CLUSTAL format seed alignment for MF_00004

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

APT_CORGL       -----------------------------------------MSEQALSTFDRAREALDKK
APT_MYCTU       -----------MLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASL
APT_STRCO       ----------------------------------------------MTEPTGITELLLSR
APT_MYCPU       ------------------------------------------------------MNLEKF
APT_BACSU       ------------------------------------------------------MDLKQY
APT_STAAM       ------------------------------------------------------MDLKQY
APT_LISMO       ---------------------------------------------------MEIKDLQDY
APT_FUSNN       ------------------------------------------------------MDLKNY
APT_STRPN       ------------------------------------------------------MNLKDY
APT_STRP1       ------------------------------------------------------MDLTNY
APT_LACLA       ------------------------------------------------------MELKDY
APT_ALKHC       ------------------------------------------------------MDFKQH
APT_CLOAB       ------------------------------------------------------MDLKDS
APT_CLOPE       ------------------------------------------------------MSLKDK
APT_THEMA       ---------------------------------------------------MFKLDLKRF
APT_CALS4       ---------------------------------------------------MTLDDIKEM
APT_BUTFI       -----------------------------------------------------MKKVEDY
APT_AGRFC       --------------------------------MTVIASE-----------------LSAA
APT_RHIME       --------------------------------MTAVQSE-----------------LISA
APT_RHILO       -------------------------------MKPSLEDT-----------------LLAS
APT_BRUME       -------------------------------MESGFKVT-----------------LKDA
APT_NEIMA       -------------------------------MLVHPEAMSVGA-------------LADK
APT_NEIMB       -------------------------------MLVHPEAMSVGA-------------LADK
APT_PSEAE       --------------------------------MIFDEFT-----------------LKSQ
APT_PSEST       --------------------------------MIFDEFS-----------------IKTL
APT_RALSO       --------------------------------MTDASISPSSPVPASTELGDVTRYLRER
APT_HELPY       -------------------------------MNETLKEE-----------------LLQS
APT_HELPJ       -------------------------------MNEMLKEE-----------------LLQS
APT_ECOLI       ------------------------------MTATAQQLEY----------------LKNS
APT_ECO57       ------------------------------MTATAQQLEY----------------LKNS
APT_SALTI       ------------------------------MTATAQQLEF----------------LKNS
