CLUSTAL format seed alignment for MF_00012

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ILVD_CALS8       --------------------------MRSDIVKKGFEKAPQRSLFKAMGYTDE--EIRRP
ILVD_HUNT2       --------------------------MRSDAVKKGIERAPHRALFKAMGYTDE--ELERP
ILVD_CALS4       --------------------------MRSDAVKKGVERAPHRSLLYALGLTDE--ELKRP
ILVD_CLOB8       --------------------------MRSDVITKGSKSAPQRSLLSALGLTKE--EMERP
ILVD_CLOK5       --------------------------MRSDVITKGTKSAPQRALLNALGLTKE--EIERP
ILVD_LACP7       --------------------------MKSDAVTKGIQQAPHRSLFNALGLTKE--ELDKP
ILVD_CLOAB       --------------------------MNSDKAMKGVERAPHRSLFKALGFIDE--EMDRP
ILVD_CARHZ       --------------------------MPSHLIKSGISKAPHRSLLKALGITDN--ELKRP
ILVD_MOOTA       --------------------------MRSDAMKTGLARAPHRSLLKAMGLTET--EIERP
ILVD_SYNFM       --------------------------MRSDLMKKGVEKAPHRSLFKAMGYTQT--ELDRP
ILVD_SYNAS       --------------------------MRSDIMKKGLEKAPHRSLFKAMGYTDE--EIARP
ILVD_DESVH       --------------------------MRSKKMTHGLEKAPHRSLLHALGLTRE--ELARP
ILVD_DESVV       --------------------------MRSKKMTHGLEKAPHRSLLHALGLTRE--ELARP
ILVD_DESAG       --------------------------MRSKKMTHGLEKAPHRSLLYALGLTRE--ELSRP
ILVD_THEMA       --------------------------MRSDVIKKGLERVPHRSLLKALGITDD--EMRRP
ILVD_THEP1       --------------------------MRSDVIKKGLERAPHRSLLKALGITDD--EMRRP
ILVD_PYRAB       --------------------------MRSDVIKKGIERAPHRALFKAMGLTDE--ELDKP
ILVD_PYRFU       --------------------------MRSDVIKKGIERAPHRSLFKAMGFTDE--ELERP
ILVD_CLONN       --------------------------MNSKEVTKGVARAPHRSLFYAMGYTPE--DLKKP
ILVD_IGNH4       --------------------------MKRSDVFLRPEYAPHRALWRASGLIDE--ELRRP
ILVD_GEOMG       --------------------------MRSDTIKQGIERTPHRALIKGTGVPQS--EMAKP
ILVD_GEOSL       --------------------------MRSDTIKKGVERTPHRALIKGTGVPQS--QMDKP
ILVD_GEOUR       --------------------------MRSDMIKKGLERTPHRALLKGTGVPQS--EMDKP
ILVD_PELPD       --------------------------MRSDTITQGFERTPHRALLKGSGVPQS--QMDKP
ILVD_PELCD       -----------------------MKGKRSEAITQGFERAPHRALLMGTGIPRK--ELGKP
ILVD_METMJ       --------------------------MRSETVKKGYQRAPNRALLRSLGVTDR--EMDLP
ILVD_METB6       -----------------------MTDLRSDTIRKGYERAPNRSLLRSLGVTDR--EIELP
ILVD_METHJ       --------------------------MRSDDVKAGYARAPNRSLIRSLGIDES--EMHQP
ILVD_ARCFU       --------------------------MRSDEVKKGIDRVAHRALLKALGVTDD--EMDKP
ILVD_METTH       --------------------------MKSDTIKRGIQRAPHRSLLARCGLTDD--DFEKP
ILVD_METST       --------------------------MRSDNIKKGINRTSHRSLLRACGLDDN--DMKKP
ILVD_METS3       --------------------------MKSDNIKKGIQRAPHRSLLRACGLGDN--DFDKP
ILVD_METJA       --------------------------MISDRVKKGLKRAPNRSLLKACGYTDE--ELERP
ILVD_META3       --------------------------MISDNLKKGVSRAPNRSLLKACGYTDE--EIEKP
ILVD_METM5       --------------------------MISDNVKKGVIRSPNRALLKACGYSDE--DMEKP
ILVD_METM7       --------------------------MISDNVKKGVIRSPNRALLKACGYSDE--DMEKP
ILVD_METMP       --------------------------MISDNVKKGVIRTPNRALLKACGYTDE--DMEKP
ILVD_METVS       --------------------------MISDNIKKGVIRSPNRALLKACGYTDE--DMEKP
ILVD1_METAC      --------------------------MRSAIIKEGPERAANRSLLKATGVTDS--EMKKP
ILVD_METMA       --------------------------MRSAIIKEGPERAANRSLLKATGVTDA--EMKRP
ILVD2_METAC      --------------------------MRSDIIKEGPERAPNRSLLKATGVTDS--EMKKP
ILVD_METBF       --------------------------MRSDIIKEGPERAPNRSLLKATGVTDS--EMRKP
ILVD_METBU       --------------------------MRSDNTKKGDARAPNRSLLKAIGVTDS--EMKKP
ILVD_METTP       --------------------------MRSDITKSGPERAPHRALLKAMGITDD--EIKRP
ILVD_METKA       --------------------------MRSGDIKEGVERTPHRALLRACGLTDE--EMDRP
ILVD_DEHMB       --------------------------MKSEDVKLGIERAPHRSLLRALGLNTE--SFQKP
ILVD_DEHMC       --------------------------MKSEDVKLGIERAPHRSLLRALGLNTE--SFQKP
ILVD_DEHM1       --------------------------MKSEDVKLGIERAPHRSLLRALGLNTE--SFQKP
ILVD_ANADE       --------------------------MRSDRIKKGFERAPHRSLLRATGLND--GDFEKP
ILVD_ANADF       ------------------------MGVRSDTIKKGFERAPHRSLLRATGLTD--ADFDKP
ILVD_ARCB4       --------------------------MRSDEVKKGFDRTPHRSLLRATGLKD--EDFDKP
ILVD_SULNB       -------------------------MMRSDEIKKGYNRAPHRSLLRATGLKD--EDFDKP
ILVD_NITSB       --------------------------MRSDEIKKGFQRAPHRSLLRATGLKD--EDFEKP
ILVD_SULDN       --------------------------MRSDTIKKGFDKAPHRSLLRATGLRD--EDFDKP
ILVD_HELHP       --------------------------MRSDIVKKGYQRAPHRSLLRATGLKD--EDFNKP
ILVD_WOLSU       --------------------------MRSSIIKEGYQKAPHRSLLRATGLKD--EDFGKP
ILVD_CAMFF       --------------------------MRSDIIKDGYTRTPHRSLLRATGLKD--DDFKKP
ILVD_CAMHC       --------------------------MRSDVIKKGYIRAPHRSLLRATGLKD--DDFKKP
ILVD_CAMC5       --------------------------MRSDVIKKGYTRAPHRSLLRATGLKD--EDFSKP
ILVD_CAMJE       --------------------------MRSDAIKKGHLRAPNRSLLRACGLKD--EDFDKP
ILVD_CAMJR       --------------------------MRSDAIKKGHLKAPNRSLLRACGLKD--EDFDKP
ILVD_CAMJD       --------------------------MRSDAIKKGHLKAPNRSLLRACGLKD--EDFDKP
ILVD_CAMJJ       --------------------------MRSDAIKKGHLKAPNRSLLRACGLKD--EDFDKP
ILVD_CAMJ8       --------------------------MRSDAIKKGHLKAPNRSLLRACGLKD--EDFNKP
ILVD_AQUAE       ------------------------MKFRSDKVKKGIERAPHRALLRACGLSD--EDFDKP
ILVD_BACVZ       -----------------------MAELRSNMITQGIDRAPHRSLLRAAGVKE--EDFGKP
ILVD_BACSU       -----------------------MAELRSNMITQGIDRAPHRSLLRAAGVKE--EDFGKP
ILVD_BACP2       -----------------------MAELRSNMIKQGIDRAPHRSLLRAAGVKD--EDFGKP
ILVD_BACLD       -----------------------MTGLRSDMITKGIDRAPHRSLLRAAGVKE--EDFGKP
ILVD_GEOKA       -----------------------MKKRRSDMIKKGFDRAPHRSLLRAAGVKD--EDFDKP
ILVD_BACAH       --------------------------MRSDMIKKGFDKAPHRSLLKATGLKD--EDFDKP
ILVD_BACHK       --------------------------MRSDMIKKGFDKAPHRSLLKATGLKD--EDFDKP
ILVD_BACAN       --------------------------MRSDMIKKGFDKAPHRSLLKATGLKD--EDFDKP
ILVD_BACC1       --------------------------MRSDMIKKGFDKAPHRSLLKATGLKD--EDFDKP
ILVD_BACCZ       --------------------------MRSDMIKKGFDKAPHRSLLKATGLKD--EDFDKP
ILVD_BACCR       --------------------------MRSDMIKKGFDKAPHRSLLKATGLKD--EDFDKP
ILVD_BACCN       --------------------------MRSDMIKKGFDKAPHRSLLKATGLKD--EDFHKP
ILVD_BACSK       --------------------------MRSNMIKKGIDRAPHRSLLRAAGVKE--EDMDKP
ILVD_BACHD       --------------------------MRSDMIKKGIDRAPHRSLLRAAGVKE--EEMDKP
ILVD_LISMO       --------------------------MRSDKIKKGVEQAPARSLLHATGQIKSPGDMDKP
ILVD_LISMF       --------------------------MRSDKIKKGVEQAPARSLLHATGQIKSPGDMDKP
ILVD_LISW6       --------------------------MRSDKIKKGVEQAPARSLLHATGQIKSPGDMDKP
ILVD_LISIN       --------------------------MRSDKIKKGVEQAPARSLLHATGQIKSPGDMDKP
ILVD_STAAC       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAE       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAA2       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAA9       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAS       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAA1       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAM       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAW       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAN       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAA8       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAT       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAA3       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAB       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAAR       --------------------------MRSDMIKKGDHQAPARSLLHATGALKSPTDMNKP
ILVD_STAES       --------------------------MRSDMIKKGDHQAPARSLLHATGALKQPTDMNKP
ILVD_STAEQ       --------------------------MRSDMIKKGDHQAPARSLLHATGALKQPTDMNKP
ILVD_STAHJ       --------------------------MRSDMIKKGDHQAPARSLLHATGALKNPTDMNKP
ILVD1_STAS1      --------------------------MRSDMIKKGDQQAPARSLLHATGALDKPTDMNKP
ILVD_LEUMM       -----------MTDTFSFNVNSDDLQKRSDHIKMGIHQAPARSLLYATGQVSNPEDMKKP
ILVD_SYMTH       ---------------------MEGSTVRSDLIKKGPDRAPHRALLKATGVTD--ADMGKP
ILVD_CHLCH       --------------------------MRSDTIKSGFEKAPHRSLLKATGAIRSSSDYRKP
ILVD_CHLPD       --------------------------MRSDTIKKGFDKAPHRSLLKATGVITSSDDYQKP
ILVD_PELLD       --------------------------MRSDTIKTGFEKAPHRSLLKATGTIHGKSDYQKP
ILVD_CHLPM       --------------------------MRSDTIKTGFEKAPHRSLLKATGTIKEKGDYRKP
ILVD_CHLTE       --------------------------MRSDTIKKGFEKAPHRSLLKATGCVSTRDDFSKP
ILVD_BIFAA       ------------------------MEMRSAKLMNGRVFAGARALYRAAGVDGK-DFGK-P
ILVD_BIFLO       -----------------------MTEMRSAKIMSGRVFAGARALYRAAGVSGD-DMGKKP
ILVD_CORGL       -----------------------MIPLRSKVTTVGRNAAGARALWRATGTKEN-EFG-KP
ILVD_CORGB       -----------------------MIPLRSKVTTVGRNAAGARALWRATGTKEN-EFG-KP
ILVD1_COREF      -----------------------MIPLRSKVTTVGRNAAGARALWRATGTKEN-EFG-KP
ILVD_CORDI       -----------------------MFPLRSRVTTVGRNAAGARALWRATGTKDN-EFG-KP
ILVD_CORJK       ---------------------MNAIPLRSAVTTQGRNAAGARALWRATGMTDQ-DFE-KP
ILVD3_NOCFA      -----------------------MPPLRSRTTTAGRNAAGARALWRATGLTDS-DFG-KP
ILVD_FRACC       -----------------------MPALRSRTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_SALAI       -----------------------MPELRSRTSTHGRTMAGARALWRATGMTDD-DFG-KP
ILVD_STRAW       -----------------------MPELRSRTVTHGRNMAGARALMRASGVPGA-DIGRKP
ILVD_STRCO       -----------------------MPELRSRTVTHGRNMAGARALMRASGVPGA-DIGRKP
ILVD2_NOCFA      -----------------------MPELRSRTVTHGRNMAGARALMRASGVPAA-DIGAKP
ILVD_THEFY       -----------------------MPALRSRTVTHGRNMAGARALLRATGVARE-DFG-KP
ILVD_BACFR       ----------------------MKKQLRSSFSTQGRRMAGARALWAANGMKKE-QLG-KP
ILVD_BACFN       ----------------------MKKQLRSSFSTQGRRMAGARALWAANGMKKE-QLG-KP
ILVD_BACTN       ----------------------MKKQLRSSFSTQGRRMAGARALWAANGMKKN-QMG-KP
ILVD_PARD8       ----------------------MKNPLRSSFSTEGRRMAGARALWRANGMKEE-QFG-KP
ILVD_BLOFL       -----------------------MPKYRSSTTTQGRNMAGARALWRATGMNSG-DFN-KI
ILVD_BLOPB       -----------------------MPKYRSITTTHGRNMTGARALWRATGMTTE-DFD-KM
ILVD_BUCAI       -----------------------MPKYRSFTTTQGRNMSGARSLWRATGMTEK-DFT-KP
ILVD_BUCDN       -----------------------MPKYRSFKTTHGKNMSGARSLWRATGMNDE-DFK-KP
ILVD_BUCAP       -----------------------MPKYRSFTTTHGRNMSGARSLWRATGMTDE-DFK-KP
ILVD_BUCMH       -----------------------MPKYRSSTTTQGRNMAGARSLWKATGMTDL-DFK-KP
ILVD_BUCSC       -----------------------MPKYRSSTTTQGRNMAGARALWKATGMTDS-DFN-KP
ILVD_BUCBP       -----------------------MPKYRSSTTTQGPNMSGARALWRATGMSSD-DFN-KP
ILVD_BUCCC       -----------------------MPKYRSFTTINGKNMAGARALWRATGVKDA-DFG-KP
ILVD_ACTP2       -----------------------MPILRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_MANSM       -------------------MEIFMPKLRSATSTQGRNMAGARSLWRATGMKEG-DFG-KP
ILVD_HAES1       -----------------------MPKLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_HISS2       -----------------------MPKLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_PASMU       -----------------------MPKLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_HAEI8       -----------------------MPKLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_HAEIG       -----------------------MPKLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_HAEIN       -----------------------MPKLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_HAEIE       -----------------------MPKLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_ACTSZ       -----------------------MPVLRSATSTQGRNMAGARALWRATGMKEN-DFG-KP
ILVD_AERHH       -----------------------MPKLRSATTTHGRNMAGARALWRATGMTDQ-DFG-KP
ILVD_AERS4       -----------------------MPKLRSATTTHGRNMAGARALWRATGMTDE-DFG-KP
ILVD_VIBCH       -----------------------MPKYRSATTTHGRNMAGARALWRATGVKEE-DFG-KP
ILVD_VIBC3       -----------------------MPKYRSATTTHGRNMAGARALWRATGVKEE-DFG-KP
ILVD_VIBVU       -----------------------MPKYRSATTTHGRNMAGARALWRATGVKDE-DFG-KP
ILVD_VIBVY       -----------------------MPKYRSATTTHGRNMAGARALWRATGVKDE-DFG-KP
ILVD_VIBPA       -----------------------MPKYRSATTTHGRNMAGARALWRATGVKDE-DFG-KP
ILVD_ALIF1       -----------------------MPTYRSATTTHGRNMAGARALWRATGVKED-DFG-KP
ILVD_PHOPR       -----------------------MPKYRSATTTHGRNMAGARALWRATGVKDE-DFG-KP
ILVD_ECOLC       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECOHS       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECO24       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_SHIF8       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_SHISS       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_SHIFL       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECOLI       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_SHIBS       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECO57       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_SHIDS       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECOUT       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECOK1       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECOL5       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ECOL6       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_SALPB       -----------------------MPKYRSATTTYGRNMAGARALWRATGMTDS-DFG-KP
ILVD_SALTY       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDS-DFG-KP
ILVD_SALCH       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDS-DFG-KP
ILVD_SALPA       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDS-DFG-KP
ILVD_SALTI       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDS-DFG-KP
ILVD_KLEP7       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_ENT38       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_YERPE       -----------------------MPKYRSHTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_YERPA       -----------------------MPKYRSHTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_YERPN       -----------------------MPKYRSHTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_YERPP       -----------------------MPKYRSHTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_YERP3       -----------------------MPKYRSHTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_YERPS       -----------------------MPKYRSHTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_YERE8       -----------------------MPKYRSHTTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_PECAS       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_SODGM       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDD-DFG-KP
ILVD_PHOLL       -----------------------MPKYRSATTTHGRNMAGARALWRATGMTDA-DFG-KP
ILVD_COLP3       -----------------------MPKLRSATSTQGRNMAGARALWRATGMTDG-DFG-KP
ILVD_PSYIN       -----------------------MPQYRSKTSTHGRNMAGARALWRATGVKDD-DFG-KP
ILVD_SHEB5       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHEB9       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHEB8       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHEPC       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHESW       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHESM       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHESR       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHESA       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHEON       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHEDO       -----------------------MPKLRSATSTEGRNMAGARALWRATGMKDN-DFG-KP
