CLUSTAL format seed alignment for MF_00003

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RBFA_MYCPN        ----------------------MASYKKERLENDIIRLINRTVI-HEIYNETVKTG----
RBFA_MYCPE        -------------------MKHMSNVKIERYESIIKDLISHAIT-TLVYDDLIKQA----
RBFA_UREPA        ---------------------MANEVRVARLESLIKDVINNALA-NEINDKIAKLA----
RBFA_FRATW        ---------------------MAAEGRVQRVASEFQKVISLLLR-TRIKDAKLASA----
RBFA_MYCPU        ----------------------MQNIKLEKREQDILINISRIIS-EEVQNLKDVLT----
RBFA_MYCAP        ---------------------MKKSISVLRKESQIKNFISTIIT-NELTNANIYNP----
RBFA_WOLSU        ---------------------MKEKSVKLQRTESLLKEVIPEAL-STLSDTRLNSL----
RBFA_CAMJR        ---------------------MNPSEIKKLRTESILKELIPEAL-ANLDDENLKNL----
RBFA_HELPS        ---------------------MNA---HKERLESNLLELLQEAL-ASLNDSELNSL----
RBFA_THET8        -----------------------MAYGKAHLEAQLKRALAEEIQ--ALEDPRLF----LL
B7AAB8_THEAQ      -----------------------MSYGKAHLEERLRRILAEEIQ--ALEDPRLF----LL
D7BIB5_MEISD      -----------------------MGRSKLHLESQIVRTLAEVLH--DLEDPRVPP---FV
E4U7R5_OCEP5      ----------------------MSHKTLSRLELHVARALSAIIH--DMKDPRLPI---VV
D7CWZ7_TRURR      ------------------------MDASQRHARALERALAELIP--QLKDPRIPV---VA
RBFA_DEIRA        MSVPFRALRCRDEVAVFFLAAPGPLMKPEQVQAQMSRVLSSAIA--ELRDPRVPL---IV
RBFA_THEMA        ---------------------MNPAYRKAMLESEIQKLLMEALQ--QLRDPRLK--KDFV
RBFA_THEM4        ---------------------MNPEYRNKKIENKIRGLISEGLQ--KIKVPEIDALKSYI
RBFA_TREPA        -------------------MKQVSQLRVRKLGEHIRAEIAQLIMLGKIKDPRVS---PFL
RBFA_DEHM1        -----------------------MSRRVKKLNQLFRADISALLQ-KEVRDPRLD---TLL
RBFA_NOSS1        ---------------------MATNRRVSRVAELIKREVSQMLI-NGIKDDRVGTGM--V
RBFA_SYNY3        ---------------------MATSRRVSRVSSLIKREVSQMLL-HEIKDDRVGTGM--V
RBFA_SYNP6        ---------------------MATNRRVERVASLIKREVSQMLM-SGIKDDRVGAGM--V
RBFA_SYNS9        ---------------------MAQGRRVERVAALIRKETSELLI-NGIRDERVHKGM--V
RBFA_CLOPE        ----------------------MANFRGKRINEEVRKEVSDIIR-NQIKDPRLTAM---V
RBFA_CLOB1        ----------------------MAKYRAGRINEEVKKEVSNIIH-NDIKDPRLSAM---V
RBFA_CHLMU        ---------------------MTENRRMKKVNAMLRESIAKVIL-KDVKHPKISNRW--I
RBFA_CHLTR        ---------------------MAENRRMKKVNAMLREAIAKVIL-KDVKHPKISNRW--I
RBFA_CHLPN        ---------------------MTENRRIKRVNALLQEAIAKVIL-KDVKHPKISNLW--I
RBFA_PARUW        ----------------------MAIQRTDRLNSLLKEVISEVIR-RDVRNPYVTEL---V
RBFA_ANAD2        ---------------------MTTHNRPARVAEEFRHELSAILA-RGLKDPRITGF---V
RBFA_BACSU        -----------------------MSMRANRVGEQMKKELGDIIS-RKLKDPRIGFL----
RBFA_BACC4        -----------------------MKLRANRVGEQMKKELGDIIS-RKIKDPRIGFV----
RBFA_BACHD        ----------------------MSNVRANRVGEQMKKELSDIFM-RELKDPRIEFV----
RBFA_LISMO        -----------------------MNVRANRVSEQMKKELGDILN-RKIKDPRLGFV----
RBFA_STAAM        ----------------------MSSMRAERVGEQMKKELMDIIN-NKVKDPRVGFI----
RBFA_LACP3        -----------------------MKHRIGRVETQIQREVDDILL-KDVNDPRVKGV----
RBFA_LACH4        -----------------------MKHRIGRVEGEILRELTKILQ-KNIRDPRLSEV----
RBFA_STRP1        --------------------MAMANHRIDRVGMEIKREVNDILQ-KKVRDPRVQGV----
RBFA_STRE4        ----------------------MTNHRIDRVGMEIKREVNEILH-KKVRDPRVQGV----
RBFA_LACLA        ---------------------MGNSFRSDRVAVEIQREINDILR-NKVRDPRVQDV----
RBFA_STRCO        ---------------------MADNARAKRLADLIREVVAQKLQ-RGIKDP-RLGSH--V
RBFA_CUTAK        --------------------MNTPNPRVAKLADQIRVVVAETLE-RRVKDP-RLG-F--V
RBFA_MYCLE        ---------------------MADQARARRLAKRICTIVASAIE-FEIKDP-GLD-G--V
RBFA_MYCTU        ---------------------MADAARARRLAKRIAAIVASAIE-YEIKDP-GLA-G--V