APT_SALTY       ------------------------------MTATAQQLEF----------------LKNS
APT_YERPE       --------------------------MTVSASKTAQQLKY----------------IKDS
APT_VIBCH       --------------------------------MTTETLSL----------------IKSS
APT_HAEIN       ---------------------------------MTTQLDL----------------IKSS
APT_PASMU       ---------------------------------MNDKLAL----------------IKSS
APT_NOSS1       ------------------------------------------------------MDLKSL
APT_SYNY3       ------------------------------------------------------MDLKAL
APT_TREPA       -------------------------------MRGIGRYHAPVD---------GHAALDRA
APT_BORBU       -------------------------------MKNKTEYY------------------DQF
APT_UREPA       --------------------------------------------------MINIDYIKSK
APT_MYCGE       -------------------------------------------------MDQNFKLLDQA
APT_MYCPN       -------------------------------------------------MKQKLQALDRA
                                                                            

APT_CORGL       TRYVQDFPEKGVLFEDLTPVLGDAESFVAVVDAMAEAAEKL--NAEIIGGLDARGFLLGS
APT_MYCTU       TRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRAS----GADLVAGVDARGFLVAA
APT_STRCO       IRDVADYPEPGVVFKDITPLLADPGAFAALTDALAEAAGRT--GATKVVGLEARGFILGA
APT_MYCPU       IKDVKDFPKQGINFKDISPLLANGQALNYTIKKMAELAK----DADIIVGPDARGFLFGT
APT_BACSU       VTIVPDYPKEGVQFKDITTLMDKGDVYRYATDQIVEYAKEK--QIDLVVGPEARGFIIGC
APT_STAAM       VSEVQDWPKPGVSFKDITTIMDNGEAYGYATDKIVEYAKDR--DVDIVVGPEARGFIIGC
APT_LISMO       VAIVNDWPKKGIVFKDITPLMNDGEAYRFATDKIVEYAKEL--KIDIIVGPEARGFIIGC
APT_FUSNN       VASIENYPKEGIIFRDITPLMNDGEAYKYATEKIVEFAKDH--HIDIVVGPEARGFIFGC
APT_STRPN       IATIENYPKEGITFRDISPLMADGNAYSYAVREIVQYATDK--KVDMIVGPEARGFIVGC
APT_STRP1       IASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDK--DIDMVVGPEARGFIIGC
APT_LACLA       IATIENYPKEGVVFRDISPLMADGNAYNYAATEIVQYARDK--EIDMVVGPEARGFIIGC
APT_ALKHC       ITIVENFPKEGIRFKDITTLMQNGEVYKRAIDEMARFAKEK--EVDLVVGPEARGFVVGC
APT_CLOAB       IRVIDGFPKEGISFKDVTTLIQDKEAYKYSVDKIGEYLKDK--NVDLIVAPEARGFLFGA
APT_CLOPE       IRVIEDFPKKGISFKDITTLIADGEGLRDSVDQMAEFFKDK--NIDVVVGPEARGFIFGV
APT_THEMA       IRDIPDFPQKGIVFRDITPLLRNQEAFKEAIDRMCELVFDR--EFDLVVAPEARGFILGA
APT_CALS4       IREIPDFPKKGIRFKDITPVLKDAKAFNYSIEMLAKALEGR--KFDLIAAPEARGFLFGA
APT_BUTFI       IRTIPDFPEPGIMFRDVTSILQDAEGFKLAIDEMIKLLDGV--DCDVIAGAESRGFIFGA
APT_AGRFC       IRSIPDYPKPGIIFRDITTLLGNPRAFRRAVDELVQPYAGT--KIDKIAGMEARGFILGG
