CLUSTAL format seed alignment for MF_00009

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YBEY_TREPA      ----------------------------------MSEVNKV---SVSCE-------GFCP
YBEY_BORBP      ---------------------------------MSKSDLNL---LVENI------KFEHL
YBEY_LAWIP      -------------------------------------MAVI---LLGNE------HIWKL
YBEY_DESAG      -------------------------------------MIVI---TTRTG------AMTGF
YBEY_DESVH      -----------------------------------MSRLLV---DDPCR------AAWRL
YBEY_TROWT      ----------------------------------MTGLLYL---QNSSG------YNDCY
YBEY_STRCO      ------------------------------------MSIDV---NNESG------TEVDE
YBEY_BIFLO      ------------------------------------MSVDV---TNET-------QWVID
YBEY_MYCGA      --------------------------------------------MINHF------DLKKV
YBEY_RUBXD      ------------------------------------MPFRV---EVLNE------TSGGA
YBEY_PROMP      ----------------------------MYQKDLYDLQIDL---VFKCNDFSNLSNHFIN
YBEY_RICTY      -----------------------------------MINVEI---VRNYN------KWREH
YBEY_PROMA      ------------------------MQNLNDSSISVDLTIDL---SLSGFTFDLMKDSIDS
YBEY_SYNY3      ----------------------------MAPTSVNKIAVEL---SLQTDLTGSAMASSGV
YBEY_SYNPX      ------------------------------------MELDL---ALDAAG-----PWSPE
YBEY_THEEB      ----------------------------------MTVTVYL---EVHDP------ALPAE
YBEY_GLOVI      -------------------MARAYRLGEDLGTGAKCVKFLI---NLAST------PSMAV
YBEY_BDEBA      --------------------------------------MEV---LIVNE------SKHAA
YBEY_LACJO      -----------------------------------MNNLDI---SFNDE------VNFLK
YBEY_DEIRA      -------------------------------------MIDL---IARKR------PPAGL
YBEY_WOLPM      -------------------------------------MLEV---NILDK------KWCSI
YBEY_GLUOX      -----------------------------MEPPSRHAGTDI---IIEDA------RWRAS
YBEY_FRATT      -----------------------------MKRKLKMDNLNI---NFIND------DEHPI
YBEY_BUCCC      -----------------------------MNIKKNLMKIDI---QNVCK------KNIFF
YBEY_BUCBP      --------------------------------MNKKITLNI---QIASK------KIIFL
YBEY_BUCAP      ------------------------------MKKKNNIILTI---QKNCK------NTKNI
YBEY_WIGBR      ---------------------------------MNDNFLNI---QIECC------LYKQT
YBEY_ZYMMO      -----------------------------------MITVEA---DISD-------LWPEQ
YBEY_LEGPL      ------------------------------------MTYHI---DIQNA------TGKLL
YBEY_NEIMB      ----------------------MKRTKKYPFLTLQRQRFHL---NFENAS-----SAAGI
YBEY_COXBU      -----------------------------------MISIDV---QHATQ-------FEDL
YBEY_BLOFL      --------------------------------MVSRVILNL---QLVCA------NTQGI
YBEY_YERPS      ---------------------------------MSQVILDL---QIACA------DSQGL
YBEY_HAEIN      ---------------------------------MGSVLVDL---QIATE------NIEGL
YBEY_CAUVC      ----------------------------------MTITVDI---EIEDE------AWTTA
YBEY_XYLFT      -------------------------------MTRGPIFLNV---GISYGL-----PRTKL
YBEY_RALSO      MLALRPEHHDSITLRIEAEPAAEAEDADDALAGAEMLTLDL---TVQHGDALKAAARKAL
YBEY_RHOPA      -------MSQPRPGHRPDCNGADPDSNFASMTHSARPFTEV---VIEAD------CWQAE
YBEY_RUEPO      ------------------------------------MTLDL---TLEDP------RWTIL
YBEY_RHIME      ---------------------------------MTALDIQI---SVEAG------DWPPE
YBEY_BARQU      -----------------------------------MITIDI---TVESA------RWNNE
YBEY_GEOSL      --------------------------------------MKVAITNRQKR------HPIGT
YBEY_MYCH2      ------------------------------------MKAKI---NFLNQ------SRIKF
YBEY_THEMA      -------------------------------------MIRI---LGEGK------GSKLL
YBEY_HELHP      ----------------------------------MSIMPTL---DMDKD------TFTQV