RBFA_NOCFA        ---------------------MVDQARARRLAKRISEIVATAIE-YEVKDP-RLR-F--V
RBFA_CORDI        ---------------------MVDHARAARLAKRIQTIVATAIE-REVKDR-RLE-Y--V
RBFA_CORGL        ---------------------MADNARAARMAKRIQTIVASAIE-RDIKDR-RLE-F--V
RBFA_ECOLI        --------------------MAKEFGRPQRVAQEMQKEIALILQ-REIKDPRLGMM---T
RBFA_SALTY        --------------------MAKEFGRPQRVAQEMQKEIAIILQ-REIKDPRLGMM---T
RBFA_YERPE        --------------------MAKEFSRSQRVSQEMQKEIALILQ-REIKDPRVGM----A
RBFA_PASMU        --------------------MAREFKRSDRVAQEIQKEIAVILQ-REVKDPRIGM----V
RBFA_HISS2        --------------------MAREFKRSDRVAQEIQKEVAVILQ-REVKDPRIGM----V
RBFA_VIBCH        --------------------MPKEFSRTQRVAQQLQKELAMILQ-REVRDSRLGM----V
RBFA_BUCAI        --------------------MEKLFNRSDRIAQELQKKIAAIIQ-HSLKDPRIKTI---I
RBFA_RALSO        ----------------MPKKSGSASGRNLRIADQIQRDLAELIQ-REIKNPA-MGL---V
RBFA_CUPMC        ----------------MAKK-GNITSRNLRLSDQIQKELAEMIQ-REIRDPR-LGL---V
RBFA_BORPA        ---------------MRRHKSKSIPGRNLRLADQIQKDLAGIIQ-REIDMTR-AGL---I
RBFA_METPP        ----------------MKHK-RAIPNRGLRVADQIQRDVAGLI--RELKDPR-IGM---V
RBFA_LEGPL        ----------------MNNN----FKRTDRIAEMIQRKLALIIP-QEIKDPRLKGF---V
RBFA_NEIMB        -----------------MRKPQRGYARQDRVKEQIMRELAELVR-TGLKDPR-AGF---I
RBFA_XYLFA        -------------------MPKKSFQRAERISVQIHRDLGALVQ-AAVRDHG-LPS---M
RBFA_XANCP        -----------------MTMPTKSFHRTDRVSAQVRRDLGTIVH-AAVRDHG-LPS---V
RBFA_METPB        -----------MAQKQTPSGP---SQRQQRVAELVRHALAEVLQRGDIQDPVLGSHVV--
RBFA_METNO        -----------MRKPTESAGP---TQRQQRVAELVRHAIAEVLSRGDLQDPVLSRHVI--
RBFA_RHOSK        ----------MAHRSHTGTGP---SQRQLRVGELIRRTLADVLNRGEIHDPELNRLSI--
RBFA_RHIME        -----------MAKSTSSAPS----QRMLRVGEQVRAAITQVLQRGEVLDPLIENTVI--
RBFA_BRUME        -----------MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVI--
RBFA_ACICJ        -------MLRDRNRSGVRGGAEGPSQRQRRVAEDLRHRLAELFARTEFRDPELAGVHI--
RBFA_RICPR        ------------MKKLTKTNS----HRQQKLASIINEVLIEILKRGKMLDKRLFDCPL--
RBFA_RICCN        ------------MKKLTKTHS----HRQQKLASIINEALIEILRRGKMLDSRLFDCPL--
B3CR89_ORITI      ------------MKKIYQAKS----YKTLRTANMIRLALIDVLHSNK-LHTDLFECKI--
RBFA_ANAMM        ------------MIAFTPSAG----LRSLKVASVLKRALAQLF----IREFYDLSSML--
Q2GGQ7_EHRCR      ------------MIYKSES------FRNLKVASVLNRAISRVL----MQDICLFNSHI--
Q73FL1_WOLPM      -----------------MKKE----IRNLKIASVLHRAISRVL----MEGKV-FNKNV--
T2GB87_DESGG      -------------------MKRTDSLHARRLSDLILREVADILA-RDMGDPRLEGV----
RBFA_BORBU        ---------------------MYKNIKKFKLESFIAQEIGNLIVSGGIKDPRIHSF---L
B3PNC5_MYCA5      ----------------------MTTINHERKTSLLLQLIGESFY--ELQDFDVTNI----
I3ZKE2_TERRK      -----------------MPEHRAREHHRNRVQDTLREEISVIID-GELSDPRIGSA----
RBFA_LEPIC        ----------------------MNPIRRRKIEAEAVRTVAMMILSGKVKDPRVHMV----
RBFA_ACIF5        ----------------MLHSSHRPYPRGARVAHLLREEIAAVLP--RLHGMSSGLSPLPP
Q6F193_MESFL      ---------------------MANHKIKGRKEATILRELTIIIE-REMKNDVLRAL----
E1X219_HALMS      --------------------MGASSGKKNILSEKILNAANAFIR-TSVSDPSLTFV----
RBFA_PELLD        -----------------------MSRRTEKVASLLQQELGAILEKEYPRGGPLL------
RBFA_FLAPJ        ----------------------METNRQKKIGGVIQKDLVDILQ-GEIRKNGISNLV--I
RBFA_CYTH3        ----------------------MESVRQQKVARLILKEMADIFL----KESRVLFGNVFI
A8Z5W9_SULMW      ------------------------MFKNKKAAILIKKKLSEIFNRELIYFPYRKLI----
B3ER34_AMOA5      ---------------------MNDSVKKMQKSSIILRNLREIFL-HELANSFGNIL---V
J9ZA03_LEPFM      --------------------MKPVYRRADRVSSEIREIVALVLS-RFSAEPALGRL----
                                                                              