APT_RHIME       IRSIPDYPKPGVMFRDITTLLGNPRAFRRAIDELVHPYAGT--KVDKVAGIEARGFILGG
APT_RHILO       IRTIPDYPKPGILFRDITTLLGNARAFRRAIDELVHPYAGQ--KVDKIAGIEARGFILGG
APT_BRUME       IRTIPDYPKPGVQFRDVTTLMGNAQAFRRAVDELVYPYAGN--RIDKVAGIEARGFILGG
APT_NEIMA       IRKIENWPQKGILFHDITPVLQSAEYFRLLVDLLVYRYMDQ--KIDIVAGLDARGFIIGA
APT_NEIMB       IRKIENWPQKGILFHDITPVLQSAEYFRLLVDLLVYRYMDQ--KIDIVAGLDARGFIIGA
APT_PSEAE       IRAVPDFPKPGVVFRDITPLFQSPRALRMTVDSFVQRYIEA--DFSHIGAMDARGFLIGS
APT_PSEST       IRPVQDFPRPGVVFRDITPLFQSPKALRMVADSLIQRYVEA--DFTHIGALDARGFLVGS
APT_RALSO       IRTVPDWPQLGVMFRDITPLLQDPKSLRVLVDVFVHRYMGQ--GLNLVAGIDARGFILGS
APT_HELPY       IREVKDYPKKGILFKDITTLLNYPKLFNKLIDTLKKRYLAL--NIDFIVGIEARGFILGS
APT_HELPJ       IREVKDYPKKGILFKDITTLLNYPKLFNKLIDALKKRYLAL--NIDFIVGIEARGFILGS
APT_ECOLI       IKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNA--GITKVVGTEARGFLFGA
APT_ECO57       IKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNA--GINKVVGTEARGFLFGA
APT_SALTI       IKSIQDYPKPGILFRDVTSLLEDPKAYALSIELLVERYKNA--GITKVVGTEARGFLFGA
APT_SALTY       IKSIQDYPKPGILFRDVTSLLEDPKAYALSIELLVERYKNA--GITKVVGTEARGFLFGA
APT_YERPE       IKTIPDYPKAGILFRDVTSLLENPKAYSASIKLLSEHYSES--GVTKVVGTEARGFLFGA
APT_VIBCH       IKSIPDYPKKGILFRDVTSLLEDAQAYQATIQLLVEKYKDM--GFTKVVGTEARGFLFGA
APT_HAEIN       IKSIPNYPKEGIIFRDITTLLEVPAAFKATIDLIVEQYRDK--GITKVLGTESRGFIFGA
APT_PASMU       IKSIPNHPKEGIIFRDITSLLEVPAAFQTVVDLFVTRYKEK--GITKVLGTESRGFIFGA
APT_NOSS1       IRDIPDFPKPGILFRDITTLLRDRQGLRYTIDFLAEKCSEANLNIDYVIGMESRGFIFGT
APT_SYNY3       IRDIPDFPKPGIMFRDITTLLNSPEGLRYTIDSLVEQCESQELVPDHVVGMESRGFLFGM
APT_TREPA       IRKRIDFPKKGILYYDITGVLMNAAVFRYCLDQMVEFYRDE--HVTAVAAIESRGFIFAA
APT_BORBU       ISKIPNFPKKGVLFYDITSVLLKPEVYSSLINEVYSFYNFK--KIDCIAVVESRGYLIGA
APT_UREPA       IRDVPDFPKKGIVFKDITPLFLEPKIIEKIVDDFADFAKSL--NIDAIIGAESRGFLFAA
APT_MYCGE       IKRFENFPNQGTLFYDITPVFSNPQLFNFVLTQMAQFIKAI--NAEAIVCPEARGFIFGG
APT_MYCPN       IKRFNDFPTPGILFYDITPIFLNSELFEFVLEQMAQFIQEV--KADGIVCPEARGFIFGG
                     . *  *  : *:: ::            .             :   ::**::.. 

APT_CORGL       AVAYKLGLGVLAIRKKGKLPPPVVTQEYELEYGT-AALELPSEGID--IAGKNIVLIDDV
APT_MYCTU       AVATRLEVGVLAVRKGGKLPRPVLSEEYYRAYGA-ATLEILAEGIE--VAGRRVVIIDDV
APT_STRCO       PVALRAGLGFIPVRKAGKLPGATLSQAYDLEYGS-AEIEVHAEDL---TAGDRVLVVDDV
APT_MYCPU       PTAAFLSKPFIMVRKKGKLPGEVIKHEYDLEYGK-DILEIQ-KGVI--KPGDKAIIIDDV
APT_BACSU       PVAYALGVGFAPVRKEGKLPREVIKVDYGLEYGK-DVLTIHKDAIK---PGQRVLITDDL
APT_STAAM       PVAYSMGIGFAPVRKEGKLPREVIRYEYDLEYGT-NVLTMHKDAIK---PGQRVLITDDL