YBEY_WOLSU      -------------------------------------MIDF---DNQTD------TNLDI
YBEY_LEPIN      ------------------------------------MNCKI---LFRKE-----------
YBEY_AQUAE      -----------------------------MSSTKRQKNRVL---VKLKK------RKVRK
YBEY_FUSNN      ----------------------------MELIVDFSSDLQTEKYNMFID------TLYEN
YBEY_CALS4      --------------------------------------MNV---LIDNR------QTKVD
YBEY_SYMTH      ------------------------------------MEIWV---NNDQE------IVEFT
YBEY_MYCPU      -----------------------------------MNIINI---TNKSNF-----RFMYK
YBEY_MYCPE      -------------------------------------MFDV---QIFDE------KKFLS
YBEY_UREPA      ------------------------------------MHFLI---TNEVK------KIFND
YBEY_MYCMS      -------------------------------------MIRI---NYFNE------NDINM
YBEY_MESFL      -------------------------------------MISI---DFINE------TDLKV
YBEY_LACPL      --------------------------------------MDL---ELYDQ------TTTGA
YBEY_ONYPE      --------------------------------------MII---KIHNQ------TSFCI
YBEY_STAES      -------------------------------------MFTI---DFSDH------TGLVE
YBEY_STRP8      --------------------------------------MYI---EMIDE------TGQVS
YBEY_PARUW      -------------------------------------MIVI---INASN------EQHDL
YBEY_CHLTR      -----------------------------------MLILDRSSPQIFIS------NEQQD
YBEY_CHLPN      ---------------------------------MTQEKIKI---HVSNE-------QTCI
YBEY_CHLFF      ---------------------------------MKKVPIKV---CVSNK------QKDVP
YBEY_RHOBA      ----------------------------MMEQPSTNLTADV---LIDEE------AEPDL
YBEY_CHLTE      ------------------------------------MPLQI---FNTTK------RTIDE
YBEY_CHLCH      ------------------------------------MSLEL---CNSTR------QAIPN
YBEY_BACTN      ------------------------------------MAVTY---QTEGV------KMPDI
YBEY_PORGI      -------------------------------------MAKI---NFYAE-------GVSL
                                                                            

YBEY_TREPA      PP---------WIGQ--------------------VAPFVCAVLDSQA--------ISHW
YBEY_BORBP      SV---------FHDF--------------------ILSVLNTL------------SISDF
YBEY_LAWIP      PF---------------------------------CRLEFVAILEKML------SFAKLQ
YBEY_DESAG      PL---------SRHD--------------------IRIALHSMLSCLG--------LSGA
YBEY_DESVH      PI---------ALRD--------------------ISGVFAAMQCATG--------LEGF
YBEY_TROWT      FK---------------------------------TESLVDFLYRTLF-------IDKGS
YBEY_STRCO      QA---------------------------------ILDIARYALARMR-------IHPLS
YBEY_BIFLO      PK--------VFSDL--------------------GIWVLDQMR-----------VSTQS
YBEY_MYCGA      PP--------SIKED--------------------FSEILKIINQCFS---SHFKVKNNL
YBEY_RUBXD      RL---------TPER--------------------ATELCRRAFVERG-----LDPERMG
YBEY_PROMP      KSDNIIFESGFWEEVL-------------------LCWIKIILDEKDTSFPNFILYKKSF
YBEY_RICTY      RK--------INKGL--------------------IKKITQNVLVRFD----HFDKIKQF
YBEY_PROMA      KMIDLIMDCDTWRNSI-------------------VSWFDCILMQPNLTCPQIVRKNRFF
YBEY_SYNY3      EE----LLTNPWQGW--------------------CQRWLEYLADCLP-------PASSY
YBEY_SYNPX      DPSSLIETQTWQITL--------------------VDWIQTICADPSLPCPALVCQADEV
YBEY_THEEB      VT---------ALPW--------------------ERWFRTWMAMVEP------TQGKVY
YBEY_GLOVI      VP---------TAVELCIQAAVDDPVGEARWQSWFDQWLLELQ------------SAGAV
YBEY_BDEBA      PR-----------KF--------------------IQTWMQLVVTELKRKKVLKAEQARR
YBEY_LACJO      DS---------DKDW--------------------ITWISNLLLSAKK----EIHKENTQ
YBEY_DEIRA      RP--------------------------------ALRASLSAAMQHFG--------GEER
YBEY_WOLPM      IE--------NPKNF--------------------VLGVINASLKELK------IDHYKP