RBFA_MYCPN        HVTHVKLSDDLLHVTVYLDCYN----------------------REQIDRVVGAFNQAKG
RBFA_MYCPE        TVHYVTLSKDKSIAKVYISCYD----------------------KTIIDKILKKINGASG
RBFA_UREPA        RVTAVRLSNDLSVAKIFLDAHK----------------------RESMLKVLENVNKVSG
RBFA_FRATW        TITEVDLSKDLSYAKIYYTCLA----------------------IEDAEYIDKAFEKSKG
RBFA_MYCPU        TVVGIKLSSDLSHCNVYVTFS------------------------KNSKKNLERLNQASG
RBFA_MYCAP        TVTDVVLSTDLGHVKVFLAFS------------------------SKENDGLDAVKNASG
RBFA_WOLSU        GVVEVDCSKGKYHAEVYLDAPFAT--------------------PEEKREILRQLRLAEG
RBFA_CAMJR        CVVDVECKKGRYDAFVYLDKMFFN--------------------VHEQEKILSSLKKASR
RBFA_HELPS        SVTRVECSKGKHHAFVFV--------------------------LSQDHKILSKLKKAEG
RBFA_THET8        TVEAVRLSKDGSVLSVYVEAFR---------------------EEEG---ALRALSRAER
B7AAB8_THEAQ      TVEAARLSPDGGLLSVYVEAFR---------------------DQEG---ALEALAHAER
D7BIB5_MEISD      GVERVDVAPDLANAVVYVGLEP---------------------DSP----AFAVLHHARR
E4U7R5_OCEP5      TVERVRLSPDLSQARVLVSALE---------------------RSQE---TAELLNHAHR
D7CWZ7_TRURR      TIERVRLSADFSAAKVLVSTLR---------------------EEDEAP-LKAALERASG
RBFA_DEIRA        TVERVHVTPDYGQARVYVSAIG---------------------ADMPE--LLDALTHARG
RBFA_THEMA        TFSRVELSKDKRYADVYVSFLG---------------------TPEERKETVEILNRAKG
RBFA_THEM4        VISRVLVSKDKRFADVFVSYIG---------------------DADSRKRAVELLEKYKG
RBFA_TREPA        SVNWVDVSGGMVCARVYVSSFM---------------------GKYKTKQGVQGLESAAG
RBFA_DEHM1        SVNEVDVSEDMRHATVYVSHLA---------------------GDEHKDEILAALNAAAG
RBFA_NOSS1        SVTDVDVSGDLQHAKIYVSIYG---------------------TEEAKAETMAGLKSATG
RBFA_SYNY3        SVTEVEVSGDLQHAKIFVSIYG---------------------SPEAKASTMAGLHSAAP
RBFA_SYNP6        SVTDVVVSGDLQHTKIFVSIYG---------------------TPEAKAETMEGLKSAAS
RBFA_SYNS9        SITSVEVAGDLQHCKIFVSIFG---------------------EPNDQNEVMEGLEAASG
RBFA_CLOPE        SVTQVEVTKDLRYAKVFVSLFAK--------------------NDEEKEESLKALKSSAG
RBFA_CLOB1        SVTDVNVTKDLKYAKVYVSIFG---------------------NEKAKEESLEALKSSVG
RBFA_CHLMU        TITRVSLSRDLQSARVYVSIMP---------------------HENSQEETLAALKASAG
RBFA_CHLTR        TITRVSLSRDLQSACVYVSIMP---------------------HENSQEETLAALKASAG
RBFA_CHLPN        TVTRVSLSKDLHSARVYVSVMP---------------------HENTKEEALEALKVSAG
RBFA_PARUW        TVTRVQISRDLRYAKVFISIIG---------------------SEQAKVETIEALNSAAG
RBFA_ANAD2        TVTGSKMSPDLKEATVYVSIHG---------------------DERVRKDTFAGLQAAAG
RBFA_BACSU        TVTDVRVSGDLQIAKVYISVLGD--------------------EK-KREEALKGLAKAKG
RBFA_BACC4        TVTDVQVSGDLQIAKVYISVLGD--------------------EE-QKENTLKGLAKAKG
RBFA_BACHD        TVTGVDVTGDLQQANVYITVLGD--------------------DE-QKEATLAGLSKAKG
RBFA_LISMO        TVTGVDVTGDLQEAKVFISILGT--------------------DK-EKENTLLALAKAHG
RBFA_STAAM        TITDVVLTNDLSQAKVFLTVLGN--------------------DK-EVENTFKALDKAKG
RBFA_LACP3        TITGVKLTGDLQHATIFYSILDD--------------------APDKVEAAQTGLDKASG
RBFA_LACH4        TITAVECMNDLSYATVYYSLLTE--------------------DANKEKEVQEGLEKAKG
RBFA_STRP1        TITEVQMQGDLSLAKVYYTIMSD--------------------LASDNQKAQTGLEKATG
RBFA_STRE4        TITEVQMLGDLSVAKVYYTIMSD--------------------LASDNQKAEIGLKKATG
RBFA_LACLA        NITDVQLTGDLSQATVYYSLLSN--------------------LASDNEKAATALKKATG
RBFA_STRCO        TITDTRVTGDLREATVFYTVYG---------------------DDEERKAATAGLESAKG
RBFA_CUTAK        TITDVRLTGDSRDATLFWTAMG---------------------TDKEIAGTEAALESAKG
RBFA_MYCLE        TIVDVKVTADLHDATVFYTVMGRT-----------------LEDAPDYTAATAALNRAKG
RBFA_MYCTU        TITDAKVTADLHDATVYYTVMGRT-----------------LHDEPNCAGAAAALERAKG