APT_LISMO       PVAYALGIGFAPVRKPGKLPRETIEMEYDLEYGT-NKLSMHSDAIK---PGQRVLITDDL
APT_FUSNN       PVSYALGVGFVPVRKPGKLPREVIEYAYDLEYGS-NKLCLHKDSIK---PGQKVLVVDDL
APT_STRPN       PVAFELGIGFAPVRKPGKLPREVISADYEKEYGV-DTLTMHADAIK---PGQRVLIVDDL
APT_STRP1       PVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGL-DTLTMHADAIK---PGQRVLIVDDL
APT_LACLA       PVAFALGVGFAPVRKPGKLPREVIEATYEKEYGT-DTLTMHSDSIK---PGQRVLIVDDL
APT_ALKHC       PIAYAIGKGFVPVRKAGKLPREVISVDYGLEYGK-DRLTIHRDAIQ---KGQRVLIADDL
APT_CLOAB       PVAYKIGAGFIPVRKKGKLPCETVEVTYELEYGE-DILEMHKDAIK---KGQRVAIVDDL
APT_CLOPE       PVAYALGVGFIPVRKPGKLPGDTVRVEYDLEYGK-DALEIHKDAIK---PGMRVAIVDDL
APT_THEMA       AMAYKLGKGFVPVRKPGKLPYKTVYEEYQLEYGT-EQLHIHEDAIE---KGQKVLIVDDV
APT_CALS4       PLAFRLGVGFVPVRKPGKLPAETLSYEYELEYGL-DSLEIHKDAVV---KGQRVVIVDDL
APT_BUTFI       PLAYALGKPSVLVRKKGKLPCETIEKTYDLEYGT-ATIEMHKDAIK---PGQKVVVVDDL
APT_AGRFC       AVAHQLSAGFVPIRKKGKLPHTTVRVAYSLEYGV-DEMEMHVDAVQ---PGEKVILVDDL
APT_RHIME       AIAHQLSAGFIPIRKKGKLPHDTVRIAYSLEYGV-DEMEMHRDAVA---PGDKVILVDDL
APT_RHILO       AVAHQLSAGFVPIRKKGKLPFDTVRVAYSLEYGL-DEMEMHKDGVA---PGEKVILVDDL
APT_BRUME       AIAHQLSAGFVPIRKKGKLPRDTVRIAYSLEYGV-DEMEMHRDAIE---KGERVVLVDDL
APT_NEIMA       ALAYQLNVGFVPIRKKGKLPFETVSQSYALEYGE-AAVEIHTDAVK---LGSRVLLVDDL
APT_NEIMB       ALAYQLNVGFVPIRKKGKLPFETVSQSYALEYGE-AAVEIHTDAVK---LGSRVLLVDDL
APT_PSEAE       AVAYALNKPLVLFRKQGKLPADVLAEGYQTEYGE-AFLEVHADSLC---EGDSVLIFDDL
APT_PSEST       ILAYELNKPLVLFRKQGKLPADVLSQAYSTEYGE-AHLEIHADSLC---EGDSVLLFDDL
APT_RALSO       IVAYELNLGFVPIRKKGKLPFTTVAEEYMLEYGS-ATVEIHADACK---PGDRVLLIDDL
APT_HELPY       ALAYALGVGFVPVRKKGKLPAHTLSQSYSLEYGS-DSIEIHSDAFRG-IKGVRVVLIDDL
APT_HELPJ       AFAYALGVGFVPVRKKGKLPAHTLSQSYSLEYGS-DSIEIHSDAFRG-IKGVRVVLVDDL
APT_ECOLI       PVALGLGVGFVPVRKPGKLPRETISETYDLEYGT-DQLEIHVDAIK---PGDKVLVVDDL
APT_ECO57       PVALGLGVGFVPVRKPGKLPRETISETYDLEYGT-DQLEIHVDAIK---PGDKVLVVDDL
APT_SALTI       PVALGLGVGFVPVRKPRKLPRETIAETYELEYGT-DQLEIHVDAIK---PGDNVLVVDDL
APT_SALTY       PVALGLGVGFVPVRKPRKLPRETIAETYELEYGT-DQLEIHVDAIK---PGDNVLVVDDL
APT_YERPE       PVALALGVGFVPVRKPGKLPRETISESYELEYGT-DTLEIHTDSIQ---PGDKVLVVDDL
APT_VIBCH       PLALELGVGFVPVRKPGKLPRQTVAQSYELEYGT-DTLEIHVDAIK---PGDKVLVVDDL
APT_HAEIN       PVALALGLPFELVRKPKKLPRETISQSYQLEYGQ-DTLEMHVDAIS---EGDNVLIIDDL
APT_PASMU       PVALALNVPFVLVRKPGKLPRETISQTYQLEYGQ-DTLEIHTDAIH---AQDKVLIIDDL
APT_NOSS1       PLAYKLGAGFIPVRKKGKLPAAVHSIEYELEYGT-DCLEVHRDALH---PDSRVLIVDDL
APT_SYNY3       PLAYQMNAGFIPVRKPGKLPAPVHRVEYDLEYGK-DSLEIHQDAVA---PHHRVLIVDDL