ILVD_SHEFN       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKEN-DFG-KP
ILVD_SHELP       -----------------------MAKLRSATSTQGRNMAGARALWRATGVKDS-DFG-KP
ILVD_SHEAM       -----------------------MAKLRSATSTEGRNMAGARALWRATGVKDT-DFG-KP
ILVD_SHEHH       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHEPA       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKDN-DFG-KP
ILVD_SHESH       -----------------------MPKLRSATSTEGRNMAGARALWRATGVKEN-DFG-KP
ILVD_PSEA6       -----------------------MPKLRSATTTQGRNMAGARALWRATGMKDG-DFG-KP
ILVD1_PSEHT      -----------------------MAKLRSATTTEGRKRAGARALWRATGMTDS-DFG-KP
ILVD1_BURL3      -----------------------MPTYRSKTSTAGRNMAGARSLWRATGMKDD-DFS-KP
ILVD_BURVG       -----------------------MPTYRSKTSTAGRNMAGARSLWRATGMKDD-DFS-KP
ILVD2_CUPPJ      -----------------------MPAYRSKTSTAGRNMAGARSLWRATGMKDD-DFN-KP
ILVD_ACIAC       -----------------------MPAYRSKTSTAGRNMAGARSLWRATGMKDE-DFS-KP
ILVD_MARMS       -----------------------MPVYRSKTTTSGRNMAGARALWRATGMTDD-DFQ-KP
ILVD_SACD2       -----------------------MPQYRSRTTTQGRNMAGARALWRATGMKDE-DFQ-KP
ILVD_PSEAE       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEAB       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEA7       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEMY       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEU5       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEP1       -----------------------MPDYRSKTSTQGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEPK       -----------------------MPDYRSKTSTQGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEPG       -----------------------MPDYRSKTSTQGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEE4       -----------------------MPDYRSKTSTQGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEPF       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDD-DFK-KP
ILVD_PSEF5       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDD-DFK-KP
ILVD_PSE14       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSEU2       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_PSESM       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKDE-DFK-KP
ILVD_XANAC       -----------------------MPEYRSKTSTHGRNMAGARALWRATGMRDG-DFH-KP
ILVD_XANC5       -----------------------MPEYRSKTSTHGRNMAGARALWRATGMRDG-DFH-KP
ILVD_XANOR       -----------------------MPEYRSKTSTHGRNMAGARALWRATGMQDG-DFQ-KP
ILVD_XANOM       -----------------------MPEYRSKTSTHGRNMAGARALWRATGMQDG-DFQ-KP
ILVD_XANCP       -----------------------MPEYRSKTSTHGRNMAGARALWRATGMKDG-DFH-KP
ILVD_XANC8       -----------------------MPEYRSKTSTHGRNMAGARALWRATGMKDG-DFH-KP
ILVD_XYLFA       -----------------------MPEYRSKTSTYGRNMAGARALWRATGMKDD-DFQ-KP
ILVD_XYLFT       -----------------------MPEYRSKTSTYGRNMAGARALWRATGMKDD-DFQ-KP
ILVD_HAHCH       -----------------------MPEYRSSTTTKGRNMAGARALWRATGMKTE-DFS-KP
ILVD_RHORT       -----------------------MTPYRSRTSTHGRTMAGARGLWRATGMKDE-DFG-KP
ILVD_HYDCU       -----------------------MPDYRSKTSTHGRNMAGARALWRATGMKTE-DFG-KP
ILVD_CAUVC       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_GRABC       -----------------------MPQYRSRTTTHGRNMAGARGLWRATGMKDG-DFG-KP
ILVD_ZYMMO       -----------------------MPPYRSRTTTHGRNMAGARSLWRATGVKNE-DFG-KP
ILVD_GLUOX       -----------------------MPAYRSRTTTHGRNMAGARALWRATGMKDG-DFG-KP
ILVD_AZOSB       -----------------------MPQYRSRTSTAGRNMAGARALWRATGMKDG-DFE-KP
ILVD2_AROAE      -----------------------MPQYRSRTSTAGRNMAGARALWRATGMKDG-DFE-KP
ILVD_DECAR       -----------------------MPQYRSHTSTHGRNMAGARSLWRATGMKDG-DFG-KP
ILVD1_BORBR      -----------------------MPHYRSRTSTHGRNMAGARALWRATGMKDG-DFG-KP
ILVD1_BORPA      -----------------------MPHYRSRTSTHGRNMAGARALWRATGMKDG-DFG-KP
ILVD1_BORPE      -----------------------MPHYRSRTSTHGRNMAGARALWRATGMKDG-DFG-KP
ILVD_BORA1       -----------------------MPHYRSRTSTHGRNMAGARALWRATGMKDG-DFG-KP
ILVD_NEIMA       -----------------------MPEYRSKTSTHGRNMAGARALWRATGVMET-DFG-KP
ILVD_NEIMF       -----------------------MPEYRSKTSTHGRNMAGARALWRATGVMET-DFG-KP
ILVD_NEIMB       -----------------------MPEYRSKTSTHGRNMAGARALWRATGVMET-DFG-KP
ILVD_NEIG1       -----------------------MPEYRSKTSTHGRNMAGARALWRATGVMET-DFG-KP
ILVD_PSYA2       ------------------------MDYNSKTSTGGRNMAGARALWRATGMTDG-DFG-KP
ILVD_CHRVO       -----------------------MPQYRSRTSTAGRNMAGARALWRATGMTDA-DFG-KP
ILVD_METFK       -----------------------MPQYRSRTSTHGRNMAGARALWRATGMKED-DFQ-KP
ILVD_SYNP6       -----------------------MPQYRSRTTTYGRNMAGARALWRATGMKDE-DFE-KP
ILVD_SYNE7       -----------------------MPQYRSRTTTYGRNMAGARALWRATGMKDE-DFE-KP
ILVD_NITOC       -----------------------MPAYRSRTTTHGRNMAGARALWRATGMKEG-DFG-KP
ILVD_NOVAD       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD_SPHAL       -----------------------MPSYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD1_ACIAD      -----------------------MPDYRSKTSTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_DEIRA       -----------------------MPTYRSRTTTEGRNMAGARALWRATGMTDG-DFQ-KP
ILVD_RHIEC       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD_RHIL3       -----------------------MPVYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD_RHIME       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD_SINMW       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD_AGRFC       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD1_RHILO      -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD_BRUAB       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_BRUA2       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_BRUO2       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_BRUC2       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_BRUSU       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_BRUME       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_BRUSI       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_OCHA4       -----------------------MPPYRSRTTTHGRNMAGARGLWRATGMKDE-DFG-KP
ILVD_RHOP5       -----------------------MPAYRSRTSTHGRNMAGARSLWRATGMKNE-DFG-KP
ILVD_NITHX       -----------------------MPAYRSRTSTHGRNMAGARGLWRATGMKNE-DFG-KP
ILVD_NITWN       -----------------------MPAYRSRTSTHGRNMAGARGLWRATGMKNE-DFG-KP
ILVD_AZOC5       -----------------------MPAYRSRTSTHGRNMAGARGLWRATGMKDG-DFG-KP
ILVD_RHOPA       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD_RHOP2       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDS-DFG-KP
ILVD1_BRADU      -----------------------MPAYRSRTTTHGRNMAGARGLWRATGMKDA-DFG-KP
ILVD_BARHE       -----------------------MPSYRSRISTHGRNMAGARSLWRATGMKES-DFG-KP
ILVD_BART1       -----------------------MPSYRSRISTHGRNMAGARGLWRATGMKDA-DFG-KP
ILVD_RHOS4       -----------------------MPAFRSRTSTHGRNMAGARGLWRATGVKDS-DFG-KP
ILVD_RHOS1       -----------------------MPAFRSRTSTHGRNMAGARGLWRATGVKDS-DFG-KP
ILVD_PARDP       -----------------------MPAYRSRTTTHGRNMAGARGLWRATGVKNS-DFG-KP
ILVD_RUEPO       -----------------------MPMYRSRTSTHGRNMAGARGLWRATGMTDG-DFG-KP
ILVD_RUEST       -----------------------MPMYRSRTSTHGRNMAGARGLWRATGMTES-DFG-KP
ILVD_HYPNA       -----------------------MIPYRSRTSTHGRNMAGARGLWRATGMTDS-DFG-KP
ILVD_MAGSA       -----------------------MPAYRSRTSTHGRNMSGARGLWRATGMTDA-DFG-KP
ILVD_ACICJ       -----------------------MPQYRSRTSTHGRNMAGARALWRATGMGDA-DFG-KP
ILVD_MAGMM       -----------------------MPQYRSRTSTHGRNMAGARALWRATGIKEE-DFG-KP
ILVD_NOSS1       ---------------MSE-------NFRSKAITQGVQRSPNRAMLRAVGFQDA--DFTKA
ILVD_TRIEI       ---------------MPE-------NLRSQLVTKGVQRAPNRAMLRAVGFEDS--DFTKP
ILVD_ACAM1       ---------------MSD-------NRNSQVVTQGVQRAPNRAMLRAVGFGDD--DFTKP
ILVD_MICAN       ---------------MAD-------NYRSRIVTQGTQRSPNRAMLRAVGFGDE--DFSKP
ILVD_SYNY3       ---------------MSN-------NPRSQVITQGTQRSPNRAMLRAVGFGDD--DFTKP
ILVD_THEEB       ---------------MAE-------NWRSRIITEGIQRTPNRAMLRAVGFGDE--DFNKP
ILVD_SYNJB       ------------MANSPF-------PLRSQVVTQGVQRSPNRAMLRAVGFRDE--DFGKP
ILVD_SYNJA       ------------MANPPF-------PLRSQVVTQGVQRSPNRAMLRAVGFRDE--DFGKP
ILVD_GLOVI       ---------------MSG-------NLRSRIVTQGVQRSPNRAMLRAVGFGDG--DFERP
ILVD_NITEU       ---------------MPD-------NRRSQTITQGAQRTPNRAMLRAVGFGDG--DFDKP
ILVD_NITEC       ---------------MPD-------NRRSQAITKGAKRAPNRAMLRAVGFGDG--DFDKP
ILVD_NITMU       ---------------MSD-------NQRSRAITQGAERTPNRAMLRAVGFSDN--DFDKP
ILVD_CHLAA       ---------------MSD-------NRRSRMITEGPQRSPNRAMLRAVGFGDN--DFTKP
ILVD_DEIGD       ---------------MTDTRTKRRMNWNSHHITQGDERAPNRAMLRAVGFEDG--DFDKA
ILVD_HALHL       ---------------MAD-------NRRSRVITQGVARTPNRAMLRAVGFRDE--DFEKP
ILVD_PROMS       -----------------------MNKLRSSAITQGVQRSPNRSMLRAVGFNDE--DFNKP
ILVD_PROM9       -----------------------MNKLRSSAITQGVQRSPNRSMLRAVGFNDE--DFNKP
ILVD_PROM0       -----------------------MNKLRSSAITQGVQRSPNRSMLRAVGFNDE--DFNKP
ILVD_PROM2       -----------------------MNKLRSSAITQGVQRSPNRSMLRAVGFNDE--DFNKP
ILVD_PROM5       -----------------------MNKLRSSAITQGVQRSPNRSMLRAVGFSDD--DFTKP
ILVD_PROMP       -----------------------MNKLRSSAITQGVQRSPNRSMLRAVGFSDE--DFTKP
ILVD_PROMA       ------------------------MKLRSSAITQGVQRSPNRAMLRAVGFEDD--DFNKP
ILVD_PROM3       -------------------------MLRSAAITKGTQRSPNRAMLRAVGFGDE--DFNKP
ILVD_PROMM       -------------------------MLRSAAITKGTQRSPNRAMLRAVGFGDE--DFNKP
ILVD_SYNSC       -------------------------MLRSDAVTKGIQRSPNRAMLRAVGFGDS--DFGKP
ILVD_SYNPX       -------------------------MLRSDAVTKGIQRSPNRAMLRAVGFGDE--DFGKP
ILVD_SYNS9       -------------------------MLRSDAVTKGIQRSPNRAMLRAVGFGDA--DFGKP
ILVD_SYNR3       -----------------------MAPLRSSAITQGVQRSPNRAMLRAVGFGDG--DFSKP
ILVD_PROMT       -------------------------MLRSNAITQGIQRSPNRAMLRAVGFDDN--DFNKP
ILVD1_AROAE      ---------------MSDPTRPARIDERSRNVTEGVMRAPNRSMYYAMGYRET--DFGKP
ILVD3_AROAE      ---------------MSDPTRPARIDERSRNVTEGVMRAPNRSMYYAMGYRET--DFSKP
ILVD3_BORBR      ----------------------MSDNNRSRHITEGVARAPNRAMYYALGYTEA--DFQNP
ILVD2_BORPA      ----------------------MSDNNRSRHITEGVARAPNRAMYYALGYTEA--DFQNP
ILVD2_BORPE      ----------------------MSDNNRSRHITEGVARAPNRAMYYALGYTEA--DFQNP
ILVD_BURMA       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURM9       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURM7       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURMS       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURPS       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURP6       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURP1       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURP0       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_BURTA       ----------------------MSYNRRSKNITQGVARSPNRSMYYALGYQKD--DFDKP
ILVD2_BURL3      ----------------------MAYNRRSKHITQGVARSPNRSMYYALGYQKD--DFDKP
ILVD1_CUPPJ      ----------------------MAFNKRSRNITQGVARSPNRSMYYALGYQKE--DFDKP
ILVD_RALSO       ----------------------MPDNKRSQHITQGVARSPNRSMYYALGYKKE--DFSNP
ILVD_HERAR       ----------------------MAFNRRSKNITQGVSRSPNRSMYYAMGYEKA--DFDKP
ILVD_JANMA       ----------------------MAFNRRSKNITQGISRSPNRSMYYAMGYEKE--DFDKP
ILVD_POLNA       -----------------METKVIAINRRSANITEGKSRAPNRSMYYAMGYEES--DFKKP
ILVD_POLSJ       -----------------METKTIQLNPRSKNITEGKSRAPNRSMYYAMGYEEA--DFKKP
ILVD_RHOFT       -----------------MDIKPVILNPRSKNITEGKSRAPNRSMYYAMGYEAD--DFKKP
ILVD_VEREI       -------------MADNKTTTIEPINRRSANITQGKSRAPNRSMYYAMGYVEG--DFVKP
ILVD_METPP       ----------------------MSINRRSKNITEGVARAPNRSMYYAMGYQEA--DFKKP
ILVD_TREPR       ------------------------MNTNSRRITHGFTRSPNRAMLCAMGYDGA--DFAKP
ILVD_CHRSD       ------------MSQQDSPANADHRRRHSSIVVDGPGKAASRAMLRAVGFTDE--DFKKP
ILVD2_PSEHT      -------------------MTSEKPRKYSQKIVDGSAQAPSRSMLRAVGFNDD--DFKKS
ILVD2_ACIAD      -------------------MSKDNIRQYSAPVYDGIENAPARSMMRAVGFQDK--DFNRP
ILVD_METCA       -------------------MTDKHPRPHSSQVVDGMERAPSRAMLHAVGFADA--DFAKP
ILVD_RUTMC       ----------------MRRKIMYNPRKYSSQVVDGFERAPSRAMLYPVGFTKE--DFNKP
ILVD_LACLS       -----------MEFKYNGKVESIELNKYSKTLTQDPTQPATQAMHYGIGFKDE--DFKKA
ILVD_LACLA       -----------MEFKYNGKVESVELNKYSKTLTQDPTQPATQAMYYGIGFKDE--DFKKA
ILVD_CYTH3       -----------------MIIVSTELNKISKRLTQDPSQPASQAMMYGAGFTDE--DMKKP
ILVD_FRATN       --------------------MKKVLNKYSRRLTEDKSQGASQAMLYGTGMNDA--DMHKP
ILVD_FRATT       --------------------MKKVLNKYSRRLTEDKSQGASQAMLYGTEMNDA--DMHKP
ILVD_FRAP2       --------------------MTKVLNKYSRRLTEDKSQGASQAMLYGTGMNDN--DMHKP
ILVD_RHOBA       ------------MTASQPESDSNALNKYSSKITQPKSQGASQAMLYATGMSSE--DMNKP
ILVD_LEPBJ       --------------------MSDILKKRSSMTTDGDNRAPNRAMLRAVGFTDE--DFHKP
ILVD_LEPBL       --------------------MSDILKKRSSMTTDGDNRAPNRAMLRAVGFTDE--DFHKP
ILVD_LEPIN       --------------------MGDNLKKRSSMTTDGDNRAPNRAMLRAVGFTDE--DFHKP
ILVD_LEPIC       --------------------MGDNLKKRSSMTTDGDNRAPNRAMLRAVGFTDE--DFHKP
ILVD_STRPN       -------------------MTELDKRHRSS-IYDSMVKSPNRAMLRATGMTDK--DFETS
ILVD_STRR6       -------------------MTELDKRHRSS-IYDSMVKSPNRAMLRATGMTDK--DFETS
ILVD_STRP2       -------------------MTELDKRHRSS-IYDSMVKSPNRAMLRATGMTDK--DFETS
ILVD_STRT2       --------------MEENIVSENNMKHRSS-VYDSMVKSPNRAMLRATGMTDD--SFEKP
ILVD_STRT1       --------------MEENIVSENNMKHRSS-VYDSMVKSPNRAMLRATGMTDD--SFEKP
ILVD_STRSY       ---------------MTDTNKLKDFRHRSS-VYDSMVKSPNRAMLRATGMTDD--SFEKP
ILVD_STRS2       ---------------MTDTNKLKDFRHRSS-VYDSMVKSPNRAMLRATGMTDD--SFEKP
ILVD_STRSV       --------------MKGKAMTDKDIRHRSK-IYDSMVKSPNRAMLRATGMTDK--DFETP
ILVD_STRMU       ---------------MTDKKTLKDLRNRSS-VYDSMVKSPNRAMLRATGMQDE--DFEKP
ILVD_OCEIH       --------------------MGKDLRIKSK-AFDGTMRAPNRAMLRAVGLTDE--DFKKP
ILVD2_STAS1      -------------MTKEHSEQQKDLRIRSKVISEGVSRTPNRAYLRALGFEDE--DFQKP
ILVD_ROSCS       --------------------MSSDLKRHSRTITDGRTRAGARAMLKAIGFTDE--DLAKP
ILVD_ROSS1       --------------------MSSDLKRRSRTITDGRTRAGARAMLKAIGFTDE--DLAKP
ILVD_KORVE       -----------------MTEKSPKPHKRSDAITEGPNRAPARAMLRAAGFTPE--DLRKP
ILVD_THET2       --------------------------MRSDQIKKGLKQAPARAMLRAVGVGDE--DFGRP
ILVD_THET8       --------------------------MRSDQIKKGLKQAPARAMLRAVGVGDE--DFGRP
ILVD_HALMA       MSNQERQE--------RP---EKDPDLRSTEVTEGYEKAPHRAMFRAMGYDDE--DLSSP
ILVD_NATPD       MSQQTEPDDDAALDGDEPGAYGKDERLRSREVTEGPERAPHRAMFRAMGYDDE--DLSSP
ILVD2_BORBR      ---------------------MSLHKHRSRMVTQGLTRTPHRAFLRATGFDDA--ALEKS
ILVD3_BRADU      -----MKLRCPAAYGTSHVDDANMKKLRSRITTDGLDRAPHRAFMRAMGLDDA--AIAKP
ILVD2_BRADU      ----------------MNAKTNIKQRLPSRHVTEGPARAPHRSYFYAMGLTTE--QIHQP
ILVD2_RHILO      ----MRQAAPPAARMRMDAKVISKAKLPSRHVTVGPARAPHRSYLYAMGLSAA--EIAQP
ILVD_PARL1       ----------------MDAKTFDKSKLPSRHVTVGPERAPHRSYYYAMGLTEE--EINQP
ILVD_PELUB       ------------------MAKFNKKKLPSRHTSLGADRAPHRSFYYAMGETEK--DVAKP
ILVD_DINSH       ----------------MLKRSFDKSKLPSRHVTEGPSRAPHRSYYYAMGMTEE--EIHQP
ILVD_PYRAR       ---------------------MVKLRIRSSQWYDGVDNAPHRPYLRAVGLTEA--DFAKP
ILVD_PYRIL       ---------------------MVKVRIRSPAWYDGVDNTPHRSYLRAIGFTDE--DFTKP
ILVD_PYRAE       ---------------------MVKIRIRSPLWYDGVDNAPHRSYLKAIGFTEE--DFSKP
ILVD_PYRCJ       ---------------------MVRVRIRSPSWYDGVDNAPHRVYLRAVGFTEE--DFSKP