RBFA_NOCFA        TITDAKVTGDLREATVYYTVMGET-----------------IDAEPDYDAAAAGLAKAKG
RBFA_CORDI        TVTDTRVTGDLHDATVYYTVRGRT-----------------IDDQPDLKAAAEALQRARG
RBFA_CORGL        TITDVTMTGDLHDAKVFYTVRGAS-----------------IEEEPDLEAAAEALHRARG
RBFA_ECOLI        TVSGVEMSRDLAYAKVYVTFLN-------------------DKDEDAVKAGIKALQEASG
RBFA_SALTY        TVSGVEMSRDLAYAKVFVTFLN-------------------DKDEDAVKAGIKALQEASG
RBFA_YERPE        TVSGIELSRDLAYAKVFVTFLNVLTD---------------NADPDTVKNGIKALQDASG
RBFA_PASMU        TVSDVEVSSDLAYAKVFVTFLF-------------------DNDESAIDAGMKGLEKASP
RBFA_HISS2        TVSDVEISSDLAYAKIFVTFLF-------------------DQDENVIEQGMKGLEKASP
RBFA_VIBCH        TISDVEVSRDLAYAKVFVTFLC--------------------IGEQTPESCLAALREHEV
RBFA_BUCAI        TVSEVQVSKDLSYAQIFVSFLE-------------------SDNNEKVKKKITILNRASS
RBFA_RALSO        TLQSVSLTPDYAHAKIYFTVLG----------------------AEP-DAAAAILNEKAG
RBFA_CUPMC        TLQSVSLTPDYAHAKVYFTVLG----------------------AEP-ETAAAILKEKAG
RBFA_BORPA        TLSGVELSADYAHAKVYFTVLG----------------------AEP-DTAAALLNEKAG
RBFA_METPP        TIQAVEVTPDYAHAKVFFSVLI----------------------GDP-AECAAALNEAAG
RBFA_LEGPL        TISAVKVAADLGHAKIYFTVLN----------------------EDK-SVVTNILNGAAS
RBFA_NEIMB        TVNEVEVTRDYSHATVFYTILN----------------------QDAREITEEVLEHARG
RBFA_XYLFA        SVSDVEVTRDMAHAKVFVTALQ----------------------AERSFEAVAGLKALAR
RBFA_XANCP        SVSDVEISRDLAHAKVFVTALQ----------------------QERSAEAVKGLKEIAG
RBFA_METPB        TVPEVRMSPDLKLATAYVMPLG----------------------GQDEAPVIAALERHKK
RBFA_METNO        TVPEVRMSPDLKLATAYVMPLG----------------------GEDEQPVIEALERNRK
RBFA_RHOSK        TVGEVRCSPDLKVATVHVMPLG----------------------GKDVEEAIALLSKHRG
RBFA_RHIME        SISEVRMSPDLKIATAYVTPLG----------------------VADHAAVIEALNKHAK
RBFA_BRUME        SVSEVRMSPDLKIATCFITPLG----------------------SADPQAVIKALASHAK
RBFA_ACICJ        TVAEVRMSPDLKHATVFVSRLG----------------------ATDIDRYLPALKRIAP
RBFA_RICPR        TITKIIVTADLKIANCYFFPF---------------------NTKLTFDEIMDALNNSKH
RBFA_RICCN        TITKVIVTADLKIANCYFLPF---------------------NTKLTIDEIMDALNNSKN
B3CR89_ORITI      TVTKVLAQAGQGMYHCYILPFS--------------------NSKVSQDKLMHAINDSLP
RBFA_ANAMM        SISGVKVSEDTRNATVFVAIG---------------------DKSVDGDEVVAALNDASN
Q2GGQ7_EHRCR      TISKVEVSSDIRDATVFVIIS---------------------QECSDKEALIKELNDSSY
Q73FL1_WOLPM      AVSDVKLSKDLKKADVYIVLSSLNIQVADYLDPEKRRTGDPSENNCDINTVVNEMNQSAW
T2GB87_DESGG      VISGVRLNPNLRVAEVLYTMEN---------------------DEARRQATAKALATACG
RBFA_BORBU        TVVKVEFSKDLINAKVFMGSIK---------------------EGASLDNAVKALNNAKG
B3PNC5_MYCA5      AINDVILSNDGSHAKVYVTFFK------------------------DKERYFEKITKMAP
I3ZKE2_TERRK      TCTEVTLEPGGKSGHAYIQVVG---------------------DEAEEQSTLEGLVAARG
RBFA_LEPIC        SVHRAEISEDGKNMKVFVTAIC---------------------TDKKKIKVLSGLNSASG
RBFA_ACIF5        SITMVDLPTDMRSATVYFSLMD---------------------GPDRADTIREVLQDHAG
Q6F193_MESFL      SIAEVRLTNDSEIAKIYWSFLPLN-------------------KEITKELIASELEENKK
E1X219_HALMS      SITRVELSDDLSNSKLYWDTFD----------------------ASRRGDSKKAILAITG
RBFA_PELLD        TVVDVKVTADLGLARAYVSIIG---------------------SEEQRTAAMEFLRDETK
RBFA_FLAPJ        SVSKVSVTTDLGVARVYLSVFP----------------------QEKAPEILESIKSNMY
RBFA_CYTH3        SITVVRMSPDLSVAKLYLSIMLQ----------------------EDKNAILKEIKVHTK
A8Z5W9_SULMW      IITKVIVNSDFSLAKIYISFFP----------------------KENQYNLIKIINNKSK
B3ER34_AMOA5      TVTSLYICDKTRVVKVYVSFMP----------------------SQNGPRMIKELEKHKS
J9ZA03_LEPFM      TILYVNLPDDLKVARIHYSVFP----------------------GEDPLYYGRLLTRHKG
                                                                        .     