YBEY_GLUOX      VP--------GTERA--------------------IRRALVAVARQGG-----PDFTQSP
YBEY_FRATT      PS----------QDL--------------------LLKCLQLVANKHH--------ISHA
YBEY_BUCCC      PK---------KKYF--------------------FLWLKNIF------------KNKKI
YBEY_BUCBP      PK---------KCQY--------------------LIWIRSSLMHV---------YQSNI
YBEY_BUCAP      PK---------KYIF--------------------EKWIKKVLYK----------KKNVN
YBEY_WIGBR      PS---------IDKF--------------------KFWIKSIFLH----------FKKVS
YBEY_ZYMMO      SN---------WEALAQTA----------------CQQAVSVSASDFL-----LAKDYET
YBEY_LEGPL      PL---------SEDE--------------------ITKLASLALRD---------HKQDA
YBEY_NEIMB      PA---------ERDF--------------------YRWAWSALKNEYR----------RA
YBEY_COXBU      PS---------LSNI--------------------EQWVETALQFIVT-------DKNKS
YBEY_BLOFL      PA---------NNKI--------------------KLWIKKIFFS----------SKKKI
YBEY_YERPS      PT---------EGDF--------------------QRWLEAVLPL----------FQPVS
YBEY_HAEIN      PT---------EEQI--------------------VQWATGAVQP----------EGNEV
YBEY_CAUVC      EA---------DAEA--------------------LVWRAAQAVLDAH------EDIEGQ
YBEY_XYLFT      PA---------AVSF--------------------RKWVAATLQGRIR----------KA
YBEY_RALSO      PK---------QKDI--------------------EAWIAPALFA-------------DA
YBEY_RHOPA      AS---------AEAT--------------------VLRAIETAADAVD------ADTGGA
YBEY_RUEPO      PP------------L--------------------ADRAISATLAQMG------LDPELC
YBEY_RHIME      DE---------LQSF--------------------CERVLEAAADFLAREENQPLPAQAA
YBEY_BARQU      KM---------LYDI--------------------TEKALKTTMNHLS------LENVVS
YBEY_GEOSL      RR---------------------------------LRKVAETILGALG--------YPDS
YBEY_MYCH2      KY----------LKL--------------------FRKIFKLLVEKEQ-------ITGEI
YBEY_THEMA      EN---------------------------------LKEKLEEIVKK---------EIGDV
YBEY_HELHP      GY---------LYNL--------------------LDKIGHLGLFERD--------LSCY
YBEY_WOLSU      TL---------------------------------LESIATFL--------------SPR
YBEY_LEPIN      ------------------------------------------------------LNDSEC
YBEY_AQUAE      DK---------I-----------------------EKWAELALSAL---------GLNNV
YBEY_FUSNN      NH---------LENY--------------------IKKVLNLEKIE---------SDRPL
YBEY_CALS4      AS--------GLEAL--------------------VVRAIKATLEEEE-------VVDEV
YBEY_SYMTH      EE---------HEEL--------------------IRRVAERALELAG-----AGLGSNV
YBEY_MYCPU      KE---------------------------------FLKIMDIIQEKFN-------FKKRI
YBEY_MYCPE      KK---------DISL--------------------IKKVSKFIFIEEK-------LKNKI
YBEY_UREPA      KL---------YSQR--------------------FKQITDLVSTKLN-------IDKKR
YBEY_MYCMS      DF---------WKKF--------------------CNKILKTAYNYFN-------FNYDI
YBEY_MESFL      KE---------WEDL--------------------AKQIINSGFKYLK-------LKNKI
YBEY_LACPL      QP--------EQLQL--------------------IRDLIDLAGQTLK-------LRDDT
YBEY_ONYPE      TP---------------------------------FKSLLIKMFLP---------IKEKK
YBEY_STAES      TS---------WFDQ--------------------IDQLLTFAKKKEN-------IHNDA
YBEY_STRP8      QE---------IMEQ--------------------TLDLLNFAAQKTG--------KEEK
YBEY_PARUW      KF---------SLAN--------------------LDAIVKEVIQKEQ--------QTCD
YBEY_CHLTR      VS---------IDLQ--------------------SAQRLVVLFLELQ-------KVSTD
YBEY_CHLPN      PI---------HLVS--------------------VEKLVLTLLEHLK--------VTTN
YBEY_CHLFF      IR---------------------------------VQSAKKLVLCCLQ-----YWKITTD
YBEY_RHOBA      SI---------WFG---------------------CLETARTELAQAAIAAAAVEGCDRG
YBEY_CHLTE      TL---------------------------------LAEVIRLVIGEEG--------GAVG
YBEY_CHLCH      KR---------------------------------LLQAIRMVVQGEG--------YEIA
YBEY_BACTN      KK----------RET--------------------TEWIKNVAASY---------GKRLG
