CLUSTAL format seed alignment for MF_00010

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y2004_NITHX      -------MITSAAYVGAAVAEIAGCFAFWAWLRLGKSVWWLAPGMVSLALFAYLLTLVDS
Y1459_NITWN      -------MITPAAYVGAAIAEIAGCFAFWAWLRLGKSVWWLVPGMASLALFAYLLTLVDS
Y2370_RHOP2      -------MNTAIIYVGAAIAEIAGCFAFWGWLRLGKPVWWLAPGLLSLALFAYLLTLVES
Y3084_RHOPS      -------MKSPIIYVCAALAEIAGCFAFWGWLRLGKPVWWLLPGMLSLAAFAYLLTLVES
Y1058_AGRFC      -------MKVYLIYVLAAVAEIAGCFSFWAWLKLGKTGWILLPGMVALAAFAWLLTLVAT
Y1408_RHIEC      --------MTYIIYAFAAVFEIAGCFAFWAWLKLEKPAWWLAPGMISLALFAWLLTLVPS
Y1530_RHIL3      --------MTYIIFAFAALFEIAGCFAFWAWLKLENPVWWLAPGMVSLALFAWILTLVPS
Y7841_RHILO      --------MTYLFYTAAALAEIAGCFSVWAWWRLERSPLWLAPGFVSLLLFAWLLALVDT
Y369_RHOS4       ------MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGTFAWLLALTPV
Y3838_RHOPA      -------MTSLLTFCAAALMEIAGCFAFWAWLRLDKSPLWLIPGMLALALFAYLLTLADS
Y1566_ZYMMO      -------MLALL-YIPAALAEITGCFSFWAWIRLHKSPLWLLPGIASLLLFAWLLTFSPA
Y701_SPHAL       -------MTAFA-YIGAALAEIAGCFAFWAWLRMDKSVWWVVPGIASLALFAYLLTLVEA
Y3269_MAGSA      -------MWTIPTYILAAFAEIGGCFAFWAWLRLDKSPLWLVPGMASLGLFAWALTRIDA
Y1014_MAGSA      -------MWAIPTYLLAAFAEIGGCFAFWAWLRLGKSPFWLAPGMASLALFAWALTRVDA
Y1837_PARDP      ----MTLAAPIAVYVLAALAEIAGCFAFWAWLRLGKSPLWLVPGMVSLAVFAWLLTRVDA
Y1976_CAUVC      -------MTSFAIYVLAALAEIAGCFGFWAWLRLGKSPAWAVLGVLSLVIFALLLTRIEA
Y4174_GLOVI      --------MALLLFGLAAAAEIGGCFAFWSVLRLGKNPLWLAPGLVSLVVFAWLLTRSEA
Y3275_PSEAE      -------MINYFWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEA
Y2166_PSEAB      -------MINYLWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEA
Y1503_PSE14      -------MLNYLWFFLAALFEIFGCYAFWLWLRQGKSALWVIPALISLTLFALLLTRVEA
Y3752_PSEU2      -------MLNYLWFFLAALFEIFGCYAFWLWLRQGKSALWVIPALVSLTVFALLLTRVEA
Y1628_PSESM      -------MLNYLWFFLAALFEIAGCYAFWLWLRQGKSALWVIPALISLTLFALLLTRVEA
Y4337_PSEF5      -------MLNYLWFFLAALFEIAGCYAFWMWLRQGKSALWVIPALVSLTLFALLLTKVEA
Y4105_PSEPF      -------MLNYLWFFLAALFEIAGCFAFWMWLRQGKSALWVIPALISLTLFALLLTRVEA
Y1043_RHIME      -------MPAYAIYFLAALAEITGCFAFWSWLRLGKSALWLIPGMASLALFAWLLTMVDA
Y3331_CYTH3      -------MGNLFYFILAAFCEISGCYLFWLHFRSDKPALLLLPAAACLLVFAYLLTKIDT
Y5296_TRIV2      -------MQTLVFFLIAALGEIFGCYTFWVWLRLGKSILWIVPGVLALIVFAFALTKVNA
Y4495_PHOPR      ----MPELKTVGLFFITAIAEIIGCYLPYLWLREGKTIWLLIPAAISLALFAWLLTLHPA
Y2554_METFK      ----MFELKTVALFVITALAEIIGCYLPYLWLNQNKSPLLLIPAAISLALFAWLLTLHPS