RBFA_MYCPN        VFSRVLAHNL--YLAKAVQIHFVKDKAIDNAMRIESIINSLKKSKPN-------------
RBFA_MYCPE        FFRTILAKNL--NLRKAPAIVFLNDESIDKIDEINSLLEQIKGK----------------
RBFA_UREPA        LLRSKLAAEW--TSYKVPELRFVIDETIDYANHIDELFKKIKQQEN--------------
RBFA_FRATW        FFRSSIAKSL--SLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENY
RBFA_MYCPU        YIKKQLSSIL--KWRKIPSLHFKIDDTFEKSLKIEQILEEIKKEK---------------
RBFA_MYCAP        YIRKRLSKTL--NWRKVPELHFYIDEVEKKAFEIDQILNSLKNEE---------------
RBFA_WOLSU        TIRDHCLSAT--GWFKCPRFHFNFDDSTDKANRLDAIFEQLKKER-ES------------
RBFA_CAMJR        ALQNYCMSEQ--GWYRCPNFHFKFDDRLEYQNHMDALFEKIKKDKNES------------
RBFA_HELPS        LIRQFVLQAS--GWFKCPKLSFVLDNSLEKQLRLDAIFNEIAKGKDND------------
RBFA_THET8        RLVAALARRV--RMRRLPRLEFLPWRASPA------------------------------
B7AAB8_THEAQ      RLASALGRRV--RLRRLPRLEFLPWNPEP-------------------------------
D7BIB5_MEISD      YIQDELAQRM--RLRRIPRLKFVASEAAPAARRCRYSTNPGEKP----------------
E4U7R5_OCEP5      YLQEELAHAM--ELRRIPRLRFFAEPREVL------------------------------
D7CWZ7_TRURR      FLQRRLAAAA--DLRRTPRLSFHTDPAEVLS-----------------------------
RBFA_DEIRA        RLQRELSAHV--RMRRTPTLEFHAADDQRFPAAPGSTW----------------------
RBFA_THEMA        FFRTFIAKNL--RLYVAPEIRFYEDKGIEASVKVHQLLVQLGYDPLKDKEKKEEDKEEE-
RBFA_THEM4        FFRKYIAQNL--RIYTTPELRFKEDIGIEESIRINKLL-----DEISKNNKNISDK----
RBFA_TREPA        FIRSVLAKKL--RLRQCPRLSFVYDESVRDGFSLSRKI-----DRLESGGVQTEHA----
RBFA_DEHM1        FFRTEIAKKT--DIRYMPVFNFIWDDTIERGVRLNTLI-----DRVTQHQPED-------
RBFA_NOSS1        FVRSELGARV--RLRRTPEVTFIEDRSIERGTKVLTLLNKLENARSPD-DIPSADDSLDE
RBFA_SYNY3        FVRRELGQRM--RLRRTPEVSFLEDRSLERGDKILNLLNNLPQAIATE-DLEDDDSGLAL
RBFA_SYNP6        YVRSELGQRV--RLRRTPEVIFVEDKGLERGTQVISLLEQLTREREAR-EAAQAAAGVVD
RBFA_SYNS9        FLRGELGRRL--QMRRAPEVKFQLDRGLEKGTSVLGLLNQLEDQRQERGEIPPGSDELQP
RBFA_CLOPE        FIRREVGNRV--KLRSTPEILFEEDNSIDNAMYIESLLNKIKEK----------------
RBFA_CLOB1        FIRKEVGRRV--KLRNTPEVIIEVDNSIERGMHIDELLHSIKENESNDN-----------
RBFA_CHLMU        FIACQASKDV--VLKYFPDLNFYMEDIFSPQDHIESLLLKIAEQDKKLTHNNNNSSELHD
RBFA_CHLTR        FIAFQASKDL--VLKYFPDLNFYVEDIFSPQDHIESLLLKIAEQDKKTNP----------
RBFA_CHLPN        FIAHRASKNV--VLKYFPELHFYLDDIFSPQDYIENLLWQIQEKEKS-------------
RBFA_PARUW        FIAVNASQKV--VMRYFPELNFKLDDSVDKHMRIEELLGKITKERESRQGDNSDQLEQEP
RBFA_ANAD2        FLQREVSRAL--RLRNTPHLRFVYDESVARGDRIERLLREARTQGQAAPAPDVEPAPGAA
RBFA_BACSU        FIRSEIGSRI--RLRKTPEIEFEFDESIDYGNRIETLIHELHSE-KPSE-----------
RBFA_BACC4        FIRSEIGQRI--RLRKTPEITFEFDESIGYGHRIDTLLHEINKDGKREE-----------
RBFA_BACHD        FIRSEIGKRI--RLRKTPELFFHFDESIEYGNRIEKLLQDINRDGE--------------
RBFA_LISMO        FIRSEIGRRI--RLRKVPEMSFEIDNSIAYGNRIDELLRDLNNDQ---------------
RBFA_STAAM        FIKSELGSRM--RLRIMPELMYEYDQSIEYGNKIERMIQDLHKQDR--------------
RBFA_LACP3        LIRREVGQRI--RLFKVPEIEFAQDKSVQYGARIDQLINEVRRKNLE-------------
RBFA_LACH4        MMRHLLGQTL--TVYKVPELIFKRDNSVKYGSKIDRLIAEVKKQDAERASK---------
RBFA_STRP1        TIKRELGKQL--TMYKIPDLVFEKDNSIAYGNKIDQLLRDLDNKS---------------
RBFA_STRE4        TIKRELGKQL--TMYKIPDLVFEKDNSIAYGNKIDQLLRELEKKQ---------------
RBFA_LACLA        LFKSELAKRM--TIFKIPDLTFAKDESVEYGSKIDELLRGLNNKSEY-------------
RBFA_STRCO        ILRSEVGKAA--GVKFTPTLTFVMDALPDTARNIEDLLDKARQSDEKVREASAGATYAGE
RBFA_CUTAK        MLRSTVGKRL--KLRYAPTLTFVRDATPETAKSIEDALARAAASDAEIARRSQGAMPAGE
RBFA_MYCLE        TLRSKVGAGT--GVRFTPTLTFIRDTTSDSVARMEELLARARAADADVAQVRLRAKPAGE
RBFA_MYCTU        VLRTKVGAGT--GVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGE
RBFA_NOCFA        VLRSKVGAGT--GVKFTPSLAFVLDKVPDAAREMEELLARARAADAEVARVAAEARHAGE
RBFA_CORDI        QLRKIVGDQL--SVRFTPTLSFELDTVPETSAHMEDLLARARARDLELAELKKNAQPAGD
RBFA_CORGL        QLRKIVGQQL--GVRFTPTLTYSIDTVPEASAHMEALLDRARKRDEELAKLREGAAPAGD
RBFA_ECOLI        FIRSLLGKAM--RLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED--
RBFA_SALTY        FIRSLLGKAM--RLRIVPELTFFYDNSLVEGMRMSNLVTNVVKHDEERRVNPDDSKED--
RBFA_YERPE        YIRTLLGKAM--RLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK--