YBEY_PORGI      PR---------IRRRIV------------------GKWIAEVCSRY---------GKAVG
                                                                            

YBEY_TREPA      DLSIVCCTDAFIRRLNYDYRGIDSPTDVLSFE---NDGEYCDDAGTRF------------
YBEY_BORBP      ELSVILCDNVYIQKLNNKFRNKNEPTDVLSFN---YNELNEGLVGGIN------------
YBEY_LAWIP      TIEVYLVSDTTIAFFNLHYMNCLGITNVLSFP---MDD--EDLA----------------
YBEY_DESAG      HVEVILTDDGESAQLNREFLGCYGPTNILSFP---AAG--PVAAPRQEPDSPPACRKDSS
YBEY_DESVH      EVELTIADDALIAMINEEQLGCIGPTNILSFP---AYGAPPDYPADGM-----ECGTGQD
YBEY_TROWT      YLGVSFITAAEMRDLKIKHFGVNEDSDVLSFP---IDEIAPGSENSLV------------
YBEY_STRCO      ELSVIVVDAEAMEQLHIQWMDLPGPTDVMSFP---MDELRPPSKDEEE------------
YBEY_BIFLO      DLTIMFVDPDPIAELHMRWMNLEGPTDVMSFP---MDELRPGDGKTVM------------
YBEY_MYCGA      FYELSFVSEKQSLQLNSSLRNKEYVADIISVC---LWE--NAEIITPL------------
YBEY_RUBXD      ELSVALVEPEVIHDLNLKFRNKDAPTDVLSFE---VDGPYGEMV----------------
YBEY_PROMP      SLSLQIINDNEISSINQKWMNKSGSTDVLSFP---IIS--DEDTTKDL------------
YBEY_RICTY      ELSILLTNTAEILTLNQQFRSIEKATNVLSFP---NNELNWHNLYSKL---------EFL
YBEY_PROMA      SMGLLFTNDLSIRQMNKEWRKKDESTDVLSFP---AID--EHIVLPPN------------
YBEY_SYNY3      ELTLLFTGDRRIQELNRKFRHQDKPTDVLAFA---ALEGDFPLIESEE------------
YBEY_SYNPX      SLGLRFTDDATITALNSTWRQRNQATDVLSFA---ALEEAPGLPDVSC------------
YBEY_THEEB      ELTLRLTTDAAIQALNQQYRDRDTPTDVLAFA---TRD--GALPLPLG------------
YBEY_GLOVI      ELTLRLTDDAEIRRLNARFRGVDAPTDVLSFE---FEADDTQALIAEE------------
YBEY_BDEBA      ELTLVFLDKKPAQKINMEFRGKNYATDVLSFD---SMD--PGSL----------------
YBEY_LACJO      EMSINFVSSKKIHEINKKYRGKDRPTDVISFA---IEDGLDEDFISAF----------SD
YBEY_DEIRA      EVTVVLVGDPEIRALKLEHWGEDAATDVLSFP---TWEPGDPFMPPHL------------
YBEY_WOLPM      NISIALADDDLLHQLNLKFREMDKPTNVLSFP--------YEQLSNEC------------
YBEY_GLUOX      APSILLATDRIVKRLNARFRDKNKPTNVLTF---------EPLSPMHG------------
YBEY_FRATT      EVNLNIVSNDEIQQINKQFRNKDKPTNIISFE---FEK--PQGLPDDI------------
YBEY_BUCCC      EITIRIVDMLEMKFLNKKYKKKNSLTNVLSFQ---SPD--SIKIKHRF------------
YBEY_BUCBP      KVLIRIVEKSEIKSLNYKFRQKNKATNILSFS---YIN--DKMIDKNY------------
YBEY_BUCAP      LINIRIVDEREMKNINLKYRGKNKSTNILSFK--------FDLFINKN------------
YBEY_WIGBR      EINLRLVEKKEIKNLNKKFLKKNYPTNILAFP---CIM--PNNDQISF------------
YBEY_ZYMMO      EISVCFSDNDTVHALNKTWRDKDRPTNVLSFP---MME--AEELAEIK-----NRVGSE-
YBEY_LEGPL      ELTVRLVDVEEMTYLNHTYRKKNKPTNVLAFP---CSL--PANIELEC------------
YBEY_NEIMB      DISLILLDEEEARAYNRDYRGKDYATNVLSFA---LNE--GEILPCQV------------
YBEY_COXBU      ALTIRFIDKEESTELNEHYRHKKGPTNVLSFP----DEPIPGFPSESF------------
YBEY_BLOFL      ELTIRIVDIQEMLYLNWYYLGKKYPTNVLSFP---FEP--PSEIQTSL------------
YBEY_YERPS      EVTIRLVDEAESHDLNLTYRGKDKSTNVLSFP---FEA--PPEIELPL------------
YBEY_HAEIN      EMTVRIVDEAESHELNLTYRGKDRPTNVLSFP---FEC--PDEVELPL------------
YBEY_CAUVC      GIVILLTDDDSVQALNRDFRKKDYATNVLSFP--------SPPNPEGQ------------
YBEY_XYLFT      DLAIRIVDEKEGRALNYHYRNKDYATNVLSFP---AQL--PEPFPKAL------------
YBEY_RALSO      QLNVRFVDEEEGRTLNHTYRGKDYATNVLTFS---YAETEDDPVA---------------
YBEY_RHOPA      ELAVMLTDDDHIRQLNASFRGKDKPTNVLSFP---AAQ--PEVQPDGA------------
YBEY_RUEPO      EISLLGCDDARITALNAEFREKPSPTNVLSWPAEDLAAETPGGTPLAP----------EP
YBEY_RHIME      ELSLVFTDDQSIRAINAEWRGQDKATNVLSFP---AFPVTPGRMPGPM------------
YBEY_BARQU      EISLLFTDDKHMAQINAQWRNKNKSTNVLSFP---ALPLKAGDPPGLM------------
YBEY_GEOSL      ELSVVITGDLGIRRVNRDYLGKDRPTNVISFA---MGEGDFGDLNPDV------------
YBEY_MYCH2      SLDLMLITQRKAQKLAIKFKNINYIPDVLSFPSNLIIA--KKNFRLHF------------
YBEY_THEMA      HVNVILVSEDEIKELNQQFRGQDRPTDVLTFP---LME--EDVY----------------