Y916_PSYA2       ----MSELKTVGLFAITALAEIAGCYLPYLWLREGKSIWLLIPGALSLVAFVWLLSLHPT
Y1498_PSYCK      ----MSELKTVGLFALTALAEIAGCYLPYLWLREGKSVWLLIPGALSLIAFVWLLSLHPT
Y2955_NITOC      ----MPELKTVGLFLITALAEIAGCYLAYLWLREDKTIWLLVPCALSLVAFVWLLSLHPT
Y1341_PSYCK      ----MSELKTVGLFAITALAEIVGCYLPYLWLREGKSIWLLVPSALSLVAFVWLLTLHPT
Y1175_PSET1      -------MKIFGLFLITALAEIIGCYLPYLWLREGKSVWLLVPAALSLAIFAWLLSLHPA
Y2410_AERHH      ----MGELKTMGLFLVTALAEILGCYLPYLWLTQGRSVWLLLPAGLSLMLFAWLLSLHPT
Y1373_ALCBS      ----MLALYTLGLFILTAVTEIVGCYLPYLWLKKSAPGWVLLPAAASLAMFAWLLSLHPT
Y485_METFK       ----MLVLKTFSLFILTALAEILGCYLPYLWLKKDGSVWLLLPAAISLAVFAWLLSLHPT
Y1172_SHESW      ----MTVITTLGLFIITAIAEIVGCYLPYLWLKKGASAWVLLPAAISLALFAWLLTLHPT
Y2656_AZOSB      ----MTELKTLLLFLATAVAEIVGCYLPYRWLREDGSAWLLLPAAASLALFAWLLTLHPA
Y351_NITMU       ----MFELKTLFLFLATALAEIVGCYLPYLWLKRDGSAWLLVPAAASLALFAWLLTLHPT
Y2845_ACIAC      ----MVELKTFLLYAVTALAEIAGCYLPWLWLRQDRSAWLLVPGAACLALFAWLLTLHPA
Y6021_PARXL      -------MKTFLLYAVTAVAEIVGCYLPWRWLKEGGSIWLLVPGALSLALFAWLLTLHGT
Y2087_ACISJ      ----MLPFKTLALFLLTAVAEIVGCYLPWLWLRQGRSAWLLVPAAASLALFAWLLTLHPA
Y3679_CUPPJ      -------MNTIALYLLTAVAEILGCYLPYLWLRQGASAWVLLPGALSLALFAWLLSLHPD
Y4032_CUPMC      -------MKTVGLYLLTALAEILGCYLPYLWLRQGASPWVLLPGAASLAVFAWLLTLHPD
Y1326_ACISJ      -------MRTFALFIATALAEIVGCYLPYLWLKQGRSAWLLVPAAASLALFAWLLTLHET
Y4406_MYXXD      ----MNLLYAFGLFVLTAVAEVVGCYLPYLWLRQGKSPLLLVPAAGSLAVFAWLLTLHPT
Y587_PSYIN       ----MEALKIFGIFTVTAVAEIVGCYLPYLWLRQGHSIWLLVPAAFSLAAFVWLLTLHPE
Y3064_XANAC      ---MTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSVWLLLPTALSLAVFVWLLSLHPE
Y3198_XANC5      ---MTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSMWLLLPTALSLAVFVWLLSLHPE
Y1694_XANOM      ---MNLAPTTLLLFAATALAELVGCYLPYLWLRNGGSVWLLLPTALRLASFVWLLSLHPD
Y1791_XANOR      ---MNLAPTTLLLFAATALAELVGCYLPYLWLRNGGSVWLLLPTALRLASFVWLLSLHPD
Y2880_XANCP      ---MSVALTTLLLFVATAVAELVGCYLPYLWLRKGGSVWLLLPAALSLAVFVWLLTLHPA
Y1229_XANC8      ---MSVALTTLLLFVATAVAELVGCYLPYLWLRKGGSVWLLLPAALSLAVFVWLLTLHPA
YNFA_ECOLI       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_ECOL5       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_SHIDS       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_SHIFL       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_SHIF8       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_ECOL6       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_ECOK1       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_ECOUT       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_ECO57       ------MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPA
YNFA_SALTI       ------MLKTTLLFFVTALCEIIGCFLPWLWIKRGASVWWLLPAAASLALFVWLLTLHPA
YNFA_SALPA       ------MLKTTLLFFVTALCEIIGCFLPWLWIKRGASVWWLLPAAASLALFVWLLTLHPA
YNFA_SALTY       ------MLKTTLLFFVTALCEIIGCFLPWLWLKRGASVWWLLPAAASLALFVWLLTLHPA
YNFA_SALCH       ------MLKTTLLFFVTALCEIIGCFLPWLWLKRGASVWWLLPAAASLALFVWLLTLHPA
Y2027_YERE8      ------MLKASLLFFVTALAEIIGCFLPYLWLRKGASMWLLLPAAASLALFVWLLTLHPA
Y2746_CHRSD      ------MLTTTLLFIATAMAEIIGCYLPWLWLRQQGSPWLLVPAAASLTLFVWLLSLHPA
Y1642_IDILO      -MSALFLMKTLGLFIATAIAEIVGCYLPYLWLKEGHSVWLLIPAAVSLALFAYLLTLHPA
Y2332_IDILO      -MSVLLIAKTLGLFFITAIAEIIGCYLPYLWLKKDGSAWLLIPAAISLAVFAWLLTLHPA
Y1473_ACISJ      ----MELLKVAILFAVTAVAEIVGCYLPWLVVKQGKSAWLLLPAAVSLSLFAWLLTLHPT
Y4944_POLNA      ----MELLRLAILFAVTALAEIVGCYLPWLVLKQGKSLLLLVPAAMSLGLFAWLLTLHPS
Y4775_RALSO      ----MEYLRIAFLFALTALAEIVGCYLPWLVLRQAKSAWLLMPAALSLALFAWLLTLHPT
Y3337_HAHCH      ----MALLKITLLFAVTAITEIVGCYLPWLVIKQGKSLWLLVPAALSLAIFAWLLTLHPT
Y342_VEREI       ----MELLKATVLFTITAVVEIVGCYLPWLVIKQNKPLWLLLPAALSLALFAWLLTLHPS
Y802_BURCA       ---MTELMRIAALFAATALAEIVGCYLPWLVLKAGRPAWLLVPAALSLALFAWLLTLHPS
Y1283_BURCH      ---MTELMRIAALFAATALAEIVGCYLPWLVLKAGRPAWLLVPAALSLALFAWLLTLHPS
Y4425_BURL3      ---MTELMRIAALFAATALAEIVGCYLPWLVLKEGRPVWLLVPAALSLALFAWLLTLHPS
Y1160_BURCM      ---MTELMKIAALFAVTALAEIVGCYLPWLVLKGGRPVWLLVPAALSLALFAWLLTLHPS
Y1340_BURPS      ---MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPA
Y761_BURMA       ---MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPA
Y1597_BURP1      ---MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPA
Y2792_BURTA      ---MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPVWLLAPAALSLALFAWLLTLHPA
Y1364_ACIAD      ---------------MTALAEILGCYFPYLILKEGKTHWLWLPAIISLAVFVWLLTLHPA
Y2632_DECAR      ---MLELVKVLGLFAITALAEIIGCYLPWLVLTQQRPVWLLIPAAVSLGLFAWLLTLHPG
Y3485_CHRVO      MEWLTGLPRVAGLFVLTALAEIVGCYLPWLVLREGRSLWLLAPTTLALALFAWLLTLHPA
Y4629_DESHY      ------MFYAIILFILAGLAEIGGGYLVWLWLREAKPFWYGIIGGLILVLYGVIPTLQK-
Y4157_DESHY      ------MVQAAILFILAGLAEIGGGYLVWLWLREARPYWYGVIGAIILVFYGIIPTLQK-
Y854_BACLD       ------MMIAIGLFLLAGLAEIAGGYLVWLWLRESKPLWYGLAGGLTLIIYGVIPAFQA-
YFJF_BACSU       -----MMLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQS-