RBFA_PASMU        YIRSLLGKAM--RLRIVPEIRFIYDRSLIEGMRMSNLVSNVIREDNARHIDDDVSEEK--
RBFA_HISS2        YIRSLLGKVM--RLRIVPELRFIYDQSLVDGMRMSNLVTNVVREDEKRHVEE--------
RBFA_VIBCH        QIRMMLGKQI--RLRLTPEIRFYYDNTLVEGMRMSNLVTEVINSDKRRKHEAGRDEDEA-
RBFA_BUCAI        YIRKLLCKRM--KLRIVPNIIFHHDDSFLKGNKISCILENLTKKE---------------
RBFA_RALSO        YLHSLLFKRL--HIHTVPTLHFHYDGSVERGIEMSRLIDQANA----SRAKDD-------
RBFA_CUPMC        YLHSLLFKRL--HIHTVPTLHFHHDTSVEHAIEMSKLINEANA----TRAKDDE------
RBFA_BORPA        WLHSQLYKLL--HIHTVPTLRFVHDLQITRGIEMSVLIDRANRPGPHSGVPDEPEDQS--
RBFA_METPP        YLRNSLFKRL--QIHTVPTLHFQFDRTTERAADLNALIHQANA----TRAKDADDQPGAT
RBFA_LEGPL        YLRSALARSI--TLRTVPQLHFIYDESIEYGQRLSRLIDEVNPP---DSSSDDNN-----
RBFA_NEIMB        HLRSELAKRI--KLFKTPELHFKYDESLERGLNLSALIDQVAA----EKPVED-------
RBFA_XYLFA        ELRMQLAHTM--RLRFVPELHFHYDDSLDRGERINTLLRDL--IPPADAEKDECG-----
RBFA_XANCP        QLRTQLARAM--KLRHVPELHFHYDDSVDRGERIDNLLRDLDDIGPEAAPDAQDAEPR--
RBFA_METPB        ILRQEVARRV--NLKYAPELRFRRDETFDEAARIDQLLRSEKVQRDLESAPREDDEAEPD
RBFA_METNO        VLRQEVARRV--NLKFAPDLRFRRDETFDEAARIDRLLRSDKVQRDLGPD-RDSGE----
RBFA_RHOSK        ELRHHITRQM--TLKYAPDLRFRPDETFDRLDETRRLFSDETVMRDIRGG-GEADED---
RBFA_RHIME        FIRGRLGPQLR-QMKYMPDVRFRDDTSFDNYQKIDSLLRSPEVSRDLDRDAD-----DEE
RBFA_BRUME        FIRGRVAPSLA-QMKYMPEFRFRPDTSFDNFSKIDALLRFPEVARDLSHDDDEDGGADEA
RBFA_ACICJ        FLRGEIGHGL--RMKFVPDLHFQPDHALDEATRINELLHRPEVMRDLLKPDEE-------
RBFA_RICPR        AIRNFITNRI--NMKFSPEIRFYYDYGFDNAIKIEELLKNSSFKDKTSE-----------
RBFA_RICCN        AIRNFITNKI--NMKFSPDIRFHYDHGFDNAIKVAHLLKDL-------------------
B3CR89_ORITI      IIRRMITQKI--NLKYSPELRIFYDYGFDNAANVDKILKSL-------------------
RBFA_ANAMM        SIRRAVFRYL--KLRYVPRLHFKLDVEFDNFLRISEIMATTK------------------
Q2GGQ7_EHRCR      FIRKAIFSYV--DLRYIPRLYFKLDYCFDNLVRVNQILESK-------------------
Q73FL1_WOLPM      SIRKSILCYV--DLRFIPELVFKPDLAFDNFVNVSKILHNHT------------------
T2GB87_DESGG      RIRTLLGPRL--RSRALPELRFVLDSFLEEVIYARPHEESGDDAPDGTPGDPPGPDSSAH
RBFA_BORBU        FIQSQIIKRI--KVRSTPKLLFVKDDSLSKSFYVNKLIEGLNTTREN-------------
B3PNC5_MYCA5      FIRSVVAKSW--KYKKLPELVFLIDTVEPSARKIEKILDNIKNQ----------------
I3ZKE2_TERRK      YIRSQLLMRL--GVRHLPEISFHIDSSEKINARMDTLLTRMKKRSARRANSQSGAART--
RBFA_LEPIC        LFQATLSGKL--GLRITPKMHFLWDEEYIQSLDESLRLTRKPTNTD--------------
RBFA_ACIF5        EIRQLLGRRL--ALRRIPPLHFVYDARFDRGAEMAELLAHLPPAPEDLP-----------
Q6F193_MESFL      TIRMKLAHKL--NTRTVPDLFFEYDTSLENANRIEEILNKVNK-----------------
E1X219_HALMS      KLRTHLSKLL--KMRHVPTITFVYDSQYDEEKKIEDLLDDEAKKGKGIS-----------
RBFA_PELLD        NIRHILSTRIRHQFRRIPELEFFEDRLFEQANRIEELLRSVRKDDGDNA-----------
RBFA_FLAPJ        LIKHDLSQRVRLQLRKVPNLAFYIDDSLDYIEKIDNALAGKENPIENRDLLEKRKKI---
RBFA_CYTH3        ELRKLLGERIRKQVRIIPEIIFYLDDNVDYANHMDDVLSKITIPKKEDENFDPNQYPGLK
A8Z5W9_SULMW      YYKKILFKKLRFKFKKMPNIFFKIDKNFTNI-----------------------------
B3ER34_AMOA5      KIRGLLGKRLANKLRSIPELKFHLDNSIERAYHIEKLLNGFEVSLTKASISV--------
J9ZA03_LEPFM      LIRKEVGKLL--RMKWIPDIEFLPSPEIANSDSQSDFLVRQTDKNKKNTSSLMDELEGEQ
                                     .                                        

RBFA_MYCPN        ------------------------------------------------------------
RBFA_MYCPE        ------------------------------------------------------------
RBFA_UREPA        ------------------------------------------------------------
RBFA_FRATW        KQNDKETKAEKLR-----------------------------------------------
RBFA_MYCPU        ------------------------------------------------------------
RBFA_MYCAP        ------------------------------------------------------------
RBFA_WOLSU        ------------------------------------------------------------
RBFA_CAMJR        ------------------------------------------------------------
RBFA_HELPS        ------------------------------------------------------------
RBFA_THET8        ------------------------------------------------------------
B7AAB8_THEAQ      ------------------------------------------------------------