YBEY_HELHP      MLEVLAVDSQNMREINFAHRAKNSTTDVLSFP---LDV--SEGADSHI-----------L
YBEY_WOLSU      EVELILLDDEAMRKINQEHRGIDKSTDVLSFP---LEG--GDFLPL--------------
YBEY_LEPIN      ELSLLLVGDSDMKEINRLRRGKDKTTDVLSFP---L-E--FDFSPLQK--ILPKNTSSDQ
YBEY_AQUAE      ELSVYITDDQEIRELNKTYRKKDKPTDVLSFP---MGEEFGGYKIL--------------
YBEY_FUSNN      YLSLLLTDNENIQVINREYRDKDAPTDVISFA---YHE--TEDFNIGS------------
YBEY_CALS4      EVSVSFVDNEEIRKLNKYYRGIDSSTDVLSFP---LME--FEEIEEGE--------EDEK
YBEY_SYMTH      SVSVTLVDDETITDLNRDHRGLASPTDVLSFS--QLEGEDMGDLPEGE------------
YBEY_MYCPU      SVDLLITDNKEVRENNLLYRNVDKETDVLSFP---FGD--PDFFDHLD------------
YBEY_MYCPE      IFELHIIDNNESQKINKQYRNKDYPTDVISFS---FWE--EGLLKTAL------------
YBEY_UREPA      FFECHFVDEKTIQEINKNYRNKDYITDVISFA---FDD--GEIITPLL------------
YBEY_MYCMS      ELSITFVNDLKAQQINQQYRNHSYIADVTSFP---VEMTENEIKAIGF------------
YBEY_MESFL      NLSITFLDSEPAQKINQEYRNHSYIPDVTSFP---IEMSPQEIKALGY------------
YBEY_LACPL      EVSVTLMNNDAIQKINEQYRGVDRPTDVISFA---MHDDDEDDLIVMD---------PEM
YBEY_ONYPE      LMHLIFVTNEKIQELNSFYRQKNYPTDVLSFP---NDLTFFAGLEDNS------------
YBEY_STAES      ELSVTFVDKDEIQNINKVYRDKDKVTDVISFA---LEEDEPEIDFNDF------------
YBEY_STRP8      EMSVTFVTNERSHELNLEYRDTDRPTDVISLE---YKPETPILFSQED--LAADPSLAEM
YBEY_PARUW      EVNIYFVDTATICKLHLDYFNDDTPTDCISFP---MDK--DENSPYKI------------
YBEY_CHLTR      QVYVYFLDDTALAQLHDEQFSDPSPTDTITLP---IDK--PGIASFPH------------
YBEY_CHLPN      EIFIYFLEDKALAELHDKVFADPSLTDTITLP---IDA--PGDPAYPH------------
YBEY_CHLFF      QVYIYFLDDKALAQIHDEVFSDPSLTDTITLP---IDS--PGISSHPH------------
YBEY_RHOBA      SVGVRICDDATIHPINREFLQHDYPTDVISFP---YEL--EPPMVE--------------
YBEY_CHLTE      SIEAIYCGNKMIRRINRDFLGHDYVTDTITFG---YNE--GGEVD---------------
YBEY_CHLCH      TITGVYCGNRMSQRINRDYLNHDYPTDTITFC--------YSEGKAIE------------
YBEY_BACTN      EIAYIFCSDEKILEVNRQYLQHDYYTDIITFD---YCQ--GDRLS---------------
YBEY_PORGI      EISYLFCDDEYILKANQEFLDHDYYTDIITFD---SCE--ADTVN---------------
                                         .:  :                              

YBEY_TREPA      -----FLAGDIIISLESVRENSERF--HVAA---HEEFKRVLIHGILHLSGMDHQ--DNS
YBEY_BORBP      ----YKIQGDLIISFEYLKFSAQEF--NVEI---YEELQRVTIHGILHLMGHNHE--TND
YBEY_LAWIP      --------GSIILSVDAVCRESLLY--RQPI---LDYCLSLLSHGIAHIAGYTHG-----
YBEY_DESAG      HAEDDTDLGVLALSTGAVHRESFLY--GQPP---HRHALRLLAHGLLHLAGYDHG-----
YBEY_DESVH      AHTSLPLLGSLVLSVDTLRREAFLY--GQPV---QEHCLRLLAHGLGHIAGYDHG-----
YBEY_TROWT      ----YGVLGDIVVCPETVMRQAV----RHPF---EHEIYLLVVHGFLHLLGFDHS--DAP
YBEY_STRCO      --APQGLLGDIVLCPEVAAKQGAEAPTEHSM---DEELQLLTVHGVLHLLGYDHE--EPD
YBEY_BIFLO      ----EGVLGDIVICPWVAAQQAAAA--GHST---MQEMLLLTIHGILHLLGYDHV--TPE
YBEY_MYCGA      -------LGEIFICSKKIAKDAIKY--DVNF---WYLLIRMIIHGLLHLLEFDHE--QSD
YBEY_RUBXD      --------GEIVICPGCAEMDLEE----------------LVVHGALHLSGMDHG--ENF
YBEY_PROMP      ---NFIELGDLFISLETAFKQSLEF--NHSI---KKEMLWLASHGLLHLLGWEHN--DDY
YBEY_RICTY      YYSDYMHLGDIAFCYEVIYNESCEQ--QKTF---ENHFIHMLIHSILHLIGFDHQ--NDT
YBEY_PROMA      ---QFLELGDIIVSVETAFKQAKIH--NHSL---MHELRWLVSHGFLHLLGWDHP--SSA
YBEY_SYNY3      -TEEPLYLGDIVISLERADHQARER--GHSA---KLEVVWLTAHGLLHLLGWDHP--DEA
YBEY_SYNPX      -----VELGDIVISLDTARRQASEH--GHNL---TRELRWLVSHGLLHLLGWDHP--DEE
YBEY_THEEB      ---EPEYLGDIIISGDTARRQAAES--GHTL---SIEIAWLACHGLLHLLGWDHP--DEA
YBEY_GLOVI      ----PLYLGDIVVSVPTATRQAREF--GHTL---EVELAWLAVHGLLHLLGWDHP--DEQ
YBEY_BDEBA      --------GELVLCPEVLKRQSKEH--GLTY---QQELGYMLLHGVLHLLGYDHE--TSE
YBEY_LACJO      DPDFVEDIGDLFLCPEVIKRHSVEY--ETGF---NREFGYTLVHGYLHLNGYDHI--EDD
YBEY_DEIRA      --------GDIIISLDTAQRQAESR--GHSL---TREVALLASHGLTHLVGHDHP--HAE
YBEY_WOLPM      ------DLGDIAISIDTIKRESHEY--YIPI---LAHIAHMLVHGLLHLLGYDHQ--KKD