ILVD_AERPE       -----------------------MKRPRSRLWYDGLENTPHRVYLRAIGFTSD--DFQKP
ILVD_METS5       --------------------MYD--KSRSNKVYGGYEKAPNRAFLKAMGLTDD--DISKP
ILVD_SULTO       --------------------MNPDKKKRSNLIYGGYEKAPNRAFLKAMGLTDD--DIAKP
ILVD_PICTO       --------------------------MGSKEFYGGIEKSPNRSFLKAMGLTDK--DISNG
ILVD_SULAC       ---------------------MPESKLNSPLRYHGIYNAPHRAFLRSVGLTDG--EINKP
ILVD_SACS2       ---------------------MP-AKLNSPSRYHGIYNAPHRAFLRSVGLTDE--EIGKP
ILVD_MYCA1       --------MPTTDSARAADIKQPDIKPRSRDVTDGLEKAAARGMLRAVGMGDE--DFAKP
ILVD_MYCPA       --------MPTTDSARAADIKQPDIKPRSRDVTDGLEKAAARGMLRAVGMGDE--DFAKP
ILVD_MYCUA       -------------------MPEADIKPRSRDVTDGLEKAAARGMLRAVGMVDE--DFAKA
ILVD_MYCBO       --------MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDE--DFAKP
ILVD_MYCTU       --------MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDE--DFAKP
ILVD_MYCLE       -------------------MMPPDIKPRSRDVTDGLEKAAARGMLRAVGMNDD--DFAKA
ILVD_MYCSJ       ---MPSGSSESPADALRASDSTPDIKPRSRDVTDGLEKTAARGMLRAVGMGDD--DWVKP
ILVD1_NOCFA      ---------------MAEQTNTPDLKPRSRDVTDGLERTAARGMLRAVGMGDD--DWEKP
ILVD_ACIC1       ------------------MRAQPDLKPRSRDVTDGLERAAARGMLRAVGMTDA--DWEKP
ILVD_NOCSJ       ---------------MTEPTSRPDIKPRSRDVTDGLEKAAARGMLRAVGMGDE--DFAKP
ILVD_ARTS2       ----------MSEDTQTATENKPDIKPRSRVVTDGIHAAPARGMFRAVGMGDD--DFAKP
ILVD_RENSM       ----------MSVETSSETGNKPDIKPRSRIVTDGIAAAPARGMLRAVGFGDE--DFAKP
ILVD_CLAM3       -------------------MPEIDMKPRSRDVTDGIEATAARGMLRAVGMGDE--DWAKP
ILVD_CLAMS       -------------------MPEIDMKPRSRDVTDGIEATSSRGMLRAVGMGDE--DWEKP
ILVD_LEIXX       -------------------MPQIDWKPRSRVVTDGIEATTSRGMLRAVGMGDA--DWEKP
ILVD_TROW8       -----------MFMSSDANACEIDIKPRSRVVTHGIEATTSRGMLRAVGMGDA--DWEKP
ILVD_TROWT       -----------MFMSSDANACEIDIKPRSRVVTHGIEATTSRGMLRAVGMGDA--DWEKP
ILVD2_COREF      ----------------MTNDHDIDIKPRSRDVTDGLERTAARGMLRAVGMGDD--DWEKP
                                                          :                  

ILVD_CALS8       LIAVVNSWNEVVPGHIHLDKIAEAVKAGIRL-AGATPMEFNVIGVCDGIAMGHIGMKYSL
ILVD_HUNT2       LIGVVNSRNEIVPGHIHLDKIAEAVKAGIRM-AGGTPVEFGAIGVCDGIAMGHTGMKYSL
ILVD_CALS4       IIGVANSKNEIIPGHIHLDKIAEAVKAGIRM-AGGTPVEFSTIGVCDGIAMGHGGMKYSL
ILVD_CLOB8       LVGIVSSQNDIVPGHMNLDKIVEAVKMGVSM-AGGTPIVFPAIAVCDGIAMGHEGMKYSL
ILVD_CLOK5       LVGIVSSKNDIVPGHMNLDKIVEAVKTGVSM-AGGTPIVFPAIAVCDGIAMGHQGMKYSL
ILVD_LACP7       LIGIVSSYNEIVPGHMNLDKIVEAVKLGVAM-AGGTPIVFPAIAVCDGIAMGHIGMKYSL
ILVD_CLOAB       LIGIANSYSELIPGHMNLDKIVKAVKDGIRM-AGGVPVEFGTIGVCDGISMNHKGMSYSL
ILVD_CARHZ       FIGVVHSFSEIVPGHVHLRTVVEAVKAGVRT-AGGVPFELPVIGVCDGIAMNHEGMKYSL
ILVD_MOOTA       IIGVVNAHNELIPGHIHLNNLVEAVKAGVRL-AGGTPLEFPTIGVCDGLAMNHVGMKYSL
ILVD_SYNFM       LIGVANSANEIIPGHIHLDKVAEAVKAGIRL-AGGTPIEFSTIGVCDGIAMNHAGMRYSL
ILVD_SYNAS       LIGVVNAANEIIPGHIHLDRIVEDVKAGIRM-AGGTPVEFPAIGICDGIAMGHLGMKYSL
ILVD_DESVH       LVGVVNAANEVVPGHIHLDDIAEAVKAGVRA-AGGTPLEFPAIAVCDGLAMNHEGMRFSL
ILVD_DESVV       LVGVVNAANEVVPGHIHLDDIAEAVKAGVRA-AGGTPLEFPAIAVCDGLAMNHEGMRFSL
ILVD_DESAG       LVGVVNSANEVVPGHIHLHTIAEAVKAGVRA-AGGTPMEFPAIAVCDGLAMNHEGMRFSL
ILVD_THEMA       FIGIVSSWNEIIPGHVHLDKVVEAVKAGVRM-AGGVPFVFPTIGICDGIAMDHRGMKFSL
ILVD_THEP1       FIGIVSSWNEIIPGHVHLDKVVEAVKAGVRM-AGGVPFVFPTIGICDGIAMDHRGMKFSL
ILVD_PYRAB       LIGIVNSFNELIPGHIHLRRIAEAVKTGVRM-SGGTPLEFSTIGICDGIAMGHGGMKYSL
ILVD_PYRFU       LIGVANSFNELIPGHIHLRKIAEAVKAGIRM-AGGTPLEFNTIGICDGIAMNHLGMKYSL
ILVD_CLONN       LIGIVNSHNEIIPGHFHLNEIVQAVKLGVAS-AGGTPIEIPSIGICDGISMNHSGMKYPL
ILVD_IGNH4       LIGVANSWNEIVPGHVHLDKVAEAVKAGIRM-AGGTPLEFGTIAVCDGIAMGHEGMRYSL
ILVD_GEOMG       FIGVATSFTDLIPGHVGMRDLERFIEKGIHS-GGGYAFFFGIPGVCDGIAMGHKGMHYSL
ILVD_GEOSL       FIGVATSFTDLIPGHVGMRDLERFIEKGIHS-GGGYAFFFGIPGVCDGISMGHKGMHYSL
ILVD_GEOUR       FIGVATSFTDLIPGHVGMRDLERFIEKGIHT-GGGYAFFFGIPGVCDGISMGHKGMHYSL
ILVD_PELPD       FIGVATSFTDLIPGHVGMRDLERFIEKGVHT-GGGHAFFFGLPGVCDGIAMGHKGMHYSL
ILVD_PELCD       LIGIATSFTDLIPGHIGMRDLERFIEKGVHT-GGGYSFLFGIPGVCDGIAMGHKGMHYSL
ILVD_METMJ       FIGIANAYNNIVPGHLHLRSISQKVQEGVAA-AGAVPFEFGTIGICDGIAMGHEGMRYSL
ILVD_METB6       FIGIANAFNTIVPGHTHLRQLSDKVKEGIAA-AGGVPFEFGVIGICDGIAMGHEGMRYSL
ILVD_METHJ       FIGIANSWNTIVPGHTHLRVLGERVREGITA-GGGTPFEFNTIGICDGIAMGHEGMRYSL
ILVD_ARCFU       FIGVANAYNTIVPGHMTLDKLTQAVKEGVYA-AGGVPFEFGIIGICDGIAMGHEGMCFSL
ILVD_METTH       FIGIANSYTDIVPGHIHLRELAEAVKEGVNA-AGGVAFEFNTMAICDGIAMNHDGMKYSL
ILVD_METST       FIGIANSYTDIVPGHIHLKDLVQEVKEVIRL-EGGVPFEFDTMAVCDGIAMNHEGMYYSL
ILVD_METS3       FIGIANSFTEIVPGHIHLRELVEFVKEGIIA-AGGIPFEFNTMAICDGISMNHEGMKYSL
ILVD_METJA       FIGVVNSFTEVVPGHIHLRDIAEAVKKGIYA-NGGTAFEFNTMAICDGIAMGHEGMKYSL
ILVD_META3       FIGIVNSFTEVVPGHIHLNTLAEAAKKGVYA-NGGTPFEFNTMAVCDGIAMGHEGMRYSL
ILVD_METM5       FIGVVNSFTEVVPGHIHLKTLSDAVKHGVYA-NGGTPFEFNTIGICDGIAMGHEGMKYSL
ILVD_METM7       FIGVVNSFTEVVPGHIHLKTLSEAVKHGVYA-NGGTPFEFNTIGICDGIAMGHEGMKYSL
ILVD_METMP       FIGIVNSFTEVVPGHIHLRTLSEAAKHGVYA-NGGTPFEFNTIGICDGIAMGHEGMKYSL
ILVD_METVS       FIGVVNSFTDVVPGHIHLRTLAEAVKNGVYA-NGGTPFEFNTIGICDGIAMGHEGMKYSL
ILVD1_METAC      FIAVVNSWNEIVPGHIHLDKLAEAVKAGIRN-AGGVPFEFHTIGVCDGLAMGHEGMKYSL
ILVD_METMA       FIAVVNSWNDIIPGHIHLNKLAEAVKAGIRN-AGGVPFEFHTIGVCDGIAMGHEGMKYSL
ILVD2_METAC      FIAVVNSWNDIIPGHMHLNKLAEAVKAGIRN-AGGVPFEFHTVGVCDGIAMGHEGMKYSL
ILVD_METBF       FIAVVNSWNDIIPGHIHLNKLAEAVKAGIRN-AGGVPFEFHTIGVCDGIAMGHEGMKYSL
ILVD_METBU       FIAVVNSWTEFIPGHIHLDKVAEAVKAGIRN-AGGVPFEFHTIGVCDGIAMGHEGMKYSL
ILVD_METTP       FIGVANSANEFVPGHIHLDRIAEAVKAGIRI-AGGVPFEFQTIGVCDGIAMGHGGMRYSL
ILVD_METKA       FVAVVNTYSEVVPGHMHLDKVTEAVKAGIRM-AGGVPFEVETIALCDGIAMNTPGMKYSL
ILVD_DEHMB       FIGIVNSFTEVVPGHIHLRQISEAVKEGINA-AGGVGFEFNTIAVCDGIAMNHAGMKYSL
ILVD_DEHMC       FIGIVNSFTEVVPGHIHLRQISEAVKEGINA-AGGVGFEFNTIAVCDGIAMNHAGMKYSL
ILVD_DEHM1       FIGIVNSFTEVVPGHIHLRRISEAVKEGINA-AGGVGFEFNTIAVCDGIAMNHAGMKYSL
ILVD_ANADE       FIGIANSHIDIIPGHYYLQEYGRIAKDEIRK-AGGVPFEFNTIGVDDGIAMGHEGMRYSL
ILVD_ANADF       FIGIANSHVDIIPGHFFLQEYGRIAKDEIRK-AGGVPFEFNTIGVDDGIAMGHAGMLYSL
ILVD_ARCB4       FIGVANSFIELIPGHFFLDKVSAIIKEEIRA-NGCVPFEFNTIGVDDGIAMGHDGMLFSL
ILVD_SULNB       FIGVANSFIELIPGHYFLNKVAEVIKNEIRA-NGCVPFEFNTIGVDDGIAMGHDGMLYSL
ILVD_NITSB       FIGVANSFIEIIPGHFFLNKYAAIIKDEIRK-CGCVPFEFNTIGVDDGIAMGHDGMLYSL
ILVD_SULDN       FIGIANSYIDIIPGHFFLHEYGEIVKAAIRE-AGGVPFVFNTIGVDDGIAMGHDGMLYSL
ILVD_HELHP       FIGIANSYIDIIPGHFFLNRYAQIIKEEIRA-AGGVPFEFNTIGVDDGIAMGHSGMLYSL
ILVD_WOLSU       FIGVANSYIDIIPGHFFLQEYGRIIKEEIRA-AGGIPFEFNTIGVDDGIAMGHDGMLYSL
ILVD_CAMFF       FIGVANSFIEIIPGHFFLNKYSEILKDEIRK-NGCVPFEFNTIGVDDGIAMGHEGMLYSL
ILVD_CAMHC       FIGVCNSFAEIIPGHFFLNKFAKIIKDEIRK-NGCVPFEFNCIGVDDGIAMGHDGMLYSL
ILVD_CAMC5       FIGVANSFIEIIPGHFFLNKYAEILKDEIRK-NGCVPFEFNTIGVDDGIAMGHGGMLYSL
ILVD_CAMJE       FIGVANSYIDIIPGHYFLNDYAKIIKDEIRK-NGCVPFEFNTIGVDDGIAMGHEGMLYSL
ILVD_CAMJR       FIGVANSYIDIIPGHYFLNNYAKIIKDEICK-NGCVPFEFNTIGVDDGIAMGHEGMLYSL
ILVD_CAMJD       FIGVANSYIDIIPGHYFLNDYAKIIKDEIRK-NGCVPFEFNTIGIDDGIAMGHEGMLYSL
ILVD_CAMJJ       FIGVANSYIDIIPGHYFLNDYAKIIKDEIRK-NGCVPFEFNTIGVDDGIAMGHEGMLYSL
ILVD_CAMJ8       FIGVANSYIDIIPGHYFLNDYAKIIKDEIRK-NGCVPFEFNTIGVDDGIAMGHEGMLYSL
ILVD_AQUAE       LIGIANSYIDIIPGHVHLREFVEPIKEEVRK-LGGVPIEFNVIGVDDGIAMGHEGMHYSL
ILVD_BACVZ       FIAVCNSYIDIVPGHVHLQEFGKIVKEAIRE-AGGVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACSU       FIAVCNSYIDIVPGHVHLQEFGKIVKEAIRE-AGGVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACP2       FIAVCNSYIDIVPGHVHLQEFGKIVKEAIRE-AGGVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACLD       FIAVCNSYIDIVPGHVHLQEFGKIVKEAIRE-AGGVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_GEOKA       FIAVVNSYIDIIPGHVHLQEFGRIVKEAIRE-AGGVPFEMNTIGVDDGIAMGHIGMRYSL
ILVD_BACAH       FIAICNSFIEIIPGHKHLNEFGKLVKEAVRA-AGMVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACHK       FIAICNSFIEIIPGHKHLNEFGKLVKEAVRA-AGMVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACAN       FIAICNSFIEIIPGHKHLNEFGKLVKEAVRA-AGMVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACC1       FIAICNSFIEIIPGHKHLNEFGKLVKEAVRA-AGMVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACCZ       FIAICNSFIEIIPGHKHLNEFGKLVKEAVRA-AGMVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACCR       FIAICNSFIEIIPGHKHLNEFGKLVKEAVRA-AGMVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACCN       FVAICNSFIEIIPGHKHLNEFGRLVKEAVRA-AGMVPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACSK       FIGVCNSYIDIIPGHMHLNKFAEVAKEAIIE-AGGIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_BACHD       FIGVCNSYIDIIPGHMHLNKFAEVAKEAIRE-AGGIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_LISMO       FIAICNSYIDIVPGHVHLRELADVAKEAIRE-AGGIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_LISMF       FIAICNSYIDIVPGHVHLRELADVAKEAIRE-AGGIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_LISW6       FIAICNSYIDIVPGHVHLRELADVAKEAIRE-AGGIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_LISIN       FIAICNSYIDIVPGHVHLRELADVAKEAIRE-AGGIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAC       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAE       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAA2       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAA9       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAS       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAA1       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAM       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAW       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAN       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAA8       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAT       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAA3       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAB       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAAR       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAES       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAEQ       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD_STAHJ       FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFNTIGVDDGIAMGHIGMRYSL
ILVD1_STAS1      FVAICNSYIDIVPGHVHLRELADIAKEAIRE-AGAIPFEFDTIGVDDGIAMGHIGMRYSL
ILVD_LEUMM       FIAICNSYVEIIPGHVHLRELADVAKQAIRD-AGGIPFEFNTIGVDDGIAMGHLGMRYSL
ILVD_SYMTH       FIGIANSYIDIVPGHVHLKEFGDLVKEAVRE-AGGVPFIFNTIGVDDGIAMGHIGMRYSL
ILVD_CHLCH       FIGICNSYNELIPGHTHLQELGRIAKEAVRE-AGGVPFEFNTIGVCDGIAMGHIGMRYSL
ILVD_CHLPD       FIGICNSFNELIPGHAHLQELGRIAKNEVRK-AGGIPFEFNTIGVCDGIAMGHIGMRYSL
ILVD_PELLD       FIGICNSFNELIPGHAHLQELGRIAKEEVRK-AGGVPFEFNTIGVCDGIAMGHIGMRYSL
ILVD_CHLPM       FIGICNSFNELIPGHAHLQELGRIAKEEVRK-AGGVPFEFNTIGVCDGIAMGHIGMRYSL
ILVD_CHLTE       FIGICNSFNELIPGHAHLQELGRIAKEAVRE-AGGVPFEFNTIGVCDGIAMGHVGMRYSL
ILVD_BIFAA       IIAIANSFDEFLPGHVHLNKVGRLISDAIKE-AGGIPREFNTMAVDDGIAMGHTGMLYSL
ILVD_BIFLO       IIAIANSFDEFLPGHVHLNKVGRIVSEAIRE-AGGIPREFNTMAVDDGIAMGHTGMLYSL
ILVD_CORGL       IVAIVNSYTQFVPGHVHLKNVGDIVADAVRK-AGGVPKEFNTIAVDDGIAMGHGGMLYSL
ILVD_CORGB       IVAIVNSYTQFVPGHVHLKNVGDIVADAVRK-AGGVPKEFNTIAVDDGIAMGHGGMLYSL
ILVD1_COREF      IVAIVNSYTQFVPGHVHLKNVGDIVADAVRA-AGGVPKEFNTIAVDDGIAMGHGGMLYSL
ILVD_CORDI       IVAIVNSYTQFVPGHVHLKNVGDIVAEAVRA-AGGVPKEFNTIAVDDGIAMGHGGMLYSL
ILVD_CORJK       IIAIANSYTQFVPGHVHLKDVGDIVADAIRE-AGGVPREFNTIAVDDGIAMGHAGMLYSL
ILVD3_NOCFA      IVAIANSYTQFVPGHVHLKDVGEIVAEAVRA-AGGVPREFHTIAVDDGIAMGHGGMLYSL
ILVD_FRACC       IVAVANSFTEFVPGHVHLRNLGSLVAGAVAE-AGGVAREFNTIAVDDGIAMGHGGMLYSL
ILVD_SALAI       IVAIANSFTQFVPGHVHLKDLGGLVADAVAE-AGGVGREFNTIAVDDGIAMGHGGMLYSL
ILVD_STRAW       IIAVANSFTEFVPGHTHLQPVGRIVSEAITA-AGGIAREFNTIAVDDGIAMGHGGMLYSL
ILVD_STRCO       IIAVANSFTEFVPGHTHLAPVGRIVSEAVTA-AGGIPREFNTIAVDDGIAMGHGGMLYSL
ILVD2_NOCFA      VVAVANSFTEFVPGHTHLQPVGRIVGDAIRR-AGGIPREFNTIAVDDGIAMGHQGMLYSL
ILVD_THEFY       IVAVANSYTQFVPGHVHLREVADVVADAVRA-AGGVPREFNTIAVDDGIAMGHGGMLYSL
ILVD_BACFR       IIAIVNSFTQFVPGHVHLHEIGQLVKKEIEK-LGCFAAEFNTIAIDDGIAMGHDGMLYSL
ILVD_BACFN       IIAIVNSFTQFVPGHVHLHEIGQLVKKEIEK-LGCFAAEFNTIAIDDGIAMGHDGMLYSL
ILVD_BACTN       IIAIVNSFTQFVPGHVHLHEIGQLVKAEIEK-LGCFAAEFNTIAIDDGIAMGHDGMLYSL
ILVD_PARD8       IIAIVNSFTQFVPGHTHLHEIGQLVKAEIEK-QGCFAAEFNTIAIDDGIAMGHDGMLYSL
ILVD_BLOFL       IVAVVNSFTQFVPGHVHLRNVGKLVSEEIYI-NGGVAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BLOPB       IIAVVNSFTQFVPGHIHLRNVGALVSEQINI-TGGVAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BUCAI       IIAVVNSFSQFVPGHIHLQEVGKLICGEIQK-SGGVAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BUCDN       IIAIVNSFSQFVPGHIHLKKVGELISDQIQK-SGGVPKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BUCAP       IIAIVNSFSQFVPGHIHLQEVGKIISKEIKK-YGGVPKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BUCMH       IIAVVNSFTEFVPGHIHLRNLGKLISSEIKL-TGGVAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BUCSC       IIAVVNSFTEFVPGHIHLKELGTLVSSIIKL-EGGVAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BUCBP       IIAVVNSFTEFVPGHIHLRELGQLVSQYIIS-SGGVSKEFNTIAIDDGIAMGHSGMLYSL
ILVD_BUCCC       IIAVVNSFTEFVPGHIHLRELGQLVSKEIEK-SGGIAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_ACTP2       IIAVVNSFTQFVPGHVHLRDMGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_MANSM       IIAVVNSFTQFVPGHVHLHDIGQMVVKQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_HAES1       IIAVVNSFTQFVPGHVHLKDMGQLVATEIEK-FGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_HISS2       IIAVVNSFTQFVPGHVHLKDMGQLVAAEIEK-FGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_PASMU       IIAVVNSFTQFVPGHVHLKDMGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_HAEI8       IIAVVNSFTQFVPGHVHLKDMGQLVAAEIEK-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_HAEIG       IIAVVNSFTQFVPGHVHLKDMGQLVAAEIEK-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_HAEIN       IIAVVNSFTQFVPGHVHLKDMGQLVAAEIEK-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_HAEIE       IIAVVNSFTQFVPGHVHLKDMGQLVAAEIEK-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ACTSZ       IIAVVNSFTQFVPGHVHLKDMGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_AERHH       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_AERS4       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_VIBCH       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_VIBC3       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_VIBVU       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_VIBVY       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_VIBPA       IIAVVNSFTQFVPGHVHLKDLGQLVAQEIEA-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ALIF1       IIAVVNSFTQFVPGHVHLKDMGQLVAGEIEK-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_PHOPR       IIAVVNSFTQFVPGHVHLKDMGQLVAGEIEK-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECOLC       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECOHS       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECO24       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHIF8       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHISS       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHIFL       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECOLI       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHIBS       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECO57       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHIDS       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECOUT       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECOK1       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECOL5       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ECOL6       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SALPB       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SALTY       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SALCH       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SALPA       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SALTI       IITVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_KLEP7       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_ENT38       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_YERPE       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIVA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_YERPA       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIVA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_YERPN       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIVA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_YERPP       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIVA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_YERP3       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIVA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_YERPS       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIVA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_YERE8       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_PECAS       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SODGM       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_PHOLL       IIAVVNSFTQFVPGHVHLRDLGKLVAEQIEA-SGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_COLP3       IIAVVNSFTQFVPGHVHLKDMGQLVAGAIEE-AGGVAKEFNTIAVDDGIAMGHSGMLYSL