D7BIB5_MEISD      ------------------------------------------------------------
E4U7R5_OCEP5      ------------------------------------------------------------
D7CWZ7_TRURR      ------------------------------------------------------------
RBFA_DEIRA        ------------------------------------------------------------
RBFA_THEMA        ------------------------------------------------------------
RBFA_THEM4        ------------------------------------------------------------
RBFA_TREPA        ------------------------------------------------------------
RBFA_DEHM1        ------------------------------------------------------------
RBFA_NOSS1        D-----------------------------------------------------------
RBFA_SYNY3        D-----------------------------------------------------------
RBFA_SYNP6        STEDA-------------------------------------------------------
RBFA_SYNS9        D-----------------------------------------------------------
RBFA_CLOPE        ------------------------------------------------------------
RBFA_CLOB1        ------------------------------------------------------------
RBFA_CHLMU        ------------------------------------------------------------
RBFA_CHLTR        ------------------------------------------------------------
RBFA_CHLPN        ------------------------------------------------------------
RBFA_PARUW        ------------------------------------------------------------
RBFA_ANAD2        PDDEAEE-----------------------------------------------------
RBFA_BACSU        ------------------------------------------------------------
RBFA_BACC4        ------------------------------------------------------------
RBFA_BACHD        ------------------------------------------------------------
RBFA_LISMO        ------------------------------------------------------------
RBFA_STAAM        ------------------------------------------------------------
RBFA_LACP3        ------------------------------------------------------------
RBFA_LACH4        ------------------------------------------------------------
RBFA_STRP1        ------------------------------------------------------------
RBFA_STRE4        ------------------------------------------------------------
RBFA_LACLA        ------------------------------------------------------------
RBFA_STRCO        ADPYRK---------------------------------PDEDETDTEGAVEADETDDTA
RBFA_CUTAK        ADPYRH---------------------------------SDEEE----------------
RBFA_MYCLE        ADPYRDKGSVA-----GLVGVDIAD--------------IDDDDLTDD------------
RBFA_MYCTU        ADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE------------
RBFA_NOCFA        PDPYK----------------------------------TDRDDAE--------------
RBFA_CORDI        AHPYK-----------------------------------DDDAMND-------------
RBFA_CORGL        ADPYK-----------------------------------TSSKSESEE-----------
RBFA_ECOLI        ------------------------------------------------------------
RBFA_SALTY        ------------------------------------------------------------
RBFA_YERPE        ------------------------------------------------------------
RBFA_PASMU        ------------------------------------------------------------
RBFA_HISS2        ------------------------------------------------------------
RBFA_VIBCH        ------------------------------------------------------------
RBFA_BUCAI        ------------------------------------------------------------
RBFA_RALSO        ------------------------------------------------------------
RBFA_CUPMC        ------------------------------------------------------------
RBFA_BORPA        ------------------------------------------------------------
RBFA_METPP        EA----------------------------------------------------------
RBFA_LEGPL        ------------------------------------------------------------
RBFA_NEIMB        ------------------------------------------------------------
RBFA_XYLFA        ------------------------------------------------------------