YBEY_GLUOX      --------GDIVLGYETVRREAAAA--RRSL---RAHLSHLVVHGALHLAGYDHH--HPG
YBEY_FRATT      ---ANDFLGDIVIAPAVLENEAKEQ--NKEL---NDHWQHIFIHGLLHLLGYDHQ--DDQ
YBEY_BUCCC      ---L-NYIGDIILCAPYINKEANIL--KKKK---IELWAHMTIHSTLHLLHYSHK--DSK
YBEY_BUCBP      -------IGDLIICSEIVTEEAKKK--NVTL---ESHWAHITIHGILHLLGYNHD--NLN
YBEY_BUCAP      ----QTLLGDLVLCKKIIEKESLKY--QKTL---ESRWAHMIIHGTLHLLGYDHK--NKK
YBEY_WIGBR      -------LGDLVVCSEIVEKEAKNQ--NKSV---ESHWAHIIIHGTLHLLGYDHS--NNS
YBEY_ZYMMO      -----CLLGDIILAFDVAKKEALEK--GISL---ENHVTHLITHGTLHLLGYDHI--LDN
YBEY_LEGPL      -----PLLGDVVICPEVLLAESAQF--NKSL---HAHWSLILIHGVLHLLGYDHI--KDE
YBEY_NEIMB      ---SEKLYGDLIICPQVVLKEAAEQ--GKTP---EQHFAHLTIHGTLHLMGYDHI--EDD
YBEY_COXBU      --------GDLAICAPLVAEEAHAQ--HKTT---EAHFAHLITHGFLHLLGYDHV--ENE
YBEY_BLOFL      -------LGDIVICKQIIEYENRKN--NIFS---DVHWAHMIIHGSLHLLGYDHI--CDE
YBEY_YERPS      -------LGDLIICRQVVEKEAIEQ--EKAL---LAHWAHMVVHGSLHLLGYDHI--DDD
YBEY_HAEIN      -------LGDLVICRQVVEREASEQ--EKPL---MAHWAHMVVHGSLHLLGYDHI--EDD
YBEY_CAUVC      -------IGDIALAYGVCAREAAEQ--GKPL---AHHLQHLVAHGVLHLLGYDHE--RDD
YBEY_XYLFT      ---KIPLLGDIVMCAPVIAREATEQ--GKSL---SAHYAHLTVHGTLHLLGWNHE--DHQ
YBEY_RALSO      --------ADIVLCCPVVEQEAKDQ--GKPL---RAHYAHLIVHGALHAQGYDHE--DPA
YBEY_RHOPA      ----PRMLGDIAIAYQTVRREADDE--GKPF---DHHLSHLAVHGFLHLVGYDHE--TEE
YBEY_RUEPO      DFTGAVPLGDIAIAFDTCQREADAA--GKPI---ADHVTHLIVHGLLHLLGYDHI--RDE
YBEY_RHIME      -------LGDIVVAHETLRREAAEL--EKPF---DAHLTHLLVHGFLHLFGYDHI--EDD
YBEY_BARQU      -------LGDIIIAQETVVLEAKKE--GKSF---QDHLTHMIVHGILHLLGYNHE--TND
YBEY_GEOSL      -------LGDVIISADTAAREAEEA--GIAF---WSRLCFLLLHGTLHITGYDHERSGEA
YBEY_MYCH2      -------LGEIFMTPAKIIKQANEY--GHSE---EREFSYLFVHSIYHLLGFDHQ--DEK
YBEY_THEMA      --------GEIYVCPLIVEENAREF--NNTF---EKELLEVVIHGILHLAGYDHEF-EDK
YBEY_HELHP      AKQMKICLGSVVINYELAQKVAKQR--GHST---QDEISLLFIHGFLHILGYDHE--VDN
YBEY_WOLSU      --------GSILLSIDRVRAEAELR--GHSI---EAEAALLFIHGMLHLLGYDHE--YDQ
YBEY_LEPIN      KMFPPIALGEIVISIDTLQKQAKEI--GHSE---KDEFYRLLVHGFLHLLGYDHER-GDK
YBEY_AQUAE      --------GDVVISQDTAERQAREL--GHSL---EEEVKRLIVHGIVHLLGYDHEK-GGE
YBEY_FUSNN      ----YDTLGDIIISLERVEEQASEY--NHSF---EREFYYVLTHGILHILGYDHI--EEE
YBEY_CALS4      DAEEIYPIGDIVISLEKAKEQAEEY--GHSF---EREVAYLTVHSMLHLLGYDHE--TEE
YBEY_SYMTH      ----PMPLGDIVISLERCVSQAAEY--GHSF---ERELGFLTAHGMLHLMGWDHQ--TPE
YBEY_MYCPU      ----FIPLGSIIISHEKIVAQALEF--NHSK---KREFCYLFTHSLLHLLGYDHK--EED
YBEY_MYCPE      -------LGEIYLSYEKVVSQAEEF--KHSF---ERELGFLVSHGIYHLLGYDHE--EED
YBEY_UREPA      --------GEMYICYQKVVDQASQF--AHSF---ERELCFLFTHGLLHLLGYDHI--KIE
YBEY_MYCMS      -----RELGDMFINLNEAKRKAIKY--NHDL---NSEMGFLFVHGFLHLLGYDHE--DSN
YBEY_MESFL      -----QEIGDIFICIEEAERKSIKY--DHSL---KEEMGFLFTHGFLHLMGYDHET-NEK
YBEY_LACPL      AAEMPLNLGDIMISVDKVSEQAAFL--NHSE---ARELGYLVVHGFLHLNGYDHL--QPA
YBEY_ONYPE      -------LGDVFISFSKAQVQAQTA--KHSL---EREIAFLAVHGFLHLKGYQHR--TEE
YBEY_STAES      --DIPRVLGDIIICTDVAKEQSESY--GHSF---ERELGFLALHGFLHLLGYDHM--NDN
YBEY_STRP8      MAEFDAYIGELFISIDKAREQSQEY--GHSF---EREMGFLAVHGFLHINGYDHY--TLE
YBEY_PARUW      -------LGEIFVCPQTAIEYALSH--ELDP---YEETTLYLVHGLLHLMGYDDL--EEN
YBEY_CHLTR      ------VLGEAFVSPKAAMRFLEQY-TEDQL---YHEISRYVVHSLLHMLGYDDQ--TDE
YBEY_CHLPN      ------VLGEAFISPQAALRFLENT--SPNQEDIYEEISRYLVHSILHMLGYDDT--SSE
YBEY_CHLFF      ------VLGEAFISPKAAIRFLKDR--SQDSDLLYEEISRYVVHSLLHMLGYDDQ--TPE
YBEY_RHOBA      --------GELVASFETAIENASEP--SNPLSP-REELLLYVVHGTLHIVGHDDQ--SPE
YBEY_CHLTE      --------GEFYISLDVIESNARRF--GVSF---EDELLRVTIHSALHLMGYDDE--TSE
YBEY_CHLCH      --------GEFYISLDVIRCNARHF--NVTF---EEELLRVTIHSALHLTGMNDY--LPE