Y2744_BACHD      ------MVMATTLFLLAGLAEIGGGYLIWLWLRDGKPVYLGLFGAVALALYGVIATFQA-
Y2286_STAA3      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQS-
Y2615_STAA8      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQS-
Y2333_STAAC      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQS-
Y2339_STAAM      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQS-
Y2130_STAAN      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQS-
Y2231_STAAS      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQS-
Y2259_STAAW      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQS-
Y2216_STAAB      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQCSLVGLIGGAILMLYGVIATFQS-
Y2425_STAAR      ------MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGVILMLYGVIATFQS-
Y717_STAHJ       ------MLYSIFIFLLAGLCEIGGGYLIWLWLREGQSSWLGFIGGVILMMYGVIATFQS-
Y2216_TRIV2      ----------MLFFVLAGLCEIGGGYLVWLALREGKSLWLALIGVVILGLYGAVPTLQP-
Y1507_CLOPS      ----MENIKSIFYFLLAGVFEIGGGYLIWLWLRQGKSLIYGIIGALVLILYGIIPTLQPE
Y793_SYNY3       -----MILRSLLYFVMAGLCEIGGGYLVWLWIREGKSVWLALVRAILLTVYGFVATLQP-
Y2639_MYCTU      -----MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQP-
Y2657_MYCTF      -----MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQP-
Y2672_MYCBO      -----MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQP-
Y2558_MYCSK      MLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQP-
Y2513_MYCSS      MLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQP-
Y3406_MYCVP      -----MVVKSALLFVLAAILEIGGAWLVWQGVREHRGLTWVGAGVIALGAYGFVAAFQP-
Y3252_MYCS2      -----MVGKSVVLFVLAAVLEIGGAWLVWQGLREQRGWLWAGAGVIALGAYGFVAAFQP-
Y4756_STRAW      ----MLVLRSAALFVAAALFEIGGAWLVWQGVREHRGWLWIGAGVMALGVYGFVATLQP-
Y6609_RHOJR      ----MTVAKSVALFAVAALFEIGGAWLVWQGVREHRGWIWIGAGVAALGAYGFVATLQP-
Y3297_STRCO      ----MLVLRSAALFVVAALFEIGGAWLVWQGVREQRGWLWAAGGVLALGAYGFVATFQP-
Y2786_FRACC      ----MGVVRSLLLFVVAAVTEIGGAWLVWQGVREHRGPVWVGLGIGFLAAYGFVATLQP-
Y3683_NOCFA      ----MTVLRSLVLFGLAALAEIGGAWLVWQGWREHRGLWWIAAGVIALGAYGFVATFQP-
Y4238_ARTS2      ----MTIAKTILLFVLAAAAEIGGAWLVWQAVREGKEWWWAGLGVLALGVYGFAATLQP-
Y4423_ARTS2      ----MTIAKSVLLFILAAVAEIGGAWLVWQAVREGRAWWWAGLGIIALGLYGFVATLQP-
                                 :.  *: * :  :                  *  :    :    

Y2004_NITHX      EA-AGRAYAAYGGVYIIASL-GWLWSVEGLRPDRWDLTGAAICLLGAAIILFGPRQI--