RBFA_XANCP        ------------------------------------------------------------
RBFA_METPB        SASRD-------------------------------------------------------
RBFA_METNO        ------------------------------------------------------------
RBFA_RHOSK        ------------------------------------------------------------
RBFA_RHIME        ------------------------------------------------------------
RBFA_BRUME        PRNGDE------------------------------------------------------
RBFA_ACICJ        ------------------------------------------------------------
RBFA_RICPR        ------------------------------------------------------------
RBFA_RICCN        ------------------------------------------------------------
B3CR89_ORITI      ------------------------------------------------------------
RBFA_ANAMM        ------------------------------------------------------------
Q2GGQ7_EHRCR      ------------------------------------------------------------
Q73FL1_WOLPM      ------------------------------------------------------------
T2GB87_DESGG      ------------------------------------------------------------
RBFA_BORBU        ------------------------------------------------------------
B3PNC5_MYCA5      ------------------------------------------------------------
I3ZKE2_TERRK      ------------------------------------------------------------
RBFA_LEPIC        ------------------------------------------------------------
RBFA_ACIF5        ------------------------------------------------------------
Q6F193_MESFL      ------------------------------------------------------------
E1X219_HALMS      ------------------------------------------------------------
RBFA_PELLD        ------------------------------------------------------------
RBFA_FLAPJ        ------------------------------------------------------------
RBFA_CYTH3        E-----------------------------------------------------------
A8Z5W9_SULMW      ------------------------------------------------------------
B3ER34_AMOA5      ------------------------------------------------------------
J9ZA03_LEPFM      ------------------------------------------------------------
                                                                              

RBFA_MYCPN        -
RBFA_MYCPE        -
RBFA_UREPA        -
RBFA_FRATW        -
RBFA_MYCPU        -
RBFA_MYCAP        -
RBFA_WOLSU        -
RBFA_CAMJR        -
RBFA_HELPS        -
RBFA_THET8        -
B7AAB8_THEAQ      -
D7BIB5_MEISD      -
E4U7R5_OCEP5      -
D7CWZ7_TRURR      -
RBFA_DEIRA        -
RBFA_THEMA        -
RBFA_THEM4        -
RBFA_TREPA        -
RBFA_DEHM1        -
RBFA_NOSS1        -
RBFA_SYNY3        -
RBFA_SYNP6        -
RBFA_SYNS9        -
RBFA_CLOPE        -
RBFA_CLOB1        -
RBFA_CHLMU        -
RBFA_CHLTR        -
RBFA_CHLPN        -
RBFA_PARUW        -
RBFA_ANAD2        -
RBFA_BACSU        -
RBFA_BACC4        -
RBFA_BACHD        -
RBFA_LISMO        -
RBFA_STAAM        -
RBFA_LACP3        -
RBFA_LACH4        -
RBFA_STRP1        -
RBFA_STRE4        -
RBFA_LACLA        -
RBFA_STRCO        K
RBFA_CUTAK        -
RBFA_MYCLE        -
RBFA_MYCTU        -
RBFA_NOCFA        -
RBFA_CORDI        -
RBFA_CORGL        -
RBFA_ECOLI        -
RBFA_SALTY        -
RBFA_YERPE        -
RBFA_PASMU        -
RBFA_HISS2        -
RBFA_VIBCH        -
RBFA_BUCAI        -
RBFA_RALSO        -
RBFA_CUPMC        -
RBFA_BORPA        -
RBFA_METPP        -
RBFA_LEGPL        -
RBFA_NEIMB        -
RBFA_XYLFA        -
RBFA_XANCP        -
RBFA_METPB        -
RBFA_METNO        -
RBFA_RHOSK        -
RBFA_RHIME        -
RBFA_BRUME        -
RBFA_ACICJ        -
RBFA_RICPR        -
RBFA_RICCN        -
B3CR89_ORITI      -
RBFA_ANAMM        -
Q2GGQ7_EHRCR      -
Q73FL1_WOLPM      -
T2GB87_DESGG      -
RBFA_BORBU        -
B3PNC5_MYCA5      -
I3ZKE2_TERRK      -
RBFA_LEPIC        -
RBFA_ACIF5        -
Q6F193_MESFL      -
E1X219_HALMS      -
RBFA_PELLD        -
RBFA_FLAPJ        -
RBFA_CYTH3        -
A8Z5W9_SULMW      -
B3ER34_AMOA5      -
J9ZA03_LEPFM      -