YBEY_BACTN      --------GDLFISLDTIRTNAEQF--GAAY---DDELHRVIIHGILHLCGINDK--GPG
YBEY_PORGI      --------GDLLISLDTVRSNARAL--DLRY---EDELHRVIIHGILHLCGLKDK--SKK
                        .                                  *.  *            

YBEY_TREPA      PG-QEMLRLQ-ERILAQHCRV------LSSGIPWES------------------------
YBEY_BORBP      FQKEGMLILQ-ENVLR------------KNKRVF--------------------------
YBEY_LAWIP      ---VEMDKFC-SNLLL---PF-------KLA-----------------------------
YBEY_DESAG      ---PQMDDMT-ETLMQCATGK-------AAADTVVTGF----------------------
YBEY_DESVH      ---AEMEAFE-EAAREAALAT-------RTAR----------------------------
YBEY_TROWT      SK-KEMFSLQ-AKLIEDFFAL------ENLGTPSEEITITPDLRPSLGRI----------
YBEY_STRCO      EK-AEMFGLQ-AAIVD---GW---RAEKGLTGPSPAPTVS--------------------
YBEY_BIFLO      QE-RQMFGLQ-RQLLL---TFFALRHDANVQATLPAGTPDALALYDAAHGAGRDLDSK--
YBEY_MYCGA      AYEYVTLTIQ-EQIVNKVIKT-------AKKKIWKNQELLSLLG----------------
YBEY_RUBXD      EA-SEMARVQ-KRVME---AV-------RGR-----------------------------
YBEY_PROMP      EL-DNMLNFQ-EYLIS---KL-------D-------------------------------
YBEY_RICTY      DA-NIMESLE-IEILS---YF-------GIPSPY--------------------------
YBEY_PROMA      SL-NEMLSFQ-ELLLKTPNGS-------PLRNSMRDY-----------------------
YBEY_SYNY3      SL-TTMLSEQ-SHLLT---LI-------GQNPPLFT------------------------
YBEY_SYNPX      SL-VAMLQLQ-EQLLDGGSNV-------RIRDPHSVDTTVDVNAH---------------
YBEY_THEEB      EL-ARMLTQQ-AQCLE---AV-------GLTPPAALQ-----------------------
YBEY_GLOVI      SW-RAMVTQQ-ARLLK------------GVNVVYDWPSVYPVG-----------------
YBEY_BDEBA      AEALEMFGIQ-DAAFE---VL-------LKKVSAK-------------------------
YBEY_LACJO      EA-KVMFGIQ-GKVLR---EY-------GLPLHPDQENHGKQIH----------------
YBEY_DEIRA      GL-GFEEGAT-GEDWQ------------VFHDAWAAAQTGLPAGA---------------
YBEY_WOLPM      EE-IIMKNLE-REILA---SL-------GYNMCAI-------------------------
YBEY_GLUOX      EA-REMEGIE-TRTLR---SL-------GFGDPWRQGNWQQAGSVRI-------------
YBEY_FRATT      EA-EVMENLE-IQLLA---QL-------GIANPYIEQENQNGR-----------------
YBEY_BUCCC      SK-KNMQKTE-IYIMK---KL-------GYNNPYN-------------------------
YBEY_BUCBP      NR-IKMEYLE-TKIMA---SL-------NYKNPYIY------------------------
YBEY_BUCAP      EK-KIMEKIE-NKIML---FL-------NYEKPYFMKSS---------------------
YBEY_WIGBR      NKIEEMEILE-IKFLN---LF-------GYHNPYF-------------------------
YBEY_ZYMMO      EA-EIMEDLE-RKALA---QL-------DIPDPYSDHETGKEGLDG--------------
YBEY_LEGPL      EA-SIMQMLE-AKLLA---EL-------GYANPYEVEENELE------------------
YBEY_NEIMB      EA-EIMEAEE-IRLMR---AA-------GFPNPYQED-----------------------
YBEY_COXBU      DA-EEMENLE-IKILS---QL-------GFENPYEE------------------------
YBEY_BLOFL      DA-ELMNAME-LNIIR---TL-------GYKTCCFL------------------------
YBEY_YERPS      EA-EEMELIE-TEIMH---GL-------GYPDPYISEKDPD-------------------
YBEY_HAEIN      EA-EEMESLE-TQIMQ---GL-------GFDDPYLAEK----------------------
YBEY_CAUVC      EA-EAMEALE-REILA---GL-------DVPDPYASDEEGR-------------------
YBEY_XYLFT      EA-DAMEQLE-REILA---NL-------GISDPYLGEY----------------------
YBEY_RALSO      QA-EEMEGIE-TEVLA---GL-------GFPDPYADR-----------------------
YBEY_RHOPA      EA-EEMEDAE-RAILA---RL-------GIPDPYAGQDRVS-------------------
YBEY_RUEPO      DA-TLMEGLE-TRILG---NL-------GIDDPYTME-----------------------
YBEY_RHIME      EA-ERMEGLE-TRILA---RL-------GLSDPYGDQPPH--------------------
YBEY_BARQU      EA-CQMEELE-REILL---KL-------SINDPYAELS----------------------
YBEY_GEOSL      EA-RRMEAKE-REIFA---LL-------ENGGLV--------------------------
YBEY_MYCH2      TN-KLMDEKV-ENILI---NL-------GINR----------------------------