ILVD_PSYIN       IIAIANSFTQFVPGHVHLKDMGQLVAGAVEA-AGGIAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_SHEB5       IIAIANSFTQFVPGHVHLKDMGSLVASAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEB9       IIAISNSFTQFVPGHVHLKDMGSLVASAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEB8       IIAIANSFTQFVPGHVHLKDMGSLVASAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEPC       IIAIANSFTQFVPGHVHLKDMGSLVASAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHESW       IIAIANSFTQFVPGHVHLKDMGSLVASAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHESM       IIAIANSFTQFVPGHVHLKDMGSLVAGAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHESR       IIAIANSFTQFVPGHVHLKDMGSLVAGAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHESA       IIAIANSFTQFVPGHVHLKDMGSLVADAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEON       IIAIANSFTQFVPGHVHLKDMGSLVASAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEDO       IIAIANSYTQFVPGHVHLKDMGDLVASAIAE-AGGISKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEFN       IIAIANSFTQFVPGHVHLKNMGSLVAGAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHELP       IVAIANSFTQFVPGHVHLKDMGSLVAGAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEAM       IIAIANSFTQFVPGHVHLKDMGSLVASAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEHH       IIAIANSFTQFVPGHVHLKDMGSLVAGAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHEPA       IIAISNSFTQFVPGHVHLKDMGSLVAGAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SHESH       IIAIANSFTQFVPGHVHLKDMGSLVAGAIEE-AGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_PSEA6       IIAVSNSFTQFVPGHVHLKDMGQLVARSIEA-AGGVAKEFNTIAVDDGIAMGHSGMLYSL
ILVD1_PSEHT      IIAVVNSFTQFVPGHVHLNQLSELMGETITA-AGGVPKEFNTIAIDDGIAMGHGGMLYSL
ILVD1_BURL3      IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BURVG       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD2_CUPPJ      IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_ACIAC       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_MARMS       IIAVVNSFTQFVPGHVHLKDMGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_SACD2       IIAVVNSFTQFVPGHVHLKDMGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEAE       IIAIANSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEAB       IIAIANSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEA7       IIAIANSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEMY       IIAIANSFTQFVPGHVHLKDLGQLVAREIEK-HGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEU5       IIAIANSFTQFVPGHVHLKDMGQLVAREIEK-HGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEP1       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEPK       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEPG       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEE4       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEPF       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEF5       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSE14       IIAIANSFTQFVPGHVHLKDMGQLVAREVER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSEU2       IIAIANSFTQFVPGHVHLKDMGQLVAREVER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PSESM       IIAIANSFTQFVPGHVHLKDMGQLVAREVER-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_XANAC       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-VGGVAKEFDTIAVDDGIAMGHDGMLYSL
ILVD_XANC5       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-VGGVAKEFDTIAVDDGIAMGHDGMLYSL
ILVD_XANOR       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-VGGVAKEFDTIAVDDGIAMGHDGMLYSL
ILVD_XANOM       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-VGGVAKEFDTIAVDDGIAMGHDGMLYSL
ILVD_XANCP       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-VGGVAKEFDTIAVDDGIAMGHDGMLYSL
ILVD_XANC8       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-VGGVAKEFDTIAVDDGIAMGHDGMLYSL
ILVD_XYLFA       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-LGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_XYLFT       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-LGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_HAHCH       IIAVVNSFTQFVPGHVHLKDLGQLVCREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHORT       IIAIANSFTQFVPGHVHLKDMGQLVAAEIAA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_HYDCU       IIAVANSFTQFVPGHVHLKDMGQLVAGVIEE-AGGIAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_CAUVC       IIAVANSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_GRABC       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_ZYMMO       IIAVANSFTQFVPGHVHLKDMGQLVAEEIEK-AGGIAKEFNTIAIDDGIAMGHGGMLYSL
ILVD_GLUOX       IIAIANSFTQFVPGHVHLKDMGSLVASAIEE-VGGIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_AZOSB       IIAIANSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD2_AROAE      IIAIANSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHAGMLYSL
ILVD_DECAR       IIAVVNSFTQFVPGHVHLKDMGQLVAREIEA-AGGVAKEFNTIAIDDGIAMGHSGMLYSL
ILVD1_BORBR      IIAVVNSFTQFVPGHVHLRDLGALVASEIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD1_BORPA      IIAVVNSFTQFVPGHVHLRDLGALVASEIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD1_BORPE      IIAVVNSFTQFVPGHVHLRDLGALVAREIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_BORA1       IIAVVNSFTQFVPGHVHLKDLGALVASQIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_NEIMA       IIAVANSFTQFVPGHVHLHNMGQLVAREIEK-AGAIAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_NEIMF       IIAVANSFTQFVPGHVHLHNMGQLVAREIEK-AGAIAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_NEIMB       IIAVANSFTQFVPGHVHLHNMGQLVAREIEK-AGAIAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_NEIG1       IIAVANSFTQFVPGHVHLHNMGQLVAREIEK-AGAIAKEFNTIAIDDGIAMGHSGMLYSL
ILVD_PSYA2       IIAIANSFTQFVPGHVHLKDLGQMVAREIEK-AGGVAKEFNTIAVDDGIAMGHSGMLYSL
ILVD_CHRVO       IIAIANSFTQFVPGHVHLQNMGQLVAREIEK-AGGVAKEFNTIAIDDGIAMGHGGMLYSL
ILVD_METFK       IIAIANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHSGMLYSL
ILVD_SYNP6       IIAVANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_SYNE7       IIAVANSFTQFVPGHVHLKDLGQLVAREIER-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_NITOC       IIAIANSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFHTIAVDDGIAMGHSGMLYSL
ILVD_NOVAD       IIAVVNSFTQFVPGHVHLKDLGQMVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_SPHAL       IIAVVNSFTQFVPGHVHLKDLGQMVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD1_ACIAD      IIAVVNSFTQFVPGHVHLKDLGQMVAEQIQA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_DEIRA       IIAVVNSFTQFVPGHVHLKDLGQLVAGEIAA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHIEC       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHIL3       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHIME       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_SINMW       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_AGRFC       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD1_RHILO      IIAVVNSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BRUAB       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BRUA2       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BRUO2       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BRUC2       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BRUSU       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BRUME       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BRUSI       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_OCHA4       IIAVVNSFTQFVPGHVHLKDLGQLVAREIES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHOP5       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEK-AGGIAKEFNTIAIDDGIAMGHDGMLYSL
ILVD_NITHX       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_NITWN       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFHTIAVDDGIAMGHDGMLYSL
ILVD_AZOC5       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEK-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHOPA       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHOP2       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD1_BRADU      IIAVVNSFTQFVPGHVHLKDLGQLVAREIEQ-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_BARHE       IIAIANSFTQFVPGHVHLKDLGQLVAQQIVA-SGGIAKEFNTIAIDDGIAMGHDGMLYSL
ILVD_BART1       IIAIANSFTQFVPGHVHLKDLGQLVAQQIEI-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHOS4       IIAIVNSFTQFVPGHVHLKDLGQLVAREVEA-AGGIAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RHOS1       IIAIVNSFTQFVPGHVHLKDLGQLVAREVEA-AGGIAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_PARDP       IIAIVNSFTQFVPGHVHLKDLGQMVAREVEA-AGGIAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RUEPO       IIAIVNSFTQFVPGHVHLKDLGQMVAREVEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_RUEST       IIAIVNSFTQFVPGHVHLKDLGQMVAREVES-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_HYPNA       IIAVVNSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHDGMLYSL
ILVD_MAGSA       IIAIANSFTQFVPGHVHLKDLGQMVAREIEK-AGGVAKEFDTIAIDDGIAMGHAGMLYSL
ILVD_ACICJ       IIAIANSFTQFVPGHVHLKDLGQLVAREIEA-AGGVAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_MAGMM       IIAVANSFTQFVPGHVHLREVGKLVAEEIEA-CGAIAKEFNTIAVDDGIAMGHGGMLYSL
ILVD_NOSS1       IVGVANGYSTITPCNMGINQLAQRAEAGINT-AGAKPQIFGTITISDGISMGTEGMKYSL
ILVD_TRIEI       IIGVANAHSTITPCNMGINDLAMRAVSGVKE-AGGMPQIFGTITISDGISMGTEGMKYSL
ILVD_ACAM1       IVGLANGFSTITPCNMGIDSLATRAEASIRT-AGAMPQKFGTITISDGISMGTEGMKYSL
ILVD_MICAN       IIGIANGFSTITPCNMGINDLAMRAEAATRL-AGGMPQLFGTITISDGISMGTEGMKYSL
ILVD_SYNY3       IVGIANGYSTITPCNMGINDLALRAEAGLRT-AGAMPQLFGTITISDGISMGTEGMKYSL
ILVD_THEEB       IVGVASAHSTITPCNMGIAALASRAEAGIRA-AGGMPQLFGTITVSDGISMGTEGMKYSL
ILVD_SYNJB       IVGIANAHSTLTPCNMGIQTLAERAEAALRT-AGCMPQVFGTITISDGISMGTEGMKYSL
ILVD_SYNJA       IVGIANAHSTITPCNIGIQTLAERAEAALRA-AGCMPQVFGTITISDGISMGTEGMKYSL
ILVD_GLOVI       IVGVANGFSTITPCNLGLGALAERAEAALRA-GGAMPQLFGTITISDGISMGTEGMKYSL
ILVD_NITEU       IVGVANGFSTITPCNMGLDTLAKCAEHALKT-AGAMPQMFGTITVSDGISMGTEGMKYSL
ILVD_NITEC       IVGIANGFSTITPCNMGLDTLAKCAEHALKN-AGAMPQMFGTITVSDGISMGTEGMKYSL
ILVD_NITMU       IVGVANGFSTITPCNKGLNELALAAEQALKQ-AAAMPQMFGTITVSDGISMGTEGMKYSL
ILVD_CHLAA       IVGVANGHSTLTPCNAGLGALAARAEEAIRA-AGGMPQIFGTITVSDGISMGTEGMKYSL
ILVD_DEIGD       IIGVAHAQSNITPCNNGLGELADHITGALRE-GGAMPQVYGTITVSDGISMGTEGMKCSL
ILVD_HALHL       IIGVGNAHSTITPCNVGIGAMARRAEEALRE-VGAMPMKFGTITVSDGITMGTEGMKYSL
ILVD_PROMS       IIGVANGYSTITPCNMGLNKLALKAEESIKR-SGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_PROM9       IVGVANGYSTITPCNMGLNKLALKAEESIKR-SGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_PROM0       IIGVANGYSTITPCNMGLNKLALKAEESIKR-SGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_PROM2       IIGVANGYSTITPCNIGLNKLALKAEESIRR-SGGMPQKFGTITVSDGISMGTEGMKYSL
ILVD_PROM5       IIGVANGYSTITPCNMGLNKLALKAEDSIRK-SGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_PROMP       IIGVANGFSTITPCNMGLNKLALKAEESIRE-AGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_PROMA       IIGIANGYSTITPCNIGLNDLAKQAEKAIKD-WDGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_PROM3       IIGIANGYSTITPCNIGLNDLARRSEEAARQ-AGAMPQMFGTITVSDGISMGTEGMKYSL
ILVD_PROMM       IIGIANGYSTITPCNIGLNDLARRSEEAARQ-AGAMPQMFGTITVSDGISMGTEGMKYSL
ILVD_SYNSC       ILGIANGYSTITPCNIGLNDLAKRAEEAARQ-AGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_SYNPX       ILGIANGYSTITPCNVGLNDLSRRAEEAARQ-AGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_SYNS9       ILGIANGYSTITPCNIGLDVLAKRAEEAARL-AGGMPQMFGTITVSDGISMGTEGMKYSL
ILVD_SYNR3       IIGIANGYSTITPCNVGLNDLALRAEAATQA-AGGMPQLFGTITVSDGISMGTEGMKYSL
ILVD_PROMT       IIGIANGHSTITPCNMGLMDLANRAESALKE-AGAMPQTFGTITVSDGISMGTEGMKYSL
ILVD1_AROAE      MVGVASAHSTITPCNSGLQPLADTVAAALKE-AGANPQLFGTPTVSDGIGMGTEGMKYSL
ILVD3_AROAE      MVGVASAHSTITPCNSGLQPLADTVVAALKE-AGANPQLFGTPTVSDGIGMGTEGMKYSL
ILVD3_BORBR      MIGVANGHSTITPCNSGLQRLADAAIEAIRV-SRANPQVFGTPTISDGMSMGTEGMKYSL
ILVD2_BORPA      MIGVANGHSTITPCNSGLQRLADAAIEAIRV-SRANPQVFGTPTISDGMSMGTEGMKYSL
ILVD2_BORPE      MIGVANGHSTITPCNSGLQRLADAAIEAIRV-SRANPQVFGTPTISDGMSMGTEGMKYSL
ILVD_BURMA       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURM9       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURM7       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURMS       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURPS       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURP6       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURP1       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURP0       MIGIANGHSTITPCNAGLQRLSDAAVAAVKD-AGANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_BURTA       MIGVANGHSTITPCNAGLQRLVDAAVSAVKQ-ADANPQTFGTPTISDGMSMGTEGMKYSL
ILVD2_BURL3      MVGIANGHSTITPCNSGLQRLSDAAVAAVKA-ADANPQIFGTPTISDGMSMGTEGMKYSL
ILVD1_CUPPJ      MVGIANGHSTITPCNAGLQRLADAAIDAVKA-SDANPQVFGTPTISDGMSMGTEGMKYSL
ILVD_RALSO       MIGVANGHSTITPCNSGLQKLADAAVAAVKA-SNANPQIFGTPTISDGMSMGTEGMKYSL
ILVD_HERAR       MVGIANGHSTITPCNSGLQKLADIAIKTIKD-AGGNPQVFGTPTISDGMSMGTEGMKYSL
ILVD_JANMA       MVGVANGHSTITPCNSGLQKLADIAIKTIKD-SGGNPQVFGTPTISDGMSMGTEGMKYSL
ILVD_POLNA       MIGVANGHSTITPCNSGLQKLADAAIDAIEE-AGGNAQVFGTPTISDGMAMGTEGMKYSL
ILVD_POLSJ       MIGVANGHSTITPCNSGLQKLADAAIAGIEE-AGGNAQVFGTPTISDGMAMGTEGMKYSL