Y1459_NITWN      EA-AGRAYAAYGGIYIMASL-GWLWSVEGIEPDRWDLAGALICLIGAVVILIGPHEI--
Y2370_RHOP2      EA-AGRAYAAYGGIYIVASL-AWLWSVEGVRPDRWDVSGACVCLAGAAIILWGPRG---
Y3084_RHOPS      QA-AGRAYASYGGIYIVASL-VWLWSVENVRPDRWDVTGGCVCLIGAAIILWGPRG---
Y1058_AGRFC      EA-AGRAYAAYGGIYIAASL-FWLWGVEGHAPDRWDIAGGVVCLAGTAIILFGPRG---
Y1408_RHIEC      DA-AGRTFAAYGGIYILASL-SWLWLIEGRVPDRYDIGGGLICLAGASVILFAPRA---
Y1530_RHIL3      EA-AGRTFAAYGGIYILASL-LWLWLVESRVPDRYDIGGALICLAGASLILFAPRG---
Y7841_RHILO      NA-AGRAYAAYGGIYIAASL-AWLWLVEGVRPDRWDLAGAALCIAGASLILLAPRGA--
Y369_RHOS4       EA-AGRSYAVYGGVYVAASL-LWLWAVEGVRPDRWDMGGAALVLAGAAVILWAPRG---
Y3838_RHOPA      PL-AGRAYAAYGGIYIASAL-LWGWAIEGNRPDQWDVIGAAICLVGMSVILFGPRTLPA
Y1566_ZYMMO      EN-AGKAYAVYGGIYIIMSL-LWSWKVEATPPDHWDLIGAAFCLVGAAIILWMPRSL--
Y701_SPHAL       DH-AGRTYAAYGGVYIAAAL-LWLWAVEGAKPDRWDLIGAAVCLGGAAIILFGPRGG--
Y3269_MAGSA      DF-AGRAYAAYGGIYILASL-IWMWAVEGTRPDRWDTIGAAICVVGAMVIIFGPRST--
Y1014_MAGSA      DF-AGRAYAAYGGIYILSSL-VWMWAVEESPPDRWDVLGAAFCLAGALVIIFAPRGE--
Y1837_PARDP      DF-AGRAYAAYGGIYVTASL-GWLWLTEGQVPTRWDILGGGLCVLGAMVILAGPRAA--
Y1976_CAUVC      GA-AGRAFAAYGGVYIIASL-AWMQVVEGARPDRWDLIGGVICLAGAALILFGPRTN--
Y4174_GLOVI      TY-AGRAYAAYGGVYIAASL-VWLWLVEGTRPDRWDLAGALLCLAGAAVILFADRSP--
Y3275_PSEAE      SY-AGRAYAAYGGIYVAASL-FWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ-
Y2166_PSEAB      SY-AGRAYAAYGGIYVAASL-FWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ-
Y1503_PSE14      AY-AGRAYAAYGGIYIVASI-AWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAA
Y3752_PSEU2      AY-AGRAYAAYGGIYIVASI-AWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAA
Y1628_PSESM      AY-AGRAYAAYGGIYIVASI-AWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAP
Y4337_PSEF5      TY-AGRAYAAYGGIYIVASI-GWLAVVERVRPLGSDWLGLALCVIGASVILFGPRFSNG
Y4105_PSEPF      TY-AGRAYAAYGGIYIIASI-GWLAVVERIRPLGSDWIGVALCVIGATVILFGPRFSAS
Y1043_RHIME      AA-AGRTYAAYGGVYIVASL-SWLWLAEGVRPDHWDMTGAAVALAGSAIILAGPR----
Y3331_CYTH3      AT-AGRAYAVYGGIYIVCSL-AWMYGIEKFSPDIWDYIGVGICLIGASVILFAPR----
Y5296_TRIV2      SN-AGRVYAAYGGVYILSSV-VWLWLAEGVKPDKWDLLGVTICLLGTVVILFSHYR---
Y4495_PHOPR      A--AGRVYAAYGGVYIFTAI-LWLWLVDGIRPTVWDFVGVFVALLGMAIIMFSPRPA--
Y2554_METFK      A--AGRVYAAYGGVYIFVAI-FWLWVVDDIIPSNWDFLGASVALLGMAIIMFAPRST--
Y916_PSYA2       A--AGRTYAAYGGVYISMAI-LWLWTVNGIRPTTWDIVGSVVALIGMAIIMFAPRSV--
Y1498_PSYCK      A--AGRVYAAYGGVYISMVI-LWLWTVNGIRPTTWDIVGSAIALLGMAIIMFAPRSA--