YBEY_THEMA      NS-KEMFEKQKKYVEE---VW-------GEWRSNPSEDSDPGKR----------------
YBEY_HELHP      GE---QRALE-QKIIE---SL-------GLKESLIVRNTT--------------------
YBEY_WOLSU      GE-QRFKE---EELIT---RF-------GLPSSLIVRTEEL-------------------
YBEY_LEPIN      EE-HIMKLKE-DECLE---IL--------QGL----------------------------
YBEY_AQUAE      EE-KKFRELE-NYVLS---KL-------SKAL----------------------------
YBEY_FUSNN      DK-KLMRERE-EAILS---SF-------GYTRDK--------------------------
YBEY_CALS4      ER-KLMREKE-EKVME---RL-------GLRR----------------------------
YBEY_SYMTH      DE-ARMMAKT-EEILA---GL-------GLSR----------------------------
YBEY_MYCPU      EE-KIMNQYT-KEIVE---KL-------NIYR----------------------------
YBEY_MYCPE      EA-KIMFGKQ-YQVLK---LC-------GLGSVND-------------------------
YBEY_UREPA      DE-KIMFALQ-DEILN---EL-------KITRNINGARND--------------------
YBEY_MYCMS      DE-KIMFDLQ-DQILK---LN-------NLEYIIKFNEDDYLESN---------------
YBEY_MESFL      DE-EEMFFIQ-DEILK---IN-------KINYTIKFTEEDYKEIEEKDE-----------
YBEY_LACPL      DE-TEMFTLQ-RQILD---AY-------GLEK----------------------------
YBEY_ONYPE      EF-QIMLALQ-EKILQ---NV-------GLNLDKTT------------------------
YBEY_STAES      DE-KEMFGRQ-DAILN---EF-------GLTRN---------------------------
YBEY_STRP8      EE-KEMFTLQ-EEILT---AY-------GLTRQ---------------------------
YBEY_PARUW      DF-LIMKEAE-IRHMT---HL-------KKLELYIK------------------------
YBEY_CHLTR      DK-RIMQEQE-DVSLS---FL-------AEHQALLRPAV---------------------
YBEY_CHLPN      EK-RKMRVKE-NQILC---ML-------RKKHALLTA-----------------------
YBEY_CHLFF      ER-KKMRVKE-NQALC---ML-------REKHALLSD-----------------------
YBEY_RHOBA      PR-AAMRRAE-IAAMK---LI-------GIELPLSNDEDSAPEQDDSFDDDASDSSGGIM
YBEY_CHLTE      LR-AAMSLRE-DHYLY---RL-------RH------------------------------
YBEY_CHLCH      ER-VAMQAKE-DYYLQ---LL-------KTQKSISPQKSTDNAIFSCNS-----------
YBEY_BACTN      ER-EIMEEAE-NKALA---MR---------------------------------------
YBEY_PORGI      DE-AQMRAAE-EKALV---ML-------RETIGSELSLLHT-------------------
                                                                            

YBEY_TREPA      -----
YBEY_BORBP      -----
YBEY_LAWIP      -----
YBEY_DESAG      -----
YBEY_DESVH      -----
YBEY_TROWT      -----
YBEY_STRCO      -----
YBEY_BIFLO      -----
YBEY_MYCGA      -----
YBEY_RUBXD      -----
YBEY_PROMP      -----
YBEY_RICTY      -----
YBEY_PROMA      -----
YBEY_SYNY3      -----
YBEY_SYNPX      -----
YBEY_THEEB      -----
YBEY_GLOVI      -----
YBEY_BDEBA      -----
YBEY_LACJO      -----
YBEY_DEIRA      -----
YBEY_WOLPM      -----
YBEY_GLUOX      -----
YBEY_FRATT      -----
YBEY_BUCCC      -----
YBEY_BUCBP      -----
YBEY_BUCAP      -----
YBEY_WIGBR      -----
YBEY_ZYMMO      -----
YBEY_LEGPL      -----
YBEY_NEIMB      -----
YBEY_COXBU      -----
YBEY_BLOFL      -----
YBEY_YERPS      -----
YBEY_HAEIN      -----
YBEY_CAUVC      -----
YBEY_XYLFT      -----
YBEY_RALSO      -----
YBEY_RHOPA      -----
YBEY_RUEPO      -----
YBEY_RHIME      -----
YBEY_BARQU      -----
YBEY_GEOSL      -----
YBEY_MYCH2      -----
YBEY_THEMA      -----
YBEY_HELHP      -----
YBEY_WOLSU      -----
YBEY_LEPIN      -----
YBEY_AQUAE      -----
YBEY_FUSNN      -----
YBEY_CALS4      -----
YBEY_SYMTH      -----
YBEY_MYCPU      -----
YBEY_MYCPE      -----
YBEY_UREPA      -----
YBEY_MYCMS      -----
YBEY_MESFL      -----
YBEY_LACPL      -----
YBEY_ONYPE      -----
YBEY_STAES      -----
YBEY_STRP8      -----
YBEY_PARUW      -----
YBEY_CHLTR      -----
YBEY_CHLPN      -----
YBEY_CHLFF      -----
YBEY_RHOBA      SGGVS
YBEY_CHLTE      -----
YBEY_CHLCH      -----
YBEY_BACTN      -----
YBEY_PORGI      -----