ILVD_RHOFT       MIGVANGHSTITPCNSGLQKLADAAIAAIEE-AGGNAQVFGTPTISDGMSMGTEGMKYSL
ILVD_VEREI       MVGVANGHSTITPCNSGLQKLTDAAIEGIEE-AGGNAQVFGTPTISDGMAMGTEGMKYSL
ILVD_METPP       MIGVANGHSTITPCNSGLQKLADAAVEGIEA-AGGNAQIFGTPTISDGMAMGTEGMKYSL
ILVD_TREPR       IIGVGSGYSTITPCNAGIQRVVDAAKAMLAR-HGAMTQVFGIPTISDGISMGTPGMRYSL
ILVD_CHRSD       QVGIASTWSRVTPCNSHINVLADAASDGADA-AGGKGVVFNTITISDGIANGTEGMKYSM
ILVD2_PSEHT      QVGIASTWSMVTPCNMHINTLAEEVGKGVDS-AGAKSVIYNTITVSDGISMGTEGMKYSL
ILVD2_ACIAD      FIGIASTWANVTPCNMHIDGLAREAEHGVNQ-ASGKGIIFNTITISDGISNGTEGMKYSL
ILVD_METCA       QIGIASTWAMVTPCNMHINKLAEDAARGVDG-GGGKAVIFNTITISDGISMGTEGMKYSL
ILVD_RUTMC       QVGIASTWSMVTPCNMHINKLADETLKGVNA-TGGKAIIFNTITISDGISMGSEGMKYSL
ILVD_LACLS       QVGIVSMDWDGNPCNMHLGTLGSKIKNSVNQTDGLIGLQFHTIGVSDGIANGKLGMRYSL
ILVD_LACLA       QVGIVSMDWDGNPCNMHLGTLGSKIKSSVNQTDGLIGLQFHTIGVSDGIANGKLGMRYSL
ILVD_CYTH3       IVGIGSTGFDGNTCNMHLNILAGQVKGSITR-GGMVGLGFNTIGVSDGISMGTEGMRFSL
ILVD_FRATN       QIGIGSVWYEGNTCNMHLNQLAQFVKDSVEK-ENLKGMRFNTIGVSDGISMGTDGMSYSL
ILVD_FRATT       QIGIGSVWYEGNTCNMHLNQLAQFVKDSVEK-ENLKGMRFNTIGVSDGISMGTDGMSYSL
ILVD_FRAP2       QIGIASVWYEGNTCNMHLNQLAQFVKNSVEK-ENLKGMRFNTIGVSDGISMGTDGMSYSL
ILVD_RHOBA       QVGIGSMWYEGNSCNMHLLDLAADVKAGVTD-AGMVGMRFNTIGVSDGISMGTDGMSFSL
ILVD_LEPBJ       MIGIASTWSEVTPCNIHINKLAEKVKEGVRT-AGGVPQIYGTITVSDGITMGHEGMHFSL
ILVD_LEPBL       MIGIASTWSEVTPCNIHINKLAEKVKEGVRT-AGGVPQIYGTITVSDGITMGHEGMHFSL
ILVD_LEPIN       MIGIASTWSEITPCNIHINKLAEKVKEGVRE-AGGVPQIYGTITVSDGIMMGHEGMHFSL
ILVD_LEPIC       MIGIASTWSEITPCNIHINKLAEKVKEGVRE-AGGVPQIYGTITVSDGIMMGHEGMHFSL
ILVD_STRPN       IVGVISTWAENTPCNIHLHDFGKLAKEGVKS-AGAWPVQFGTITVADGIAMGTPGMRFSL
ILVD_STRR6       IVGVISTWAENTPCNIHLHDFGKLAKEGVKS-AGAWPVQFGTITVADGIAMGTPGMRFSL
ILVD_STRP2       IVGVISTWAENTPCNIHLHDFGKLAKEGVKS-AGAWPVQFGTITVADGIAMGTPGMRFSL
ILVD_STRT2       IVGVISTWAENTPCNIHLHGFGQIAKEGVKD-AGAWPVQFGTITVADGIAMGTPGMRFSL
ILVD_STRT1       IVGVISTWAENTPCNIHLHGFGQIAKEGVKD-AGAWPVQFGTITVADGIAMGTPGMRFSL
ILVD_STRSY       IVGVISTWAENTPCNIHLHDFGKLAKEGVKE-AGAWPVQYGTITVADGIAMGTPGMRFSL
ILVD_STRS2       IVGVISTWAENTPCNIHLHDFGKLAKEGVKE-AGAWPVQYGTITVADGIAMGTPGMRFSL
ILVD_STRSV       IVGVISTWAENTPCNIHLHDLGKLAKEGIKA-EGAWPVQYGTITVADGIAMGTPGMRFSL
ILVD_STRMU       IVGVISTWAENTPCNIHLHDFGKLAKVGVKE-AGAWPVQFGTITVSDGIAMGTQGMRFSL
ILVD_OCEIH       MIGVASTWAEVTPCNIHLNDLALLAKKGVRH-SDAVPLVFNTITVSDGISMGTQGMNYSL
ILVD2_STAS1      MIGVASTWSEVTPCNMHIDGLARASKQGISE-AGASPLIFNTITVSDGISMGTDGMRFSL
ILVD_ROSCS       IIGIANTWIETMPCNINLRALAARVKEGVRA-AGGTPMEFNTVAISDGVTMGTEGMKASL
ILVD_ROSS1       IIGIANTWIETMPCNINLRALAARVKEGVRA-AGGTPMEFNTVAIADGVTMGTEGMKASL
ILVD_KORVE       IIGIANTWIEIGPCNLHLRELAEHIKQGVRE-AGGTPMEFNTVSISDGITMGSEGMKASL
ILVD_THET2       FVGVVNTFTDGMPCNFHLRELAQHLKAGLRE-AGLFPFEFGAPAISDGISMGTPGMRASL
ILVD_THET8       FVGVVNTFTDGMPCNFHLRELAQHLKAGLKE-AGLFPFEFGAPAISDGISMGTPGMRASL
ILVD_HALMA       MIGVANPAADITPCNVHLDDVADAAYDGIDD-TEGMPIEFGTITISDAISMGTEGMKASL
ILVD_NATPD       LIGVPNPAADITPCNVHLDDVAESALEGIDE-AGGMPIEFGTITISDAISMGTEGMKASL
ILVD2_BORBR      MVGIVSTQGENTPCSMALGPQADRARLGVAA-GGGVPVSFSTISISDGTSMNHAGMRMSL
ILVD3_BRADU      MVGIVSMKGEQTPCNMTHDFQVAAAKTGIEE-AGGTPREFSTVSVSDGISMNHEGMKFSL
ILVD2_BRADU      FVGVASCWNEAAPCNIALMRQAQAVKKGVAH-AGGTPREFCTITVTDGIAMGHDGMRSSL
ILVD2_RHILO      LVGVASCWNEAAPCNISLMRQAQVVKKGVAA-ANGTPREFCTITVTDGIAMGHQGMKSSL
ILVD_PARL1       FVGVATCWNEAAPCNIALMRQAQSVKKGVKA-AAGTPREFCTITVTDGIAMGHQGMKSSL
ILVD_PELUB       FVGVVSTWNEAAPCNIALMRQAQSVKKGVRA-SGGTPREFCTITVTDGIAMGHEGMKSSL
ILVD_DINSH       LVGVATCWNEAAPCNIALSRQAQAVKMGVKQ-ASGTPREFTTITVTDGIAMGHEGMRSSL
ILVD_PYRAR       LVGVLVSWSELGPCNFHNLELVRYVKEGVKE-AGGVGLAAPTIVVNDGINMGTPGMRYSL
ILVD_PYRIL       LVGVLAAWSELGPCNYHTLELAKYVKEGIKE-AGGVGLIAPTIVVNDGINMGTPGMRYSL
ILVD_PYRAE       IVGVLASWSELGPCNYHTLELAKYVKEGIKE-AGGVGLAAPTIVVNDGINMGTPGMRYSL
ILVD_PYRCJ       LVGVAVSWSELGPCNYHTLELARYVKEGVKE-AGGAALAAPTIVVNDGINMGTPGMRYSL
ILVD_AERPE       LIAVVAAWSEAGPCNFNVLPGSLRVKEGVRS-AGGVPLAVPTIVVNDGINMGTPGMRYSL
ILVD_METS5       LVGVAVAWNEAGPCNIHLLGLSQVVKEGIRE-LGGTPRTFTAPVLIDGIAMGSESMKYSL
ILVD_SULTO       IVGVAVAWNEAGPCNIHLLGLSNIVKEGVRS-GGGTPRVFTAPVVIDGIAMGSEGMKYSL
ILVD_PICTO       LVGVGVAWSESGPCNIHALSLGNKAAEGVSH-SGMTPRLFATPLVIDGMAMGNEGMRYSL
ILVD_SULAC       LVAVATAWSEAGPCNFHTLSLAHVAKEGAKE-GGLTPLAFPTIVVNDNIGMGTEGMRYSL
ILVD_SACS2       LVAIATAWSEAGPCNFHTLALARVAKEGTKE-AGLSPLAFPTMVVNDNIGMGSEGMRYSL
ILVD_MYCA1       QIGVASSWNEITPCNLSLDRLAKAVKEGVFA-AGGYPLEFGTISVSDGISMGHEGMHFSL
ILVD_MYCPA       QIGVASSWNEITPCNLSLDRLAKAVKEGVFA-AGGYPLEFGTISVSDGISMGHEGMHFSL
ILVD_MYCUA       QIGVASSWNEITPCNLSLDRLAKSVKEGVFA-AGGYPLEFGTISVSDGISMGHEGMHFSL
ILVD_MYCBO       QIGVASSWNEITPCNLSLDRLANAVKEGVFS-AGGYPLEFGTISVSDGISMGHEGMHFSL
ILVD_MYCTU       QIGVASSWNEITPCNLSLDRLANAVKEGVFS-AGGYPLEFGTISVSDGISMGHEGMHFSL
ILVD_MYCLE       QIGVASSWNEITPCNLSLDRLAKAVKEGVFS-AGGYPLEFGTISVSDGISMGHQGMHFSL
ILVD_MYCSJ       QIGVGSSWNEITPCNMSLQRLAQSVKGGVHS-AGGFPLEFGTISVSDGISMGHEGMHFSL
ILVD1_NOCFA      QIGVASSWNEITPCNLSLDRLAQGCKDGVFA-AGGFPMQFGTISVSDGISMGHEGMHFSL
ILVD_ACIC1       QIGVASSWNEITPCNLSLDRLAQAAKEGVHA-AGGYPLEFATISVSDGISMGHEGMHFSL
ILVD_NOCSJ       QIGVGSSWNEITPCNLSLDRLAKAVKNGVHA-AGGYPLEFGTISVSDGISMGHEGMHFSL
ILVD_ARTS2       QIGVASSWNEITPCNLSLNRLAQGAKEGVHA-GGGFPMQFGTISVSDGISMGHEGMHFSL
ILVD_RENSM       QIGVASSWNEITPCNLSLDRLAKAVKEGVHA-GGGFPMIFGTISVSDGISMGHEGMHFSL
ILVD_CLAM3       QIGVASSWSEITPCNLSLDRLAQGAKEGVHA-GGGYPLQFGTISVSDGISMGHEGMHFSL
ILVD_CLAMS       QIGVASSWNEVTPCNLSLDRLAQGAKEGVHA-GGGYPLQFGTISVSDGIAMGHEGMHFSL
ILVD_LEIXX       QIGIASSWNEITPCNLSLDRLAQGAKEGVHS-GGGYPLQFGTVSVSDGISMGHEGMHFSL
ILVD_TROW8       QIGIASSWNNITPCNLSLDRLAQGAREGVHA-AGGYPLQFCTISVSDGISMGHEGMHFSL
ILVD_TROWT       QIGIASSWNNITPCNLSLDRLAQGAREGVHA-AGGYPLQFCTISVSDGISMGHEGMHFSL
ILVD2_COREF      QIGVASSWNEITPCNLTLKKLAGFAKEGVHE-AGGYPLEFGTISVSDGISMGHEGMHYSL
                  : :        .                               : *    .  .*  .:

ILVD_CALS8       ITRELIADSIEAMVMAHQFDGMVLIPNCDKIVPGMLMAAARVNIPSILISGGPMLAGRVD
ILVD_HUNT2       ATRELIADSCEAMALAHSFDGMVFIPNCDKIVPGMLMAAARINVPAIVVSGGPMLSLRHN
ILVD_CALS4       GSREVIADSIEIMAMAHGFDGIVLIPNCDKIVPGMLMAAARLDIPAIVVSGGPMLAGICD
ILVD_CLOB8       VTRDLIADSTEAMAMAHAFDALVMVPNCDKNVPGLLMAAARVNIPTIFVSGGPMLAGKVD
ILVD_CLOK5       VTRDLIADSTEAMAMAHAFDALVMVPNCDKNVPGLLMAAARLNIPTIFVSGGPMLAGKVD
ILVD_LACP7       VTRDLIADSTEAMAMAHSFDALVMVPNCDKNVPGLLMAAARVNIPTIFVSGGPMLAGRVH
ILVD_CLOAB       PSRQIIADSVEIVAKAHALDGLVLVPNCDKVVPGMLMAAGRVNIPSIVISGGPMLSGRTN
ILVD_CARHZ       ASRELIADSVEVMVKAHQFDALVFVPNCDKIVPGMLIAAMRLNLPAIFVSGGPMLAGRVR
ILVD_MOOTA       ASRELIADMIEVMAMAHPFDALVFIPNCDKIVPGMLMAAARLNLPAIFISGGPMLAGRYQ
ILVD_SYNFM       ASRELIADSVEIMSMAHPFDGLVAVPNCDKIIPGMLMAMLRLDIPAILISGGPMLAGRAG
ILVD_SYNAS       ASRELIADSTEAMVMAHPFDGLVLVPNCDKIIPGMLMAALRLNIPSIFVSGGPMLAGRLD
ILVD_DESVH       PSRELIADSIEIMATAHPFDALVFIPNCDKSVPGMLMAMLRLDVPSVMVSGGPMLAGATL
ILVD_DESVV       PSRELIADSIEIMATAHPFDALVFIPNCDKSVPGMLMAMLRLDVPSVMVSGGPMLAGATL
ILVD_DESAG       PSREIIADSIEIMATAHPFDALVFIPNCDKSVPGMLMAMLRMNVPSILISGGPMMAGTGN
ILVD_THEMA       PSRELIADSIEIVASGFPFDGLVFVPNCDKITPGMMMAMGRLNIPSVLISGGPMLAGRYN
ILVD_THEP1       PSRELIADSIEIVASGFPFDGLVFVPNCDKITPGMMMAMGRLNIPSVLISGGPMLAGRYN
ILVD_PYRAB       PSRELIADSIEAVVRAYNFDGIVMIASCDKIIPGMLMAMARLDIPAIFISGGPMLPGRFK
ILVD_PYRFU       PSRELIADSVELVARVYHFDGIVVIASCDKIIPGMLMAIARLNIPAIFVSGGPMLPGRFK
ILVD_CLONN       ASRELIADSIEAMTIAHKFDALVLVGNCDKIVPGMLMGAARLNVPAIYVSGGPMLPGKLK
ILVD_IGNH4       PSREVIADTVEIMVEAHRLDAVVMVTNCDKITPGFLLAAARLEVPVILINGGPMMPGVYG
ILVD_GEOMG       PTRELIADMVESVAEAHRLDGLVLLTNCDKITPGMLMAAARLDIPTIVVTAGPMMAGRGV
ILVD_GEOSL       PTRELIADMVESVAEAHRLDGLVLLTNCDKITPGMLMAAARLNIPSIVVTAGPMMAGRGT
ILVD_GEOUR       PTRELIADMVESVAEAHRLDGLVLLTNCDKITPGMLMAAARLDIPCIVVTAGPMMSGRGE
ILVD_PELPD       PTRELIADMVESVAEAHRLDGLVLLTNCDKITPGMLMAAARLDIPCIVVTAGPMMSGRGQ
ILVD_PELCD       STRELIADMVESIAEAHRLDGLVLLTNCDKITPGMLMAAARLDIPCIVVTAGPMLTGTGR
ILVD_METMJ       PSRENIADAVELMVEAHRFDGLVCVCTCDKIVPGMLMAAVRCNIPAIVVTGGPMLPGYAA
ILVD_METB6       PSRENIADSIELMVQAHRFDGLVCVGTCDKIVPGMLMAAVRTNIPTIVVTGGAMLPGSSG
ILVD_METHJ       PSRENIADSVELMIQAHKFDGIVCICTCDKIVPGMLMAAGRCNIPAIVLTGGNMLPGNLH
ILVD_ARCFU       PSRELVADTIEAMVEAHRFDGLVVVASCDKIIPGMLMAMLRLNIPAIAVTGGPMPYERVG
ILVD_METTH       ASREIVADTVESMAMAHALDGLVLLPTCDKIVPGMLMAAARLDIPAIVVTGGPMLPGEFK
ILVD_METST       PSREIIANTVESMAMAHQFDALILMPTCDKVVPGMIMAAARLNIPAIVITGGPMMPGKFH
ILVD_METS3       PSREIIAATVESMAKGHSFDGLVLMPSCDKVVPGMLMGAARVDVPTIVVTGGPMAAGQYK
ILVD_METJA       PSREIIADTVESMAKAHGFDGLVLIPSCDKIVPGMIMGAIRTGLPFIVVTGGPMFPGELR
ILVD_META3       PSREIIADTVESMAKAHGFDGLVLIPSCDKIVPGMIMGALRLNIPFIVITGGPMQPGELH
ILVD_METM5       PSREIIADAVESMARAHGFDGLVLIPTCDKIVPGMIMGALRLNIPFIVVTGGPMLPGEFQ
ILVD_METM7       PSREIIADAVESMARAHGFDGLVLIPTCDKIVPGMIMGALRLNIPFIVVTGGPMLPGEFQ
ILVD_METMP       PSREIIADAVESMARAHGFDGLVLIPTCDKIVPGMIMGALRLNIPFIVVTGGPMLPGEFQ
ILVD_METVS       PSREIIADAVESMARAHGFDGLVLIPTCDKIVPGMIMGALRLNIPFIVVTGGPMLPGEFQ
ILVD1_METAC      PSREVIEDTIELMVRAHQFDGMVLIPTCDKIVPGHLMAAGRLDIPAIVVTGGPMLPGYVD
ILVD_METMA       PSREVIEDTIELMVRAHQFDGMVLIPTCDKIVPGHLMAAGRLDIPAIVVTGGPMLPGYVD
ILVD2_METAC      PSREIIEDTIELMVKAHQFDGMVLIPSCDKIVPGHLMAAGRLDIPAIVVTGGPMLPGYVD
ILVD_METBF       PSREVIEDTIELMVKAHQFDGIVLIPTCDKIVPGHLMAAGRLDIPAIVVTGGPMLPGYVD
ILVD_METBU       PSREAIEDTIEIMIQGQQMDGMVMVTSCDKITPGHLMAAGRVDIPAIVVTGGPMLPGFVD
ILVD_METTP       PSREIIEDSIEIMAQAHQLDGLVLIPTCDKIVPGHLMAAGRLDLPTIVVTGGPMLPGFAC
ILVD_METKA       PSRELVADTIETVIEAHRFDGFVAIVSCDKMVPGALMAAARLDLPAAIVTGGPMEPGCVD
ILVD_DEHMB       PSREIIANTVEIMAMAHAFDGLVFIPNCDKVVPGMLMAACRLNIPSIFVSGGPMLAGRLR
ILVD_DEHMC       PSREIIANTVEIMAMAHAFDGLVFIPNCDKVVPGMLMAACRLNIPSIFVSGGPMLAGRLR
ILVD_DEHM1       PSREIIANTVEIMAMAHAFDGLVFIPNCDKVVPGMLMAACRLNIPSIFVSGGPMLAGRLR
ILVD_ANADE       PSRELIADSIETVMNAHQLDALVCIPNCDKIVPGMLMGALRVNVPTVFVSGGPMKAGHLH
ILVD_ANADF       PSRELIADSIETMMNAHSLDALLCIPNCDKIVPGMLMGALRVDVPTVFCSGGPMKAGRMA
ILVD_ARCB4       PSRELIANSIETVMNAHKLDAMIAIPNCDKIVPGMIMGALRVNVPTIFVSGGPMQKGYTK
ILVD_SULNB       PSREIIANSIETVMNAHKLDAMIAIPNCDKIVPGMIMGALRVDVPTVFVSGGPMAAGHMD
ILVD_NITSB       PSREIIANSIETVMNAHKLDALICIPNCDKITPGMIMGALRVNVPTIFVSGGPMKAGKLS
ILVD_SULDN       PSREIIADSIETVMNAHKLDALICIPNCDKIVPGMIMGALRVNVPTVFVSGGPMAAGHKK
ILVD_HELHP       PSRELIADSIETMMNAHSLDAMICIPNCDKIVPGMLMGALRVNVPTIFVSGGPMKAGKLE
ILVD_WOLSU       PSRELIADCIETVMNAHKLDAMICIPNCDKIVPGMLLGALRVNVPTVFVSGGPMKAGRLK
ILVD_CAMFF       PSREIIANSVETVMNAHALDALVCIPNCDKIVPGMLMGALRVNVPTIFVSGGPMAAGVGA
ILVD_CAMHC       PSREIIANSVETMMNAHKLDALICIPNCDKIVPGMIMGALRVNVPTIFISGGPMAAGRGK
ILVD_CAMC5       PSREIIANSIETVMNAHALDALVCMPNCDKIVPGMVMGALRVNVPTIFVSGGPMRKGYTK
ILVD_CAMJE       PSRELIANSIETVMNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTK
ILVD_CAMJR       PSREIIANSIETVMNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTK
ILVD_CAMJD       PSREIIANSIETVMNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTK
ILVD_CAMJJ       PSREIIANSIETVMNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTK
ILVD_CAMJ8       PSREIIANSIETVMNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTK
ILVD_AQUAE       PSRELIADSIETVVNAHQLDALICIPNCDKIVPGMLMGALRVNVPTVFISGGPMLAGEVN
ILVD_BACVZ       PSREIIADSVETVVSAHWFDGMVCIPNCDKITPGMLMAAMRINIPTIFVSGGPMAAGRTS
ILVD_BACSU       PSREIIADSVETVVSAHWFDGMVCIPNCDKITPGMLMAAMRINIPTIFVSGGPMAAGRTS
ILVD_BACP2       PSREIIADSVETVVSAHWFDGMVCIPNCDKITPGMMMAAMRVNIPTVFVSGGPMEAGRTS
ILVD_BACLD       PSREIIADSVETVVSAHWFDGMVCIPNCDKITPGMIMAAMRINIPTVFVSGGPMEAGRTS
ILVD_GEOKA       PSREIIADSIETVISAHWFDGMVCIPNCDKITPGMMMAAMRLNIPTIFVSGGPMKAGVTK
ILVD_BACAH       PSREIIADSVETVVNAHWFDGMICIPNCDKITPGMMMAALRINIPTVFVSGGPMAAGKTS
ILVD_BACHK       PSREIIADSVETVVNAHWFDGMICIPNCDKITPGMMMAALRINIPTVFVSGGPMAAGKTS
ILVD_BACAN       PSREIIADSVETVVNAHWFDGMICIPNCDKITPGMMMAALRINIPTVFVSGGPMAAGKTS
ILVD_BACC1       PSREIIADSVETVVNAHWFDGMICIPNCDKITPGMMMAALRINIPTVFVSGGPMAAGKTS
ILVD_BACCZ       PSREIIADSVETVVNAHWFDGMICIPNCDKITPGMMMAALRINIPTVFVSGGPMAAGKTS
ILVD_BACCR       PSREIIADSVETVVNAHWFDGMICIPNCDKITPGMMMAALRINIPTVFVSGGPMAAGKTS
ILVD_BACCN       PSREIIADSVETVVNAHWFDGMICIPNCDKITPGMMMAAMRINIPTVFVSGGPMAAGKTS
ILVD_BACSK       PSREIICDAAETVINAHWFDGVFYIPNCDKITPGMLMAAVRTNVPAVFVSGGPMEAGRTK
ILVD_BACHD       PSREIICDAAETVINAHWFDGVFFIPNCDKITPGMLMASVRTNVPSVFVSGGPMEAGRTK
ILVD_LISMO       PSREVIADAAETVINAHWFDGVFYIPNCDKITPGMLLASVRTNVPAIFCSGGPMKAGLSA
ILVD_LISMF       PSREVIADAAETVINAHWFDGVFYIPNCDKITPGMLLASVRTNVPAIFCSGGPMKAGLSA
ILVD_LISW6       PSREVIADAAETVINAHWFDGVFYIPNCDKITPGMLLASVRTNVPAIFCSGGPMKAGLSA
ILVD_LISIN       PSREVIADAAETVINAHWFDGVFYIPNCDKITPGMLLASVRTNVPAIFCSGGPMKAGLSA
ILVD_STAAC       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAE       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAA2       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAA9       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAS       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAA1       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAM       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAW       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAN       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAA8       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAT       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAA3       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAB       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAAR       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMILAAMRTNVPAIFCSGGPMKAGLSA
ILVD_STAES       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMLLAAVRTNVPAIFCSGGPMKAGLSA
ILVD_STAEQ       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMLLAAVRTNVPAIFCSGGPMKAGLSA
ILVD_STAHJ       PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMLLAAVRTNVPAIFCSGGPMKAGLSA
ILVD1_STAS1      PSREIIADAAETVINAHWFDGVFYIPNCDKITPGMLLASVRTNVPAIFCSGGPMKAGLSS
ILVD_LEUMM       PSRELIADSAETVITAHWFDGVFFLPNCDKITPGMIMASLRCNVPSVFVSGGPMKAGLDP
ILVD_SYMTH       PSRELIADAVETVIEAHQLDALICIPNCDKITPGMLMAAMRVNIPTIFISGGPMAAGRLK
ILVD_CHLCH       ASRELIADSVETVAEAHRLDGLVCIPNCDKITPGMMMAALRINIPVIFVSGGPMKAGHTP
ILVD_CHLPD       ASRELIADSVETVVEAHRLDGIVCIPNCDKITPGMMMAALRVNIPVIFVSGGPMKAGHTP
ILVD_PELLD       ASRELIADSVETVAEAHRLDGLVCIPNCDKITPGMMMAALRINIPVIFVSGGPMKAGHTP
ILVD_CHLPM       ASRELIADSVETVAEAHRLDGLVCIPNCDKITPGMMMAALRINIPVIFVSGGPMKAGCTP
ILVD_CHLTE       ASRELIADSVETVVEAHRLDGLVCIPNCDKITPGMMMGALRTNVPVVFVSGGPMKAGHTP
ILVD_BIFAA       PSRDIIADTVEYQVNAHCADALICIPNCDKVVPGMLMAALRLNIPTVFVSGGPMEAGTTV
ILVD_BIFLO       PSRDIIADTVEYQCNAHCADALICIPNCDKVVPGMLMAALRLNIPTVFVSGGPMEAGTTV
ILVD_CORGL       PSREIIADSVEYMVNAHTADAMVCISNCDKITPGMLNAAMRLNIPVVFVSGGPMEAGKAV
ILVD_CORGB       PSREIIADSVEYMVNAHTADAMVCISNCDKITPGMLNAAMRLNIPVVFVSGGPMEAGKAV
ILVD1_COREF      PSREIIADSVEYMVNAHTADAMVCISNCDKITPGMLNAAMRLNIPVVFVSGGPMEAGKAV
ILVD_CORDI       PSREIIADSVEYMVNAHTADAMVCISNCDKITPGMLNAALRLNIPAVFVSGGPMEAGKAV
ILVD_CORJK       PSREVISDAVEYMVNGHAADALVCISNCDKITPGMLNAAMRLNIPVVFVSGGPMEAGKAV
ILVD3_NOCFA      PSREIIADSVEYMVNAHTADALVCISNCDKITPGMLNAAMRLNIPTVFVSGGPMEAGKAV
ILVD_FRACC       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLLAALRLNIPTVFVSGGAMESGNAV
ILVD_SALAI       PSRELIADAVEYMVNAHCADALVCISNCDKITPGMLLAALRLNIPTVFVSGGPMEAGKTV
ILVD_STRAW       PSRDLIADSVEYMVEAHCADALICISNCDKITPGMLMAALRLNIPTVFVSGGPMESGRAT