Y2955_NITOC      A--AGRVYAAYGGVYIVMAI-LWLWVVNGIRPTTWDLVGSAIALLGMAIIMFAPRTT--
Y1341_PSYCK      A--VGRVYAAYGGVYVTMAI-LWLWAVDGIRPTTWDILGTSVALLGMAIIMFAPRNT--
Y1175_PSET1      A--AGRVYAAYGGVYIFMAI-LWLWAVDGIRPTTWDLVGSGVALVGMAIIMFAPRSV--
Y2410_AERHH      A--AGRVYAAYGGVYIFVAI-LWLWLVDGIRPSLWDLVGSLVALCGMAIIMFAPREA--
Y1373_ALCBS      D--AGRVYAAYGGVYVFVAL-LWLWGVEGVRPHPWDFVGVAVALAGMGIIMFAPRG---
Y485_METFK       A--AGRVYAAYGGVYIFVAL-GWLWLVDGIRPSTWDFVGVGVALAGMAIIMFAPR----
Y1172_SHESW      A--AGRVYAAYGGVYVTIAI-VWLWGVDGIQPHRWDLAGVVLMLAGMAVIMFAPR----
Y2656_AZOSB      A--SGRIYAAYGGVYVFVAV-LWLWGVDGVRPTVWDITGSLIALCGMAVIMFAPRGA--
Y351_NITMU       D--AGRTYAAYGGVYVSVAV-LWLWAVDGVRPTAWDMAGSLLALTGMAIIMFGPRHA--
Y2845_ACIAC      A--AGRVYAAYGGVYVAVAL-GWLWAVDGIRPDRWDLAGAAVTLAGMAIIAFAPRGAA-
Y6021_PARXL      A--AGRVYAAYGGVYVAVAI-AWLWCVDKVRPTLWDAAGVVFTLAGMAIIAFQPRV---
Y2087_ACISJ      A--TGRVYAAYGGVYVAVAL-VWLWTVDGVRPGPWDWLGVAVTLCGMAIIAFAPRGG--
Y3679_CUPPJ      A--SGRVYAAYGGVYIGVAV-LWLWLVDGVRPSAWDLAGVGVAFGGMAIIVFQPR----
Y4032_CUPMC      A--SGRVYAAYGGVYIAMAI-AWLWAVDGVRPSPWDIAGVAVALGGMAIIVFQPR----
Y1326_ACISJ      A--AGRVYAAYGGVYIGVAL-LWLWIVDGIRPTAWDVAGVAVALTGMGLIMFQPR----
Y4406_MYXXD      G--AARTYAAYGGVYIAVAL-VWLWLVEGERPTTWDLVGALVAILGMAIIVLGPRR---
Y587_PSYIN       A--AGRTYAAYGGIYVSVAL-MWLWLVESTRPTMTDLLGVLICIIGMAVIMFGPRNV--
Y3064_XANAC      A--SGRVYAAYGGVYIASAL-LWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA--
Y3198_XANC5      A--SGRVYAAYGGVYIASAL-LWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA--
Y1694_XANOM      A--SGRVYAAYGGVYIASALGLWLWWVDGVTPTRWDLLGAVCCLFGMAIIMFAPRSA--
Y1791_XANOR      A--SGRVYAAYGGVYIASALGLWLWWVDGVTPTRWDLLGAVCCLFGMAIIMFAPRSA--
Y2880_XANCP      A--SGRVYAAYGGVYIATAL-LWLWWVDRVTPTRWDLLGAGCCLLGMAIIMFSPRSG--
Y1229_XANC8      A--SGRVYAAYGGVYIATAL-LWLWWVDRVTPTRWDLLGAGCCLLGMAIIMFSPRSG--
YNFA_ECOLI       A--SGRVYAAYGGVYVCTAL-MWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT--
YNFA_ECOL5       A--SGRVYAAYGGVYVCTAL-MWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT--
YNFA_SHIDS       A--SGRIYAAYGGVYVCTAL-MWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT--
YNFA_SHIFL       A--SGRVYAAYGGVYVCTAL-MWLRVVDGVKLSLYDWTGALIALCGMLIIVAGWGRT--
YNFA_SHIF8       A--SGRVYAAYGGVYVCTAL-MWLRVVDGVKLSLYDWTGALIALCGMLIIVAGWGRT--
YNFA_ECOL6       A--SGRVYAAYGGVYVCTAL-IWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT--
YNFA_ECOK1       A--SGRVYAAYGGVYVCTAL-IWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT--