APT_TREPA       PFADRMGIPLILVRKAGKLPGDTYSCSYSLEYGK-ATVEVHKSDVV---AGARVLLTDDL
APT_BORBU       PLSLKMQLPLVLIRKEGKLPREVFSEEYELEYGF-GRIEVHKDDVR---TYSNILLIDDI
APT_UREPA       PLSIKLNKPFILVRKPNKLPNDVYSAEYTLEYGS-SRVEMHKDALK---PNQRVLIVDDL
APT_MYCGE       ALASKTQLPLVLVRKANKLPGQLISASYDLEYRKHAVLEMSTTSLIQANNAKRCVIVDDV
APT_MYCPN       ALASKTKLPLVLVRKPHKLSGELARETYDLEYRQNSILEMRVDAL---ENCKRCVIVDDL
                  :         .**  **.       *   *     : :               : **:

APT_CORGL       LATGGTLGAARKLIESCDGHVSGYVLAIEVPGLGGRD----NLGD--RPVIVVRDPQ---
APT_MYCTU       LATGGTIGATRRLLERGGANVAGAAVVVELAGLSGRA----ALAP--LPVHSLSRL----
APT_STRCO       LATGGTAEASLELIRRAGAEVAGLAVLMELGFLGGRARLEPALAG--APLEALLTV----
APT_MYCPU       LATGGTTKAIIDLLESQGAKVIKIILLLELTNLNGRS----KFGS--LQVESLVKVSV--
APT_BACSU       LATGGTIEATIKLVEELGGVVAGIAFLIELSYLDGRN----KLED--YDILTLMKY----
APT_STAAM       LATGGTIEAAIKLVEKLGGIVVGIAFIIELKYLNGIE----KIKD--YDVMSLISYDE--
APT_LISMO       LATGGTIEATIKLVEELGGIVAGCAFLIELKELEGHK----KLNG--YDRLILMKL----
APT_FUSNN       LATGGTVEATIKLVEELGGVVAGLAFLIELVDLKGRE----RLDK--YPMITLMQY----
APT_STRPN       LATGGTVKATIEMIEKLGGVMAGCAFLVELDELNGRE----KIGD--YDYKVLMHY----
APT_STRP1       LATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRH----AIRN--YDYKVLMQFPG--
APT_LACLA       LATGGTIAATIELVEKMGGIVVGCAFLIELDELKGRE----KIGD--YDYKVLMHY----
APT_ALKHC       LATGGTIEATVQMVEQLGGEVVGIAFMIELGYLNGRD----KLVT--YDVFSLTTYE---
APT_CLOAB       LATGGTINSVAKLVEALGGEVVAACFVVELTDLNGKD----KLGD--YDTMSLVKYNV--
APT_CLOPE       LATGGTIAAVAKLVEQAGGEVAGLAFTIELTELKGRD----KLKG--YEVTSLVDYDV--
APT_THEMA       LATGGTAEALIRLVKKLGGEVVSLAFLVELSYLEPRK----RLEG--YDVKTLIVY----
APT_CALS4       LATGGTVYASAKLVESLGGVVDSILFLTELTFLDGRK----KLDG--YDIISLIKF----
APT_BUTFI       IATGGTIEAACQLIEELGGEVSKIVFLMELAGLNGRE----KLK---YDVASVCYLRGKI
APT_AGRFC       IATGGTAEGAVKLLRQMGAEIVSACFVIDLPDLGGRK----KLEDLGVDVRTLVEFSGH-
APT_RHIME       IATGGTAEGAAKLLKQMGADIVAACFIIDLPELGGRK----KLEALGVNVRTLIEFEGH-
APT_RHILO       IATGGTAEAAVKLLRQIGADILAACFVIDLPDLGGRA----KLEALGVPVRTLIGFEGH-
APT_BRUME       IATGGTAEAAAKLLLQMGAEIVAACFIIDLPDLGGRK----KLEALGLPVRTLVAFEGD-
APT_NEIMA       VATGGTMLAGLELIRKLGGEIVEAAAILEFTDLQGGK----NIRASGAPLFTLLQNEGCM
APT_NEIMB       IATGGTMLAGLELIRKLGGEIVEAAAILEFTDLQGGK----NIRASGAPLFTLLQNEGCM
APT_PSEAE       IATGGTLLAAASLVRRLGARVFEAAAIIDLPELGGST----RLQDAGISTFSLTAFALDE
APT_PSEST       IATGGTLLAAAQLVRRMRANIHEAAAIIDLPELGGSQ----KLQDIGIPTFTLTAFALSD