ILVD_STRCO       PSRDLIADSVEYMVEAHCADALICISNCDKITPGMLNAALRLNIPTVFVSGGPMESGRAT
ILVD2_NOCFA      PSRDLIADSIEYMVQAHCADALVCISNCDKITPGMLLAAMRLDIPTVFVSGGPMEGGRAT
ILVD_THEFY       PSRELIADAVEYMVNAHCADALVCVSNCDKITPGMLLAALRLNIPTVFVSGGPMEAGKVT
ILVD_BACFR       PSRDIIADSVEYMVNAHKADAMVCISNCDKITPGMLMAAMRLNIPTVFVSGGPMEAGELD
ILVD_BACFN       PSRDIIADSVEYMVNAHKADAMVCISNCDKITPGMLMAAMRLNIPTVFVSGGPMEAGELD
ILVD_BACTN       PSRDIIADSVEYMVNAHKADAMVCISNCDKITPGMLMAAMRLNIPTVFVSGGPMEAGEWN
ILVD_PARD8       PSRDIIADSVEYMVNAHKADAMVCISNCDKITPGMLMASMRLNIPTVFVSGGPMEAGELD
ILVD_BLOFL       PSRDLIADSVEYVINAHCVDAMVCISNCDKITPGMLMAALRLNIPTVFVSGGPMESGSVT
ILVD_BLOPB       PSRDLIADSVEYMINAHCVDAMVCISNCDKITPGMLMAALRLNIPAIFVSGGPMESGAIT
ILVD_BUCAI       PSRELIADSIEYVVNAHCADAMICISNCDKITPGMLMASLRLNIPSVFISGGPMEAGKIQ
ILVD_BUCDN       PSRELIADSIEYVINAHCVDAMICVSNCDKITPGMLMAALRLNIPSVFISGGPMEAGKIR
ILVD_BUCAP       PSRELIADSIEYVINAHCVDSMICVSNCDKITPAMFMASLRLNIPSVFVSGGPMEAGKIK
ILVD_BUCMH       PSRELIADSIEYMINAHCADAMICISNCDKITPGMLMAALRLNIPCIFISGGPMESGKIF
ILVD_BUCSC       PSRELIADSIEYMINAHCADAMICISNCDKITPGMLMAALRLNIPCVFVSGGPMESGRIV
ILVD_BUCBP       PSRDLIADSVEFMINAHCVDAMVCISNCDKITPGMLMAALRLNIPCVFVSGGPMESGKIV
ILVD_BUCCC       PSRELIADSIEYMIQAHCVDAMVCISNCDKITPGMLLAALRLNIPSVFVSGGPMESGKIL
ILVD_ACTP2       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKTK
ILVD_MANSM       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTK
ILVD_HAES1       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTK
ILVD_HISS2       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTK
ILVD_PASMU       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPCVFVSGGPMEAGKTK
ILVD_HAEI8       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTK
ILVD_HAEIG       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTK
ILVD_HAEIN       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTK
ILVD_HAEIE       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTK
ILVD_ACTSZ       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTK
ILVD_AERHH       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRINIPVIFVSGGPMEAGKTK
ILVD_AERS4       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRINIPVIFVSGGPMEAGKTK
ILVD_VIBCH       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAIFVSGGPMEAGKTK
ILVD_VIBC3       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAIFVSGGPMEAGKTK
ILVD_VIBVU       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASMRLNIPVIFVSGGPMEAGKTK
ILVD_VIBVY       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASMRLNIPVIFVSGGPMEAGKTK
ILVD_VIBPA       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASMRLNIPVIFVSGGPMEAGKTK
ILVD_ALIF1       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMMMAAMRLNIPVIFVSGGPMEAGKTK
ILVD_PHOPR       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_ECOLC       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECOHS       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECO24       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SHIF8       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SHISS       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SHIFL       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECOLI       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SHIBS       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECO57       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SHIDS       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECOUT       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECOK1       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECOL5       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ECOL6       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SALPB       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SALTY       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SALCH       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SALPA       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SALTI       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_KLEP7       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_ENT38       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_YERPE       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_YERPA       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_YERPN       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_YERPP       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_YERP3       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_YERPS       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_YERE8       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_PECAS       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SODGM       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_PHOLL       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPAIFVSGGPMEAGKTK
ILVD_COLP3       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMMMAAMRLNIPVIFVSGGPMEAGKTK
ILVD_PSYIN       PSRDLIADSIEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_SHEB5       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEB9       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEB8       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEPC       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHESW       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHESM       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHESR       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHESA       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEON       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEDO       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEFN       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHELP       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEAM       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_SHEHH       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SHEPA       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_SHESH       PSRELISDSVEYMVNAHCADALVCISNCDKITPGMMMAALRLNIPVIFVSGGPMEAGKTK
ILVD_PSEA6       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMASMRLNIPVIFVSGGPMEAGKTK
ILVD1_PSEHT      PSRDLIADSVEYMVNGHCADAMICISNCDKITPGMMLAALRLNIPVIFVSGGPMEAGKTK
ILVD1_BURL3      PSRDIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTR
ILVD_BURVG       PSRDIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTR
ILVD2_CUPPJ      PSRDIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTR
ILVD_ACIAC       PSRDIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKTR
ILVD_MARMS       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRINIPVIFVSGGPMEAGKTK
ILVD_SACD2       PSRDIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKTK
ILVD_PSEAE       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_PSEAB       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_PSEA7       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_PSEMY       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_PSEU5       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_PSEP1       PSREIIADAVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_PSEPK       PSREIIADAVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_PSEPG       PSREIIADAVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_PSEE4       PSREIIADAVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_PSEPF       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_PSEF5       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTK
ILVD_PSE14       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_PSEU2       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTK
ILVD_PSESM       PSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTK
ILVD_XANAC       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTK
ILVD_XANC5       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTK
ILVD_XANOR       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTA
ILVD_XANOM       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTA
ILVD_XANCP       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTK
ILVD_XANC8       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTK
ILVD_XYLFA       PSREIIADSVEYMANAHCADALVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKTK
ILVD_XYLFT       PSREIIADSVEYMANAHCADALVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKTT
ILVD_HAHCH       PSREIIADSVEYMANAHCADALVCISNCDKITPGMLMAALRLNIPAIFVSGGPMEAGKTK
ILVD_RHORT       PSRELIADAVEYMVNAHCADALVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKVV
ILVD_HYDCU       PSRDLIADSVEYMCNAHCADALVCISNCDKITPGMMMAAMRLNIPTIFVTGGPMESGKTV
ILVD_CAUVC       PSRDLIADSVEYMVNAHCADAIVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVT
ILVD_GRABC       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKTV
ILVD_ZYMMO       PSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMASMRLNIPTVFVSGGPMEAGKAE
ILVD_GLUOX       PSRELIADSVEYMVNAHCADAIVCISNCDKITPGMLMASMRLNIPVVFVSGGPMEAGKIN
ILVD_AZOSB       PSRDLIADSVEYMVNAHTADALVCISNCDKITPGMLMAALRLNIPTIFVSGGPMEAGKVK
ILVD2_AROAE      PSRELIADSVEYMVNAHTADALVCISNCDKITPGMLMAALRLNIPAIFVSGGPMEAGKVK
ILVD_DECAR       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKVK
ILVD1_BORBR      PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKIT
ILVD1_BORPA      PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKIT
ILVD1_BORPE      PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKIT
ILVD_BORA1       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVV
ILVD_NEIMA       PSRDLIADSIEYMVNAHCADALVCISNCDKITPGMLIAAMRLNIPTIFVSGGPMEAGKVI
ILVD_NEIMF       PSRDLIADSIEYMVNAHCADALVCISNCDKITPGMLIAAMRLNIPTIFVSGGPMEAGKVI
ILVD_NEIMB       PSRDLIADSIEYMVNAHCADALVCISNCDKITPGMLIAAMRLNIPTIFVSGGPMEAGKVI
ILVD_NEIG1       PSRDLIADSIEYMVNAHCADALVCISNCDKITPGMLIAAMRLNIPTIFVSGGPMEAGKVI
ILVD_PSYA2       PSRDLIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFISGGPMEAGKIL
ILVD_CHRVO       PSRDLIADSVEYMVNAHCADALVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVQ
ILVD_METFK       PSRDLIADAVEYMVSAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVN
ILVD_SYNP6       PSRDLIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEAGKVI
ILVD_SYNE7       PSRDLIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEAGKVI
ILVD_NITOC       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAAMRLNIPAVFISGGPMEAGKVK
ILVD_NOVAD       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRINIPVVFVSGGPMEAGKVI
ILVD_SPHAL       PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRINIPVVFVSGGPMEAGKVV
ILVD1_ACIAD      PSRDLIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVK
ILVD_DEIRA       PSREIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKVK
ILVD_RHIEC       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKVV
ILVD_RHIL3       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKVV
ILVD_RHIME       PSREIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEAGKVV
ILVD_SINMW       PSREIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEAGKVV
ILVD_AGRFC       PSREIIADSVEYMVNAHCADAMVCISNCDKITPGMLNAAMRLNIPAVFVSGGPMEAGKVV
ILVD1_RHILO      PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKVV
ILVD_BRUAB       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_BRUA2       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_BRUO2       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_BRUC2       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_BRUSU       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_BRUME       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_BRUSI       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_OCHA4       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVV
ILVD_RHOP5       PSRELIADSVEYMVNGHCADAMVCISNCDKITPGMLMASLRLNIPSVFVSGGPMEAGKVV
ILVD_NITHX       PSREIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNVPAVFVSGGPMESGKVN
ILVD_NITWN       PSREVIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPSVFVSGGPMESGKVT
ILVD_AZOC5       PSREIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKVL
ILVD_RHOPA       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKVV
ILVD_RHOP2       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKVV
ILVD1_BRADU      PSRELIADSVEYMANAHCADGLVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEAGKVK
ILVD_BARHE       PSREIIADSVEYMINAHCADALVCISNCDKITPGMLMASLRLNIPTIFVSGGPMEAGKIK
ILVD_BART1       PSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTIFVSGGPMEAGKIK
ILVD_RHOS4       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKVT
ILVD_RHOS1       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKVT
ILVD_PARDP       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAIFVSGGPMEAGKVT
ILVD_RUEPO       PSREVIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAIFVSGGPMEAGKID
ILVD_RUEST       PSREVIADSVEYMVNAHCADAMVCISNCDKITPGMMMAAMRLNIPVIFVSGGPMEAGKID
ILVD_HYPNA       PSREIIADSVEYMVNAHCADAMVCISNCDKITPGMMMAAMRLDIPVVFVSGGPMEAGKVN
ILVD_MAGSA       PSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPTIFISGGPMEAGKVT
ILVD_ACICJ       PSRELIADAVEYMVNAHCADALVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKYI
ILVD_MAGMM       PSRDIIADSVEYMCNAHTADALICISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKVR
ILVD_NOSS1       VSREVIADSIETVCNGQSLDGVIAIGGCDKNMPGAMIAIARINIPAIFVYGGTIKPGHYN
ILVD_TRIEI       VSRDVIADSIETVCNGQTMDGVLAIGGCDKNMPGAMIAIARMNIPAIFVYGGTIKPGNYN
ILVD_ACAM1       VSREVIADSIETACMGQSMDGVLAIGGCDKNMPGAMLAMARMNIPAIFVYGGTIKPGHLN
ILVD_MICAN       VSREVIADSIETVCNGQSLDGVLAIGGCDKNMPGAMIAMARMNIPAIFVYGGTIKPGRYK
ILVD_SYNY3       VSREVIADSIETVCNGQRMDGVLAIGGCDKNMPGAMIAMARLNIPSIFVYGGTIKPGHYA
ILVD_THEEB       VSRDVIADSIETVCNAQSMDGVLAIGGCDKNMPGAMIAMARMNIPAIFVYGGTIKPGHWQ
ILVD_SYNJB       VSREVIADSIETVVNGQSMDGLLAIGGCDKNMPGAMIAMARLNVPSIFVYGGTIKPGHYN
ILVD_SYNJA       VSREVIADSIETVVNGQSMDGLLAIGGCDKNMPGAMIAMARLNVPAIFVYGGTIKPGHYN
ILVD_GLOVI       VSREVIADSIETVCNGQSLDGVLAIGGCDKNMPGAMIAIARLNIPAVFVYGGTIKPGRYQ
ILVD_NITEU       VSREVIADSIETCVQAESMDGVIAIGGCDKNMPGAMIALARLNVPSIFVYGGTIKPGHYQ
ILVD_NITEC       VSREVIADSIETCVQAESMDGVIAIGGCDKNMPGALIALARLNVPSIFVYGGTIKPGHYQ
ILVD_NITMU       VSREVIADSIETAVQAESMDGVIAIGGCDKNMPGAMIAIARMNVPAIFVYGGTIKPGHYK
ILVD_CHLAA       VSREVIADSIETVVNAQRMDGILAVGGCDKNMPGALIAMARLDIPAIFVYGGTIKPGHYK
ILVD_DEIGD       VSREVIADSIETVSRGQSHDGLIVVGGCDKNMPGAMIGIARLNIPAIFVYGGTIKPGHYQ
ILVD_HALHL       VSREVIADSIETVGGGQRMDGMLATGGCDKNMPGAMMALARLDIPGIFVYGGTIKPGHYK
ILVD_PROMS       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMIAIARMNIPSIFIYGGTIKPGKLH
ILVD_PROM9       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMIAIARMNIPSIFIYGGTIKPGKLH
ILVD_PROM0       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMIAIARMNIPSIFIYGGTIKPGKLY
ILVD_PROM2       VSREVIADSIETACNAQSMDAVLAIGGCDKNMPGAMIAIARMNIPSIFIYGGTIKPGKLH
ILVD_PROM5       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMIAIARMNIPSIFIYGGTIKPGKLN
ILVD_PROMP       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMIAIARMNIPSIFIYGGTIKPGKLN
ILVD_PROMA       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMLAMARMNIPGIFVYGGTIKPGKLN
ILVD_PROM3       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMIALARMNIPGVFVYGGTIKPGKLA