YNFA_ECOUT       A--SGRVYAAYGGVYVCTAL-IWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT--
YNFA_ECO57       A--SGRVYAAYGGVYVCTAL-MWLRVVDGVKLTLYDWTGPLIALCGMLIIVVGWGRT--
YNFA_SALTI       A--SGRVYAAYGGVYVCTAL-LWLRVVDGVRLTVYDWSGALIALCGMLIIVVGWGRT--
YNFA_SALPA       A--SGRVYAAYGGVYVCTAL-LWLRVVDGVRLTVYDWCGALIALCGMLIIVVGWGRT--
YNFA_SALTY       A--SGRVYAAYGGVYVCTAL-LWLRVVDGVRLTVYDWCGALIALCGMLIIVVGWGRT--
YNFA_SALCH       A--SGRVYAAYGGVYVCTAL-LWLRVVDGVRLTVYDWCGALIALCGMLIIVVGWGRT--
Y2027_YERE8      A--SGRVYAAYGGVYVATAL-IWLRVVDDVKLSLFDWVGAAVALVGMLIIVAGWRVN--
Y2746_CHRSD      A--SGRVYAAYGGVYVVCAL-VWLWGVDGEALRPTDWIGAALALTGMGVIASGWR----
Y1642_IDILO      E--SGRVYAAYGGIYVLTAI-VWLRIVDKSPLSNFDLIGTAFVLTGMGILVYGWR----
Y2332_IDILO      E--SGRVYAAYGGVYVVTAL-LWLKAVEGASLSTYDAVGAAFTLTGMAIIAVGWNH---
Y1473_ACISJ      A--AGRTYAAYGGMYIAVAL-VWLHVVDGVALTRWDFVGAAIALAGMSVIALQPATDT-
Y4944_POLNA      A--AGRTYAAYGGMYIAVAL-GWLRFVDGIALTRWDLSGAAIALVGMAVIVMQPSTT--
Y4775_RALSO      A--AGRTYAAYGGMYIAVAL-AWLRVVDGATLTRWDIGGAAIALAGMAVIALQPQPT--
Y3337_HAHCH      A--AGRTYAAYGGMYVVVAL-IWLHFVEGVGLTRFDFLGATMALAGMAIIALQPISHS-
Y342_VEREI       A--AGRTYAAYGGIYIAVAL-AWLHWVDGVSLTRWDVAGATVAMVGMLIIMLQPASA--
Y802_BURCA       A--AGRTYAAYGGVYIAVAL-IWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA---
Y1283_BURCH      A--AGRTYAAYGGVYIAVAL-IWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA---
Y4425_BURL3      A--AGRTYAAYGGVYIAVAL-VWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA---
Y1160_BURCM      A--AGRTYAAYGGVYIAVAL-IWLRVVDGVALTRWDAAGAVLALGGMAVIALQPRA---
Y1340_BURPS      A--AARTYAAYGGVYIAVAL-AWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG---
Y761_BURMA       A--AARTYAAYGGVYIAVAL-AWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG---
Y1597_BURP1      A--AARTYAAYGGVYIAVAL-AWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG---
Y2792_BURTA      A--AARTYAAYGGVYIAVAL-AWLRIVDGVPLSRWDAAGAALALAGMSVIALQPRG---
Y1364_ACIAD      A--SGRIYAAYGGIYIFTAL-MWLRFIDQVTLTRWDIWGGTVVLLGAALIILQPQGLLK
Y2632_DECAR      A--AGRIYAAYGGVYVAIAL-IWLWRIDGVVPTRWDLVGSAVSLAGMAIIMLQPARSV-
Y3485_CHRVO      A--AGRTYAAYGGVYVTVAI-AWLWLVDGVRPDRWDALGCALALAGMAVIMLAPRS---
Y4629_DESHY      FPSFGRVYAAYGGVFVILAV-LWGWGIDKKVPDNYDWIGAVICLVGVSVMLWAPRN---
Y4157_DESHY      FPSFGRVYAAYGGVFIILAV-LWGWGVDKKMPDTYDWIGAAICLVGVTVMLWAPRQ---
Y854_BACLD       FPSFGRVYAAYGGVFIILAV-LWGWLVDKKTPDLYDWAGAVICLAGVSVMLWAPRG---