APT_RALSO       IATGGTMMAGKRLLERLGATVVEGAAIVDLPELGGSR----LLMDGGLPLFTVCRFDGH-
APT_HELPY       LATGGTALASLELIKALQAECIEACFLIGLKELPGIQ----LLEE-RVKTFCLLEC----
APT_HELPJ       LATGGTALASLELIKALQAECIEACFLIGLKELPGIQ----LLEE-HVKTFCLLEC----
APT_ECOLI       LATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQ----RLEKQGITSYSLVPFPGH-
APT_ECO57       LATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQ----RLEKQGITSYSLVPFPGH-
APT_SALTI       LATGGTIEATVKLIRRLGGKVTDAAFIINLFDLGGEQ----RLEKQGITCYSLMPFPGH-
APT_SALTY       LATGGTIEATVKLIRRLGGKVTDAAFIINLFDLGGEQ----RLEKQGITCYSLVPFPGH-
APT_YERPE       LATGGTIEATVKLIRRLGGEVVHAAFIINLPELGGEA----RLTQQGIHCYSLVSFDGH-
APT_VIBCH       LATGGTIEATTKLIRQLGGEVEHAAFVINLPEIGGDK----RLEGLGLQVYSICEFEGH-
APT_HAEIN       LATGGTVEATVKLVQRLGGAVKHAAFVINLPELGGEK----RLNNLGVDCYTLVNFEGH-
APT_PASMU       LATGGTVEATVKLVQRLGGDVQDAAFVINLPDLGGEA----RLNALGIDAYTLVDFAGH-
APT_NOSS1       IATGGTASATAKLVQQIGCELVGFGFIIELRDLQGRK----HLPD--VPIISLVEY----
APT_SYNY3       IATGGTAKATAELLTKLGCEVLGFAFIIELAALNGRQ----CLPD--LPIISLVEY----
APT_TREPA       IATGGTLNAARTMLRAGGAEVVGFFAVVGLPFLRYHE----LIGD--LPVRTLIEYNQET
APT_BORBU       LATGGTLKSSAILLERAGGKVKDIFCFIELCAINGRQ----SLES--YEVNSLVRYN---
APT_UREPA       LATGGTVAAIENLVRQAKGIVAGSVYLIRLGFLKGEE----KLSG---KVHALINY----
APT_MYCGE       LATAGTVAAIDQLLKQLNGETVGYCFLIELKKLNGKA----KLQPNVVSKILLHY-----
APT_MYCPN       LATAGTVAAIDKLIARLGSQTVGYCFLIELQKLHGKA----KLQPNVATKILLHY-----
                :**.**  .   ::               .  :         :         :       

APT_CORGL       ------
APT_MYCTU       ------
APT_STRCO       ------
APT_MYCPU       ------
APT_BACSU       ------
APT_STAAM       ------
APT_LISMO       ------
APT_FUSNN       ------
APT_STRPN       ------
APT_STRP1       ------
APT_LACLA       ------
APT_ALKHC       ------
APT_CLOAB       ------
APT_CLOPE       ------
APT_THEMA       ------
APT_CALS4       ------
APT_BUTFI       ITDFLG
APT_AGRFC       ------
APT_RHIME       ------
APT_RHILO       ------
APT_BRUME       ------
APT_NEIMA       KG----
APT_NEIMB       KG----
APT_PSEAE       R-----
APT_PSEST       R-----
APT_RALSO       ------
APT_HELPY       ------
APT_HELPJ       ------
APT_ECOLI       ------
APT_ECO57       ------
APT_SALTI       ------
APT_SALTY       ------
APT_YERPE       ------
APT_VIBCH       ------
APT_HAEIN       ------
APT_PASMU       ------
APT_NOSS1       ------
APT_SYNY3       ------
APT_TREPA       SN----
APT_BORBU       ------
APT_UREPA       ------
APT_MYCGE       ------
APT_MYCPN       ------