ILVD_PROMM       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMIALARMNIPGVFVYGGTIKPGKLA
ILVD_SYNSC       VSREVIADAIETACNGQSMDGVLAVGGCDKNMPGAMLAMARMNIPSVFVYGGTIKPGKLG
ILVD_SYNPX       VSREVIADAIETACNGQSMDGVLAVGGCDKNMPGAMLAMARMNIPAVFVYGGTIKPGKLG
ILVD_SYNS9       VSREVIADAIETACNGQSMDGVLAVGGCDKNMPGAMLAMARMNIPSVFVYGGTIKPGKLG
ILVD_SYNR3       VSREVIADAIETACNGQSMDGVLAIGGCDKNMPAAMLAMARMNIPGVFVYGGTIKPGKLG
ILVD_PROMT       VSREVIADSIETACNAQSMDGVLAIGGCDKNMPGAMLSMARMNIPSIFVYGGTIKPGKLD
ILVD1_AROAE      VSREVIADSIETCVNGLWQDGVVVIGGCDKNMPGGMMALVRTNVPGIYVYGGTIKPGHYK
ILVD3_AROAE      VSREVIADSIETCVNGLWQDGVVVIGGCDKNMPGGMMALVRTNVPGIYVYGGTIKPGHYQ
ILVD3_BORBR      VSREVIADCIETAAQGQWMDGVVVIGGCDKNMPGGMMALARMNVPGIYVYGGTIKPGHYK
ILVD2_BORPA      VLREVIADCIETAAQGQWMDGVVVIGGCDKNMPGGMMALARMNVPGIYVYGGTIKPGHYK
ILVD2_BORPE      VSREVIADCIETAAQGQWMDGVVVIGGCDKNMPGGMMALARMNVPGIYVYGGTIKPGHYK
ILVD_BURMA       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURM9       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURM7       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURMS       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURPS       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURP6       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURP1       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURP0       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD_BURTA       VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARINVPGIYVYGGTIRPGHWK
ILVD2_BURL3      VSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARLNVPGIYVYGGTIRPGNWK
ILVD1_CUPPJ      ISREVIADCIETAAQGQWMDGVVVIGGCDKNMPGGMIALARTNVPGIYVYGGTIKPGNWK
ILVD_RALSO       ISREVIADCIETCAQGQWMDGVVVIGGCDKNMPGGMIALARTNVPGIYVYGGTIKPGNWK
ILVD_HERAR       ISREVIADCIETAVNGQWMDGVLVIGGCDKNMPGGMIAMLRTNVPSIYVYGGTIKPGHWK
ILVD_JANMA       ISREVIADCIETAVNGQWMDGVLVIGGCDKNMPGGMIAMLRTNVPSIYVYGGTIKPGNWK
ILVD_POLNA       VSREVISDCIETCVQGQWMDGVLVVGGCDKNMPGGLMGMLRANVPAIFVYGGTILPGHYQ
ILVD_POLSJ       VSREVISDCIETCVQGQWMDGVLVIGGCDKNMPGGLMGMLRANVPAIYVYGGTILPGSYK
ILVD_RHOFT       VSREVISDCIETCVQGQWMDGVLVIGGCDKNMPGGLMGMLRANVPAIYVYGGTILPGHYK
ILVD_VEREI       VSREVISDCIETCVSGQWLDGVLVVGGCDKNMPGGLMGMLRANVPAIYVYGGTILPGHYQ
ILVD_METPP       VSREVIADCVETCVGGQWMDGVLVVGGCDKNMPGGMMGMLRANVPAIYVYGGTILPGKYK
ILVD_TREPR       VSREVIADCIEACACGQSMDGLLVVGGCDKNLPGGMIGLLRANIPGIYLYGGTILPGYWG
ILVD_CHRSD       ASREIIADSIEAVSGCEGFDGVVAIGGCDKNMPGCMIGLARLNRPSIFVYGGTIQPGAG-
ILVD2_PSEHT      VSREVICDSIEAVSAGMGHDGIIAIGGCDKNMPGCLMGLARLNRPSIFVYGGTILPGEN-
ILVD2_ACIAD      VSREIIADSIEAVIGCQGYDGVIAIGGCDKNMPGCIMGLARLNRPGLFIYGGTIQPGEG-
ILVD_METCA       VSREVIADSIETVVACQGYDGVVAIGGCDKNMPGCLIALARLNRPAVFVYGGTILPGCHD
ILVD_RUTMC       VSREVIADSIETVVGCQGFDGVVAIGGCDKNMPGCIIGLVRLNRPSIFVYGGTIQPGKN-
ILVD_LACLS       VSREVIADSIETNAGAEYYDAIVAVPGCDKNMPGSIIGMARLNRPSIMVYGGTIEHGEYK
ILVD_LACLA       VSREVIADSIETNAGAEYYDAIVAIPGCDKNMPGSIIGMARLNRPSIMVYGGTIEHGEYK
ILVD_CYTH3       VSRDVIADSIETICEAHYYDALVTVVGCDKNMPGALIAMARLNRPSIMVYGGTIHSGHYK
ILVD_FRATN       QSRDLIADSIETVMSAHWYDGLISIPGCDKNMPGCMMALGRLNRPGFVIYGGTIQAGVMR
ILVD_FRATT       QSRDLIADSIETVMSAHWYDGLVSIPGCDKNMPGCMMALGRLNRPGFVIYGGTIQAGVMR
ILVD_FRAP2       QSRDLIADSIETVMSAHWYDGLVSIPGCDKNMPGCMMALGRLNRPGFVIYGGTIQAGVMR
ILVD_RHOBA       QSRDLIADSIETIMGAQWYDALITLPGCDKNMPGCLMAMGRLNRPSIMVYGGTIKPGSYR
ILVD_LEPBJ       PSREVIADSIEIVSNAMRHDGVIAIGGCDKNMPGCLMALCRIDAPSIFVYGGTILPGHCD
ILVD_LEPBL       PSREVIADSIEIVSNAMRHDGVIAIGGCDKNMPGCLMALCRIDAPSIFVYGGTILPGHCD
ILVD_LEPIN       PSREVIADSIEIVSNAMRHDGVIAIGGCDKNMPGCLMALCRIDAPSIFVYGGTILPGNCD
ILVD_LEPIC       PSREVIADSIEIVSNAMRHDGVIAIGGCDKNMPGCLMALCRIDAPSIFVYGGTILPGNCD
ILVD_STRPN       TSRDIIADSIEAAMSGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAIFAYGGTIAPGNLD
ILVD_STRR6       TSRDIIADSIEAAMSGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAIFAYGGTIAPGNLD
ILVD_STRP2       TSRDIIADSIEAAMSGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAIFAYGGTIAPGNLD
ILVD_STRT2       TSRDIIADSIEAAMGGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAIFAYGGTIAPGNLN
ILVD_STRT1       TSRDIIADSIEAAMGGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAIFAYGGTIAPGNLN
ILVD_STRSY       TSRDIIADSIEAAMGGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAVFAYGGTIAPGNLN
ILVD_STRS2       TSRDIIADSIEAAMGGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAVFAYGGTIAPGNLN
ILVD_STRSV       TSRDIIADSIEAAMGGHNVDAFVAIGGCDKNMPGSMIAIANMDIPAVFAYGGTIAPGKLD
ILVD_STRMU       TSRDIIADSIEAAMGGHNADAFVAIGGCDKNMPGSVIAMANMDIPAIFAYGGTIAPGNLD
ILVD_OCEIH       PSRDLIADSIETVVGAENLDGLVAIGACDKNIPGCLIAIANAGVPSVFVYGGTIAPGNVD
ILVD2_STAS1      PSREIIADSIESVVSAENLDALVAIGGCDKNMPGCMIGIARLNLPAVFVYGGTILPGKLD
ILVD_ROSCS       ISRDLIADSIELMGRGYMFDAIIALVACDKTIPGAAMGLTRLNVPGFLLYGGSIAPGHWR
ILVD_ROSS1       ISRDLIADSIELMGRGYMFDAIIALVACDKTIPGAAMGLTRLNIPGFLLYGGSIAPGHWR
ILVD_KORVE       VSREVIADSIELVARGNLFDGLIALSGCDKTIPGTIMALERLDIPGLMLYGGSIAPGKFH
ILVD_THET2       VSREVIADSVELIAQGYLYDGMVGLSACDKTIPGTAMGVIRSGVPGMVLYGGTIAPGEWQ
ILVD_THET8       VSREVIADSVELIAQGYLYDGMVGLSACDKTIPGTAMGVIRSGVPGMILYGGTIAPGEWQ
ILVD_HALMA       ISREIIADSVELVTFGERMDGIVTIGGCDKNMPGMMMAAIRTDLPSVFLYGGSIMPGEHD
ILVD_NATPD       ISREVIADSVELVSFGERMDALVTVAGCDKNLPGMMMAAIRTDLPSVFLYGGSIMPGQHE
ILVD2_BORBR      LSRETIADSVELVVRGHAYDALVAFAGCDKTLPAMMMAIVRLNVPAVFLYGGATLPGHAA
ILVD3_BRADU      FSRELIADSIEAVVHGLAYDALIGYGGCDKTLPGVMMGMVRCNVPSIFIYGGSSLPGRVD
ILVD2_BRADU      PSRECIADSVELTVRGHAYDALVGLAGCDKSLPGMMMAMVRLNVPSIFIYGGSILPGNFR
ILVD2_RHILO      VSREVIADSVELTMRGHCYDALVGLAGCDKSLPGMMMAMVRLNVPSIFIYGGSILPGSYR
ILVD_PARL1       ASRDVIADSVELTMRGHCYDALVGLAGCDKSLPGMMMSMVRLNVPSVFMYGGSILPGHFK
ILVD_PELUB       ISREVIADSTELTVRGHCYDALVGIAGCDKSLPALMMAMVRLNVPSVFIYGGSILPGQYK
ILVD_DINSH       ASREAIADTVELTMRGHCYDAIVGLAGCDKSLPGMMMAMVRLNVPSVFIYGGSILPGRLN
ILVD_PYRAR       ISRDLIADTIEAQFNSHGVDAWVGIGGCDKTQPGIMMAMVRLDLPAVYLYGGSAEAGWLG
ILVD_PYRIL       ISRDLIADTIEAQFNAHGIDAWVGIGGCDKTQPGIMMAMVRLDLPAVYMYGGTAEAGWLG
ILVD_PYRAE       ISRDLIADTIEAQFNAHGVDAWVGIGGCDKTQPGIMMAMVRLDIPAVYLYGGTAEAGWLG
ILVD_PYRCJ       ISRELIADSIEAQFNAHGVDAWVGIGGCDKTQPGIIMAMVRLNLPSVYLYGGSAEAGWLG
ILVD_AERPE       ISRELIADTIEAQVASHGFDGWVGIGGCDKTQPGIMMAMARLDLPSIYIYGGTAEHGVLD
ILVD_METS5       VSREVIANTVELTVNGHGYDGFVALGGCDKTQPGLMMSMARLNIPSVYMYGGTTLPGNFR
ILVD_SULTO       VSREIVANTVELVVNAHGYDGFVALAGCDKTPPGMMMAMARLNIPSIIMYGGTTLPGNFK
ILVD_PICTO       PSREVIANTVELTIKGHGFDAFVGISGCDKTTPGMLMGAARINVPSIVMYGGSTLPGYYM
ILVD_SULAC       VSRDLIADMVEAQFNAHAFDALIGIGGCDKTTPGILMAMARLNVPSIYIYGGSAEPGFYL
ILVD_SACS2       VSRDLIADMVEAQFNAHAFDGLVGIGGCDKTTPGILMAMARLNVPSIYIYGGSAEPGYFM
ILVD_MYCA1       VSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSILPGVAK
ILVD_MYCPA       VSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSILPGVAK
ILVD_MYCUA       VSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSILPGVAK
ILVD_MYCBO       VSREVIADSVEVVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSILPGRAK
ILVD_MYCTU       VSREVIADSVEVVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSILPGRAK
ILVD_MYCLE       VSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSILPGRTK
ILVD_MYCSJ       VSREVIADSVETVVQAERLDGTVLLAGCDKSIPGMLMAAARLDLASVFLYNGSIMPGVAK
ILVD1_NOCFA      VSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSILPGIAK
ILVD_ACIC1       ISREVIADSVETVFMAERFDGAVLLAGCDKSEPGMLMAAARLDLAAVFLYAGSTLPG--K
ILVD_NOCSJ       VSREVIADSVETVMMAERLDGSVLLAGCDKSLPGMMMAAARLDLASVFLYAGSTMPGQVD
ILVD_ARTS2       VSREVIADSVETVMQAERIDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSIMPGWVK
ILVD_RENSM       VSREVIADSVETVMQAERIDGSVLLAGCDKSLPGMLMAAARLNVSSVFLYAGSIMPGWVK
ILVD_CLAM3       VSREVIADSVETVMMAERLDGSVLLAGCDKSLPGMLMAAARLDLSSVFLYAGSIAPGWVK
ILVD_CLAMS       VSREVIADSVETVMMAERLDGSVLLAGCDKSLPGMLMAAARLDLSSVFLYAGSIAPGWVK
ILVD_LEIXX       VSREVIADSVETVMMAERLDGTVLLAGCDKSLPGMLMAAARLDLSAIFLYAGSIAPGWVK
ILVD_TROW8       VSREVITDSVETVLMAEALDGVVLLAGCDKSLPGMLMAAARLDVSAVFLYAGSIAPGYVT
ILVD_TROWT       VSREVITDSVETVLMAEALDGVVLLAGCDKSLPGMLMAAARLDVSAVFLYAGSIAPGYVT
ILVD2_COREF      VSREVITDSVETVMSAERLDGSVLLAGCDKSIPGMLMAAARLNLSSVFLYNGSTMPGTAK
                   *: :    *        *. .    ***  *.   .  .   .      *        

ILVD_CALS8       N---KVCD-----------LNSVFEAVGAYSAGKITDEELFALEENACPGCGSCSGMFTA
ILVD_HUNT2       D---KNLD-----------LNSVFEAVGAYKAGKMTEKEVWEYEEKACPGCGSCSGMFTA
ILVD_CALS4       G---TTCD-----------LSTVFEAVGALKAGKITEEEFYSIERNACPTCGSCSGMFTA
ILVD_CLOB8       G---CKTS-----------LSSMFEAVGAYNAGKITAEKLDEYENNVCPTCGSCSGMYTA
ILVD_CLOK5       G---CKVS-----------FSSISEAVGAFNGGKITEEKLEEFESKVCPTCGSCSGMYTA
ILVD_LACP7       G---EKRS-----------LSSMFEAVGAHAAGKMTEEEVEEFENKVCPTCGSCSGMYTA
ILVD_CLOAB       G---RVTD-----------LNSVFEAVGAVSAGKMSLEELAELENTACPTCGSCSGMFTA
ILVD_CARHZ       G---KSVS-----------LSNVFEGVGAVAAGLMSEEELLEYENYACPGCGSCAGMFTA
ILVD_MOOTA       G---RDVS-----------LSTMFEAVGAVQAGKMTEQELAALEDCACPGCGSCAGMFTA
ILVD_SYNFM       H---KQVD-----------LVSVFEAVGSFKAGTITMEELEQLEDYACPGCGSCAGMFTA
ILVD_SYNAS       G---KSVD-----------LISVFEGVGAVKAGKMTEEQLKALEDCACPGCGSCSGMYTA
ILVD_DESVH       A---GRAD-----------LITVFEGVGRVQRGDMTEAELDELVEGACPGCGSCAGMFTA
ILVD_DESVV       A---GRAD-----------LITVFEGVGRVQRGDMTEAELDELVEGACPGCGSCAGMFTA
ILVD_DESAG       G---KAAD-----------LITVFEGVGMVRQGRMTEDELEQLSETACPGCGSCAGMFTA
ILVD_THEMA       G---RDID-----------LITVFEAVGGYKVGKVDEETLKAIEDLACPGAGSCAGLFTA
ILVD_THEP1       G---RDID-----------LITVFEAVGGYKVGKVDEETLKAIEDLACPGAGSCAGLFTA
ILVD_PYRAB       G---EYVD-----------VKTVFEAVGAVKAGKMSEKELKLLEDFACPGCGSCAGMFTA
ILVD_PYRFU       G---EYVD-----------VKTVFEAVGAVKAGKMSYEELKLLENFACPGCGSCAGMFTA
ILVD_CLONN       G---KKIDL----------VHGAFEAVGSYAEGILSDDDLNKIEQHSCPTCGSCAGLFTA
ILVD_IGNH4       K---ERID-----------FKDLMERMNVLIK-EGRTEELRKLEESALPGPGSCAGLFTA
ILVD_GEOMG       EG--RRFSF----------VTDTFEAMARYKAGVIDAKELQVCEDNACPGMGSCQGLFTA
ILVD_GEOSL       EG--RRYSF----------VTDTFEAMARYKAGVIDERELGVCEDNACPGMGSCQGLFTA
ILVD_GEOUR       AG--RKYSF----------VTDTFEAMARYKAGVIDEKELKVCEDNACPGMGSCQGLFTA
ILVD_PELPD       EG--RKFSF----------VTDTFEAMARYKAGVISERELMVCEENACPGIGSCQGLFTA
ILVD_PELCD       GG--RRYSF----------VTDTFEAMARYKAGEINAAELQQCEDRACPGAGSCQGLFTA
ILVD_METMJ       G----RELS----------LIDVFEGVGRVAAGTMSEEELGELECAAMPGCGSCQGLYTA
ILVD_METB6       G----KDLS----------LIDVFEGVGKVAAGTMEEDALKELECCAMPGCGSCQGLYTA
ILVD_METHJ       G----CELS----------LTDVFEGVGKVAGGTMTEEELTELETAAMPGCGSCQGLYTA
ILVD_ARCFU       G----EKVS----------IKDAFEAAGMYKAGKLDDAGLKLYEDYCAPYCGSCQGLYTA
ILVD_METTH       G----RKVD----------LINVYEGVGTVSAGEMSEDELEELERCACPGPRSCAGLFTA
ILVD_METST       G----ETVD----------FINVTEAVGATQSGKMSEEDLYELERCACPGAGSCAGLFTA
ILVD_METS3       G----KNAD----------LITVFEAVGQESAGKISEEEVYEIEKCACPGAGSCSGLFTA
ILVD_METJA       G----KKYD----------LISVFEGVGACAAGKITEEELKEIEDIACPGAGSCAGLFTA
ILVD_META3       G----KKYD----------LISVFEGVGEYNVGKITKEELMEIETCACPGAGSCAGLFTA
ILVD_METM5       G----KKCE----------LISLFEGVGEYQVGKITEEELKSIEECACPGAGSCAGLYTA
ILVD_METM7       G----KKCE----------LISLFEGVGEYQVGKITEEELKSIEECACPGAGSCAGLYTA
ILVD_METMP       G----KKYE----------LISLFEGVGEYQVGKITEEELKCIEDCACSGAGSCAGLYTA
ILVD_METVS       G----KKYE----------LISLFEGVGQYQVGKISEEELKCIEDCACSGAGSCAGLYTA
ILVD1_METAC      D----KYTD----------LISVFEGVGAYSAGKLSEAELKRLENLSCAGAGSCAGMFTA
ILVD_METMA       D----KYTD----------LISVFEGVGAFRAGKLSEAELERLENLSCAGAGSCAGMFTA
ILVD2_METAC      D----NYRD----------LISVSEGVGAYSAGKISETEFKRLENLSCAGAGSCAGMFTA
ILVD_METBF       D----KYTD----------LISVFEGVGAYSTGKLSERDLKRLENLSCGGAGSCAGMFTA
ILVD_METBU       D----KYTD----------LVSVFEGVGSCQSGAVSSEKLKQLEDLCCCGAGSCAGMFTA
ILVD_METTP       D----RELD----------LINVFE---EWQKGGES---LSILEDLACPGAGSCAGLFTA
ILVD_METKA       G----ERVD----------LIDAFEAVGAYEEGEISEEELEELEQRACPGPGSCAGMFTA
ILVD_DEHMB       KNDQVSCVD----------LNSVFEAVGQVAKGQMTEEELLELEKVACPGCGSCAGMFTA
ILVD_DEHMC       KNDQVSCVD----------LNSVFEAVGQVAKGQMTEEELLELEKVACPGCGSCAGMFTA
ILVD_DEHM1       KNDQVSCVD----------LNSVFEAVGQVAKGQMTEEELLELEKVACPGCGSCAGMFTA
ILVD_ANADE       DGTPID-------------LNTAFEAVGKRAQGQITDAELYEIECQACPSGGSCSGMFTA
ILVD_ANADF       DGTAID-------------LTTAFEAVGKRALGQMSDAELYEIECKACPSGGSCSGMFTA
ILVD_ARCB4       DGTPID-------------LATAFEAVGKFEAGDISEEQLKDIECNACPSGGSCSGMFTA
ILVD_SULNB       DGTPID-------------LATVFEGVGEYEAGEITEETLAEMECNACPSGGSCSGMFTA
ILVD_NITSB       DGTPID-------------LATAFEAVGKVAKGEMSEEELYQIECEACPSGGSCSGMFTA
ILVD_SULDN       DGTPID-------------LATAFEAVGEHAEGKITDEELYDIECNACPSGGSCSGMFTA
ILVD_HELHP       DGTILD-------------LNSAFEAVGAFAEGKISEKRLHEIECNACPGGGSCSGMFTA
ILVD_WOLSU       DGTKVD-------------LASAFEAVGKRARNQISDEELREIECAACPGGGSCSGMFTA
ILVD_CAMFF       KGEALD-------------LNSAFEAVGAYETKQIDEKELKFIECNACPSGGSCSGMFTA
ILVD_CAMHC       NGEALD-------------LNSTFEAVGAYEVKKINKKELHDIECAACPGAGSCSGMFTA
ILVD_CAMC5       SGQPID-------------LATAFEAVGKFETKEISEEELKEIECNACPSGGSCSGMFTA
ILVD_CAMJE       KGEKIS-------------LSSVFEAVGAYESKKISEEEFKDIECSACPSGGSCSGMFTA
ILVD_CAMJR       KGEKIS-------------LSSVFEAVGAYEAKKISEEEFKDIECSACPSGGSCSGMFTA
ILVD_CAMJD       KGEKIS-------------LSSVFEAVGAYEAKKISEEEFKDIECSACPSGGSCSGMFTA
ILVD_CAMJJ       KGEKIS-------------LSSVFEAVGAYEAKKISEEEFKDIECSACPSGGSCSGMFTA
ILVD_CAMJ8       KGEKIS-------------LSSVFEAVGAYEAKKISEEEFKDIECSACPSGGSCSGMFTA
ILVD_AQUAE       -GQKVD-------------LISVFEGIGKVKRGEISEQELKVIEASACPTCGSCSGMFTA
ILVD_BACVZ       DGRKIS-------------LSSVFEGVGAYQAGKIGESDLQELEQFGCPTCGSCSGMFTA
ILVD_BACSU       DGRKIS-------------LSSVFEGVGAYQAGKINENELQELEQFGCPTCGSCSGMFTA
ILVD_BACP2       DGRKIS-------------LSSVFEGVGAYQSGKINEEELNELEQFGCPTCGSCSGMFTA
ILVD_BACLD       DGRKIS-------------LSSVFEGVGAYQSGKIDEKGLEELEQFGCPTCGSCSGMFTA
ILVD_GEOKA       DGRKIS-------------LSSVFEGVGAYLGGTLDEKGLEELERYGCPTCGSCSGMFTA
ILVD_BACAH       KGDVVD-------------LSSVFEGVGAYQSGKISEEELKDIEDHGCPSCGSCSGMFTA
ILVD_BACHK       KGDVVD-------------LSSVFEGVGAYQSGKISEEELKDIEDHGCPSCGSCSGMFTA
ILVD_BACAN       KGDVVD-------------LSSVFEGVGAYQSGKISEEELKDIEDHGCPSCGSCSGMFTA
ILVD_BACC1       KGEVVD-------------LSSVFEGVGAYQSGKISEEELKDIEDHGCPSCGSCSGMFTA
ILVD_BACCZ       KGEVVD-------------LSSVFEGVGAYQSGKISEEELKDIEDHGCPSCGSCSGMFTA
ILVD_BACCR       KGEVVD-------------LSSVFEGVGAYQSGKISEEELKDIEDHGCPSCGSCSGMFTA
ILVD_BACCN       KGEVVD-------------LSSVFEGVGAYQSGKISEEELKDIEDHGCPSCGSCSGMFTA
ILVD_BACSK       EGKSLS-------------LVSVFEGVGAFSSGKMTREELLEIEQLACPTCGSCSGMFTA
ILVD_BACHD       DGKNLS-------------LASVFEGVGAFSSGKMTREELLEIEQTACPTCGSCSGMFTA
ILVD_LISMO       HGKALT-------------LSSVFEAVGAFKDGSMSQEDFLDMEANACPTCGSCAGMFTA
ILVD_LISMF       HGKALT-------------LSSVFEAVGAFKDGSMSQEDFLDMEANACPTCGSCAGMFTA
ILVD_LISW6       HGKALT-------------LSSVFEAVGAFKDGSMSQEDFLDMEANACPTCGSCAGMFTA
ILVD_LISIN       HGKALT-------------LSSVFEAVGAFKEGSMSQEDFLDMEANACPTCGSCAGMFTA
ILVD_STAAC       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAE       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAA2       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAA9       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAS       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAA1       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAM       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAW       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAN       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAA8       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAT       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAA3       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAB       HGKALT-------------LSSMFEAVGAFKKGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAAR       HGKALT-------------LSSMFEAVGAFKEGSISKEEFLDMEQNACPTCGSCAGMFTA