YFJF_BACSU       FPSFGRVYAAYGGVFIVLAV-LWGWLVDRKTPDLYDWIGAFICLIGVCVILFAPRG---
Y2744_BACHD      FPSFGRVYAAYGGVFIFLAV-LWGWWIDGKAPDTYDWIGAVICLVGVGIMLWAPRP---
Y2286_STAA3      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2615_STAA8      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2333_STAAC      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2339_STAAM      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2130_STAAN      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2231_STAAS      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2259_STAAW      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2216_STAAB      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y2425_STAAR      FPSFGRVYAAYGGVFIIMSL-IFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA---
Y717_STAHJ       FPTFGRVYAAYGGVFIVMSL-IWAYIVDKQAPDKYDLIGACICIIGVCVMILPSRT---
Y2216_TRIV2      -THFGRAYAAYGGVFVALSV-LWGWLVDRIRPDKFDLLGGWIVLLGVLVIMYAPRG---
Y1507_CLOPS      NSNFGRVYATYGGIFIVLSI-LCGWKVDNIIPDKFDLIGGFIALIGVLIIMYAPRG---
Y793_SYNY3       -ANFGRAYAAYGGIFIILSI-IWGWQVDNVVVDRLDWLGAAIALVGVLVMMYANRA---
Y2639_MYCTU      DAHFGRVLAAYGGVFVAGSL-AWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH--
Y2657_MYCTF      DAHFGRVLAAYGGVFVAGSL-AWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH--
Y2672_MYCBO      DAHFGRVLAAYGGVFVAGSL-AWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH--
Y2558_MYCSK      DAHFGRILAAYGGVFVAGSL-LWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR----
Y2513_MYCSS      DAHFGRILAAYGGVFVAGSL-LWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR----
Y3406_MYCVP      DAHFGRVLAAYGGVFVAGSL-LWGVVADGFRPDRWDITGAAVCLAGVGLIMYAPR----
Y3252_MYCS2      DANFGRVLAAYGGVFIAGSL-LWGMIADGFRPDRWDVAGAAVALVGVGLIMYAPR----
Y4756_STRAW      DAEFGRILAAYGGVFVAGSL-AWGMVADGYRPDRWDVTGALICLAGMTVIMYAPRGGN-
Y6609_RHOJR      DAHFGRILAAYGGVFVAGSL-IWGMVADGFRPDRWDVSGALICLLGMAVIMYAPR----
Y3297_STRCO      DAHFGRILAAYGGIFVTGSI-LWGVVADGYRPDRWDIAGALVCLAGMALIMWAPRNGG-
Y2786_FRACC      DAHFGRILAAYGGVFVAGSL-LWGVAVDGFRPDRYDLAGAAICLLGVAVIMYARRV---
Y3683_NOCFA      DPDFGRVLAAYGGVFVVGSL-AWGVLVDRFRPDRWDLLGAGICLVGVAVIMYAPRGG--
Y4238_ARTS2      DAHFGRILAAYGGVFVAGSL-AWGMVFDGFRPDRWDIIGSVICLLGVAVIMFAPRNAG-
Y4423_ARTS2      DAHFGRILAAYGGVFVAGSL-VWGMVFDGFRPDRWDVIGSVICLVGVAVIMFAPRGTTS
                     .:  * ***:::   :       :       *  *    . *  ::