
MURB_CHLTR       ISLHKEVRIIPFRL---------------------
MURB_CHLPN       IDLEHEIRIIPYQPKIHSPVSEK------------
MURB_BORBU       LLLEEEVLYIGFK----------------------
MURB1_CORGL      FVMDCEVLYLSYSGDFRPAHEVADEQWPDIDLVRN
MURB_CLOAB       VELDTEVRIIGEDK---------------------
MURB_CLOPE       VELHTEVRIIGRD----------------------
MURB_STRA3       VHLEPEVRIIGESLL--------------------
MURB_STRP1       VRLEPEVRIIGENL---------------------
MURB_STRP8       VRLEPEVRIIGENL---------------------
MURB_STRP3       VRLEPEVRIIGENL---------------------
MURB_STRMU       VTLEPEVRIIGEKEVQMEDS---------------
MURB_STRPN       ITLEREVRILGESLSVAKMYAGGFTPCKR------
MURB_LACLA       VTLEPEVRIIGEK----------------------
MURB_LISIN       VELETEVKIIGEDK---------------------
MURB_LISMO       VELETEVKIIGEDK---------------------
MURB_STAAM       IELNREVRIIGEHPKES------------------
MURB_STAAW       IELNREVRIIGEHPKES------------------
MURB_STAES       VELNTEVRIIGDHPTD-------------------
MURB_OCEIH       VQLEREVRIIGEDPVE-------------------
MURB_CALS4       VELMPEIKIVGEK----------------------
MURB_THEMA       VELETEVEIWWNGRRW-------------------
MURB_BORPE       VRLEPEPVVVPAR----------------------
MURB_RALSO       VRIEPEPVVI-------------------------
MURB_PSEAE       VELEPEPNLY-------------------------
MURB_NEIMA       VELHAEPNWLPASFSL-------------------
MURB_NEIMB       VELHAEPNWLPASFSL-------------------
MURB_XANAC       VILEPEPRIIGAHW---------------------
MURB_XANCP       VILEPEPRVIGAHW---------------------
MURB_XYLFA       VAIEPETRLIGAQW---------------------
MURB_BUCAI       ILLEPEVDLIGASGKIKASKIFKLNSKLKVI----
MURB_BUCAP       IYLEPEVDFINSLGKVKLL----------------
MURB_BUCBP       ITLELEVQIIN------------------------
MURB_WIGBR       IQLEPEVKFISKIGEIKASKIIS------------
MURB_ECOLI       VWLEPEVRFIGASGEVSAVETIS------------
MURB_ECO57       VWLEPEVRFIGASGEVSAVETIS------------
MURB_ECOL6       VWLEPEVRFIGASGEVSAVETIS------------
MURB_SALTI       VWLEPEVRFIGQFGEVNAVESIA------------
MURB_SALTY       VWLEPEVRFIGRSGEVNAVESIA------------
MURB_YERPE       IWLEPEVRFIADNGEVNAVEHLS------------
MURB_HAEIN       VYLQPEVRFISATGEVNSEQIIT------------
MURB_PASMU       VWLQPEVRFIDEDGEVDSEQAIC------------
MURB_VIBCH       IELEHEVRFIGESEETNLKQWMSEQA---------
MURB_VIBVU       IALEHEVRFISTVGETCLSELRVES----------
MURB_SHEON       VMLEAEPRIMGLNGETSLHV---------------
MURB_MYCLE       ITLEPEPALVGCVL---------------------
MURB_MYCTU       ITLKPEPVLIGCML---------------------
MURB2_CORGL      VTLVPEPVWIGISIDD-------------------
MURB_STRCO       VTLVNEPVTVGVAL---------------------
MURB_LEPIN       ILLNREIEFFGDIP---------------------
MURB_DEIRA       LEYELWPEQLGG-----------------------