ILVD_STAES       QGKALT-------------LSSMFEAVGAFKEGTISKEAFLDMEQNACPTCGSCAGMFTA
ILVD_STAEQ       QGKALT-------------LSSMFEAVGAFKEGTISKEAFLDMEQNACPTCGSCAGMFTA
ILVD_STAHJ       QGKALT-------------LSSMFEAVGAFKEGKLSKEAFLDMEQNACPTCGSCAGMFTA
ILVD1_STAS1      EGKALT-------------LSSMFEAVGAFKDGSISKDEFLDMEQNACPTCGSCSGMFTA
ILVD_LEUMM       QGKATT-------------LSSMFEAVGAFKSGLMTEEEFLEMEQNACPTCGSCAGMFTA
ILVD_SYMTH       DGRRAD-------------LITIFEGVGAHSRGMISDEELKELEDLACPSCGSCSGMFTA
ILVD_CHLCH       EGKTVD-------------LISVFEAVGQCSNGSITEGELQNIEEHACPGCGSCSGMFTA
ILVD_CHLPD       DGKTVD-------------LISVFEAVGRHSTAEITDGELQTIEENACPGCGSCSGMFTA
ILVD_PELLD       SGKTVD-------------LISVFEAVGQRSTGEISEEELETIEENACPGCGSCSGMFTA
ILVD_CHLPM       SGKTVD-------------LISVFEAVGQHSTGEISEQELESIEENACPGCGSCSGMFTA
ILVD_CHLTE       SGKTVD-------------LISVFEAVGKCSTGEITEDELQTVEECGCPGCGSCSGMFTA
ILVD_BIFAA       LPDGTVKK-----------NTDLIDVMYASADDNLNEEDLLAYEKTVCPTCGSCAGMFTA
ILVD_BIFLO       LADGTVK------------STDLIDVMYATADDNVSDEELLNYEKTVCPTCGSCAGMFTA
ILVD_CORGL       VVDGVA-----------HAPTDLITAISASASDAVDDAGLAAVEASACPTCGSCSGMFTA
ILVD_CORGB       VVDGVA-----------HAPTDLITAISASASDAVDDAGLAAVEASACPTCGSCSGMFTA
ILVD1_COREF      VVDGVA-----------HAPTDLITAISASANDGVDDAGLLAVEQSACPTCGSCSGMFTA
ILVD_CORDI       VADGIA-----------HAPTDLITAITASAKDSVNDDQLLSIEQSACPTCGSCSGMFTA
ILVD_CORJK       AVDGVV-----------QAPTDLITAISASASDKVDAQALLEVESAACPTCGSCSGMFTA
ILVD3_NOCFA      VVGGVA-----------QAPTDLITAISASANSSVTDEGLSEVERSACPTCGSCSGMFTA
ILVD_FRACC       ISGGTA-----------RSRLDLITAMSAAVNPDVSDGDLSTIERSACPTCGSCSGMFTA
ILVD_SALAI       AIEGIV-----------HSKIDLIDAMIAASNEAVTDDQLDQIERSACPTCGSCSGMFTA
ILVD_STRAW       LVDGT------------VRTLDLVDAISDAVNDKISDEDILRIEENACPTCGSCSGMFTA
ILVD_STRCO       LVDGT------------VRTLDLVDAMSEAVNDKISDADILRIEENACPTCGSCSGMFTA
ILVD2_NOCFA      LADGT------------VRRLDLITAMSEAVNDATSDADLATIEENACPTCGSCAGMFTA
ILVD_THEFY       VVNGTATT---------VRKLDLINPMIASADENVSEQELNALEEAACPTCGSCSGMFTA
ILVD_BACFR       GQH-----------------LDLIDAMIKSADESVSDEEVSKIENRACPTCGCCSGMFTA
ILVD_BACFN       GQH-----------------LDLIDAMIKSADESVSDEEVSKIENRACPTCGCCSGMFTA
ILVD_BACTN       GQH-----------------LDLIDAMIKSADDSVSDQEVANIEQNACPTCGCCSGMFTA
ILVD_PARD8       GRH-----------------LDLIDAMIESADTSVSDERIEQVERHACPGCGCCSGMFTA
ILVD_BLOFL       LSRYNNSSD---------VKLSLVDAITASANPNITDIDKEQIELEACPTCGSCSGMFTA
ILVD_BLOPB       LSNQN-------------VKLNLIDAITCSVDPNISDVDQQRIESAACPTCGSCSGMFTA
ILVD_BUCAI       KNNKT-------------IKIDLVDAIINGGKSHISDDFIKDIEASACPTCGSCSGMFTA
ILVD_BUCDN       KNEKE-------------IKIDLVDAIMIGGQSNQCKNFIKEVELLACPTCGSCSGMFTA
ILVD_BUCAP       TKDKT-------------KKIDLVDAIIHGGDSNKSDDFIREIELSACPTCGSCSGMFTA
ILVD_BUCMH       INEKE-------------IKIDLIDAIKYSADPNSADDLVNQIEDSSCPTCGSCSGLFTA
ILVD_BUCSC       VDGKE-------------IKINLVDAIVYGANPNYSDALASRIENCACPTCGSCSGLFTA
ILVD_BUCBP       ISDKE-------------IKLNLVDAITCGVNPDSSDDMINEIEKSACPTCGSCSGMFTA
ILVD_BUCCC       VNEKI-------------IKIDLVDAMMHGANKNTSNKKLLNIEKSACPTCGSCSGMFTA
ILVD_ACTP2       LSDQLI-------------KLDLVDAMMKSADKTVCDDDVDAIEKSACPTCGSCSGMFTA
ILVD_MANSM       LSDQLI-------------KLDLIDAMIQSADKNVSDSDVDAIERSACPTCGSCSGMFTA
ILVD_HAES1       LSDQII-------------KLDLVDAMIQGANPNVSDDVSEQIERSACPTCGSCSGMFTA
ILVD_HISS2       LSDQII-------------KLDLVDAMIQGANPNVSDDVSEQIERSACPTCGSCSGMFTA
ILVD_PASMU       LSDKII-------------KLDLVDAMIQGANPNVSDEDSAQIERSACPTCGSCSGMFTA
ILVD_HAEI8       LSDQLI-------------RLDLVDAMIEAADPNVSDERIDAIERSACPTCGSCSGMFTA
ILVD_HAEIG       LSDQLI-------------RLDLVDAMIEAADPNVSDERIDAIERSACPTCGSCSGMFTA
ILVD_HAEIN       LSDQLI-------------RLDLVDAMIEAADPNVSDERIDAIERSACPTCGSCSGMFTA
ILVD_HAEIE       LSDQLI-------------RLDLVDAMIEAADPNVSDERIDAIERSACPTCGSCSGMFTA
ILVD_ACTSZ       LSDKLI-------------KLDLIDAMIQSADANVSDADVDVIEKSACPTCGACSGMFTA
ILVD_AERHH       LSDQII-------------KLDLVDAMIQGADPKVSDAQSEQVERSACPTCGSCSGMFTA
ILVD_AERS4       LSDQII-------------KLDLVDAMIQGADPKVSDAQSEQVERSACPTCGSCSGMFTA
ILVD_VIBCH       LSDQII-------------KLDLVDAMMQGADPKVSDAQSEQIERSACPTCGSCSGMFTA
ILVD_VIBC3       LSDQII-------------KLDLVDAMMQGADPKVSDAQSEQIERSACPTCGSCSGMFTA
ILVD_VIBVU       LSDQII-------------KLDLVDAMIQGADPKVSDEQSEQIERSACPTCGSCSGMFTA
ILVD_VIBVY       LSDQII-------------KLDLVDAMIQGADPKVSDEQSEQIERSACPTCGSCSGMFTA
ILVD_VIBPA       LSDQII-------------KLDLVDAMIQGADPKVSDEQSEQIERSACPTCGSCSGMFTA
ILVD_ALIF1       LSDQII-------------KLDLVDAMIQGADPTVSDAQSEQIERSACPTCGSCSGMFTA
ILVD_PHOPR       LSDQIL-------------KLDLVDAMIQGADPTVSDEQSEQIERSACPTCGSCSGMFTA
ILVD_ECOLC       LSDRII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECOHS       LSDRII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECO24       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_SHIF8       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_SHISS       LSEQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_SHIFL       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECOLI       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_SHIBS       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECO57       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_SHIDS       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECOUT       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECOK1       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECOL5       LSDQII-------------KLDLVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTA
ILVD_ECOL6       LSDQII-------------KLDLVDAMIQGADPKVSDSQSAQVERSACPTCGSCSGMFTA
ILVD_SALPB       LSDKII-------------KLDLVDAMIQGADPKVSDDQSNQVERSACPTCGSCSGMFTA
ILVD_SALTY       LSDKII-------------KLDLVDAMIQGADPKVSDDQSNQVERSACPTCGSCSGMFTA
ILVD_SALCH       LSDQII-------------KLDLVDAMIQGADPKVSDDQSNQVERSACPTCGSCSGMFTA
ILVD_SALPA       LSDQII-------------KLDLVDAMIQGADPKVSDDQSNQVERSACPTCGSCSGMFTA
ILVD_SALTI       LSDQII-------------KLDLVDAMIQGADPKVSDDQSNQVERSACPTCGSCSGMFTA
ILVD_KLEP7       LSDKII-------------KLDLVDAMIQGADPKVSDEQSNQVERSACPTCGSCSGMFTA
ILVD_ENT38       LSDQII-------------KLDLVDAMIQGADPKVSDAQSDQVERSACPTCGSCSGMFTA
ILVD_YERPE       LSDKII-------------KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTA
ILVD_YERPA       LSDKII-------------KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTA
ILVD_YERPN       LSDKII-------------KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTA
ILVD_YERPP       LSDKII-------------KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTA
ILVD_YERP3       LSDKII-------------KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTA
ILVD_YERPS       LSDKII-------------KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTA
ILVD_YERE8       LSDKII-------------KLDLVDAMIQGANPNVSDADSEQIERSACPTCGSCSGMFTA
ILVD_PECAS       LSNQII-------------KLDLIDAMIQGANPNVSDADSEQIERSACPTCGSCSGMFTA
ILVD_SODGM       LLDKII-------------KLDLIDAMIQGANPDVSDEDSNQIERSACPTCGSCSGMFTA
ILVD_PHOLL       LSDQII-------------KLDLIDAMIQGANPKVSDEDSNQIERSACPTCGSCSGMFTA
ILVD_COLP3       LSDQII-------------KLDLVDAMIKGADPTVSDEDSDKIERSACPTCGSCSGMFTA
ILVD_PSYIN       LSDQII-------------KLDLVDAMVMGPDKNVSDEDLAKVERSACPTCGSCSGMFTA
ILVD_SHEB5       LSDKLI-------------KLDLVDAMVAGADSNVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHEB9       LSDKLI-------------KLDLVDAMVAGADSNVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHEB8       LSDKLI-------------KLDLVDAMVAGADSNVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHEPC       LSDKLI-------------KLDLVDAMVAGADSNVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHESW       LSDKLI-------------KLDLVDAMVAGADSNVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHESM       LSDKLI-------------KLDLVDAMVAAADSSVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHESR       LSDKLI-------------KLDLVDAMVAAADSSVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHESA       LSDKLI-------------KLDLVDAMVAAADSSVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHEON       LSDKLI-------------KLDLVDAMVAAADSSVSDEDSAKIERSACPTCGSCSGMFTA
ILVD_SHEDO       LSDKII-------------KLDLVDAMVAAADSSVSEEDSAKIERSACPTCGSCSGMFTA
ILVD_SHEFN       LSDQII-------------KLDLVDAMIAGADSNVSDEDSKQIERSACPTCGSCSGMFTA
ILVD_SHELP       LSDKLI-------------KLDLVDAMVAAADDRVSDEDSEKIERSACPTCGSCSGMFTA
ILVD_SHEAM       LSDKLI-------------KLDLVDAMVAAADDRISDADSEKIERSACPTCGSCSGMFTA
ILVD_SHEHH       LSDQLI-------------KLDLVDAMVAGADSRVSDADSEQIERSACPTCGSCSGMFTA
ILVD_SHEPA       LSDKLI-------------KLDLVDAMVAGADERVSDADSEQIERSACPTCGSCSGMFTA
ILVD_SHESH       LSDKII-------------KLDLVDAMVAGADDRVSDEDSEQIERSACPTCGSCSGMFTA
ILVD_PSEA6       LSDQII-------------KLDLVDAMVAGVDNNVNDEQSGEIERSACPTCGSCSGMFTA
ILVD1_PSEHT      LANIDI-------------KLDLVDAMVKGADESVSDADSDQVERSACPTCGSCSGMFTA
ILVD1_BURL3      LANPVTKAIEV-------KKLDLVDAMVIAVDPSYSDAEVAEVERSACPTCGSCSGMFTA
ILVD_BURVG       LANPVTKTIEL-------KKLDLVDAMVIAADQSYSDADVAEVERSACPTCGSCSGMFTA
ILVD2_CUPPJ      LANPVTKAVEF-------KKLDLVDAMVIAADPAYSDADVAEVERSACPTCGSCSGMFTA
ILVD_ACIAC       LANPVTKTIEF-------KKLDLVDAMVIAADDKYSDADVAEVERSACPTCGSCSGMFTA
ILVD_MARMS       LSE---------------NKLDLVDAMVIAADPTATDERVAEYERSACPTCGSCSGMFTA
ILVD_SACD2       LAE---------------HGLDLVDAMVIAADSSASDEYVAEIERSACPTCGSCSGMFTA
ILVD_PSEAE       LAS---------------HGLDLVDAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEAB       LAS---------------HGLDLVDAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEA7       LAS---------------HGLDLVDAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEMY       LAN---------------HGLDLVDAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEU5       LAN---------------HGLDLVDAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEP1       LAS---------------HGLDLVDAMVIAADSTASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEPK       LAS---------------HGLDLVDAMVIAADSTASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEPG       LAS---------------HGLDLVDAMVIAADSSASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEE4       LAS---------------HGLDLVDAMVIAADSSASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEPF       LAS---------------HGLDLVDAMVIAADSSASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEF5       LAS---------------HGLDLVDAMVIAADSSASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSE14       LAS---------------HGLDLVDAMVIAADSTASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSEU2       LAS---------------HGLDLVDAMVIAADSTASDEKVAEYERSACPTCGSCSGMFTA
ILVD_PSESM       LAS---------------HGLDLVDAMVIAADSTASDEKVAEYERSACPTCGSCSGMFTA
ILVD_XANAC       LAE---------------HKLDLIDAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTA
ILVD_XANC5       LAE---------------HKLDLIDAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTA
ILVD_XANOR       LAE---------------HKLDLIDAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTA
ILVD_XANOM       LAE---------------HKLDLIDAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTA
ILVD_XANCP       LAD---------------HNLDLIDAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTA
ILVD_XANC8       LAD---------------HNLDLIDAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTA
ILVD_XYLFA       LTD---------------HKLDLVDAMVLAADPHASDEEVAAVERSACPTCGSCSGMFTA
ILVD_XYLFT       LAD---------------HKLDLVDAMVLAADPHASDEEVATVERSACPTCGSCSGMFTA
ILVD_HAHCH       LSE---------------HKLDLVDAMVIAADSSASDELTEEYERSACPTCGSCSGMFTA
ILVD_RHORT       LGGTER-------------SVDLIDAMVVAGDAKVSDADVETIERSACPTCGSCSGMFTA
ILVD_HYDCU       LGGMEI-------------KLDLVDAMVMAADDHCSDSDINDVEVSACPTCGSCSGMFTA
ILVD_CAUVC       VKGKIR-------------ALDLVDAMVVAADDSYSDEEVEAIEKAACPTCGSCSGMFTA
ILVD_GRABC       VKGATR-------------ALDLVDAMVVAADESYTDEEVQAVERSACPTCGSCSGMFTA
ILVD_ZYMMO       VKGVKR-------------ALDLIDAMVIAADDHYSDGEVEVIEQTACATCGSCSGMFTA
ILVD_GLUOX       GPGVTR-------------KLDLIDSMVAAANPDVSDSESEQIERSACPTCGSCSGMFTA
ILVD_AZOSB       --WEAKII-----------PLDLVDAMVKAADKNCSDEEVDAIERSACPTCGSCSGMFTA
ILVD2_AROAE      --WEAKVI-----------SLDLVDAMVKAADSSCSDAEVDAIERSACPTCGSCSGMFTA
ILVD_DECAR       --IQGQVI-----------HLDLIDAMVKAADHSVSQAELDDVERSACPTCGSCSGMFTA
ILVD1_BORBR      SPVDGKVIA----------KLDLVDAMIKAADPNVSDAEAEEVERSACPTCGSCSGMFTA
ILVD1_BORPA      SPVDGKVIA----------KLDLVDAMIKAADPNVSDAEAEEVERSACPTCGSCSGMFTA
ILVD1_BORPE      SPVDGKVIA----------KLDLVDAMIKAADPNVSDAEAEEVERSACPTCGSCSGMFTA
ILVD_BORA1       SPTDGKVI-----------KLDLVDAMIKAADPNVSDAEAEQVERSACPTCGSCSGMFTA
ILVD_NEIMA       GVANIQPE----------RRLDLIDAMIESADDNISNRQVEEVEQNACPTCGSCSGMFTA
ILVD_NEIMF       GVANIQPE----------RRLDLIDAMIESADDNVSNRQVEEVEQNACPTCGSCSGMFTA
ILVD_NEIMB       GVANIQPE----------RRLDLIDAMIESADDNVSNRQVEEVEQNACPTCGSCSGMFTA
ILVD_NEIG1       GVANIQPE----------RRLDLIDAMIESADDNVSNRQVEEVEQNACPTCGSCSGMFTA
ILVD_PSYA2       ASTVGKSHNNEDSSGGAIRKLDLVDAMMDAADDSISDEDVAAIEASACPTCGSCSGMFTA
ILVD_CHRVO       WGNE-------------VRKLDLVDAMVEAANSAVSDADVDRVERSACPTCGSCSGMFTA
ILVD_METFK       WQGN-------------MHKLDLVDAMVAAADSNVSDAESEAIERSACPTCGSCSGMFTA
ILVD_SYNP6       LNGEER-------------HLDLVDAMVVAADDRESDEDVATIERSACPTCGSCSGMFTA
ILVD_SYNE7       LNGEER-------------HLDLVDAMVVAADDRESDEDVATIERSACPTCGSCSGMFTA
ILVD_NITOC       IRGKSV-------------SLDLVDAIVAAVDPAESDADVMAYERSACPTCGSCSGMFTA
ILVD_NOVAD       LKGKE-------------HALDLVDAMVAAADESFTDEEVTAIERSACPTCGSCSGMFTA
ILVD_SPHAL       LKGKE-------------VALDLVDAMVAAADEKYSDEEVLAIEQAACPTCGSCSGMFTA
ILVD1_ACIAD      FRGNE-------------KAIDLVDAMVVAADDSYTDEEVQAFERSACPTCGSCSGMFTA
ILVD_DEIRA       LGDGE-------------HALDLVDAMVMAADDSVSEEDIELVERSACPTCGSCSGMFTA
ILVD_RHIEC       LHGKQ-------------HALDLVDAMVAAADDKISDEDVKVIERSACPTCGSCSGMFTA
ILVD_RHIL3       MHGKT-------------HALDLVDAMVAAADDKISDEDVQTIERSACPTCGSCSGMFTA
ILVD_RHIME       LHGKT-------------HALDLVDAMVAAADDKVSDEDVQIIERSACPTCGSCSGMFTA
ILVD_SINMW       LHGKT-------------HALDLVDAMVAAADDKVSDEDVQIIERSACPTCGSCSGMFTA
ILVD_AGRFC       LHGKT-------------VALDLVDAMVAAADDKISDEDVKIIERSACPTCGSCSGMFTA
ILVD1_RHILO      LAGKT-------------QALDLVDAMVAAADDKISDEDVKVIERSACPTCGSCSGMFTA
ILVD_BRUAB       WEDSV-------------KKLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTA
ILVD_BRUA2       WEDSV-------------KKLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTA
ILVD_BRUO2       WEDSV-------------KKLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTA
ILVD_BRUC2       WEDSV-------------KKLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTA
ILVD_BRUSU       WEDSV-------------KKLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTA
ILVD_BRUME       WEDSV-------------KKLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTA
ILVD_BRUSI       WEDSV-------------KKLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTA
ILVD_OCHA4       WDDQV-------------KKLDLVDAMVAAADDSYTDDQVKAIERSACPTCGSCSGMFTA
ILVD_RHOP5       LSTGA-------------RKVDLIDAMVSAADDSMSDADVAVMEENACPTCGSCSGMFTA
ILVD_NITHX       VNGKI-------------RSVDLIDAMVAAADDSVSDADVEAIERSACPTCGSCSGMFTA
ILVD_NITWN       LNGKV-------------KSVDLIDAMVAAADDSVSDADVEAIERSACPTCGSCSGMFTA
ILVD_AZOC5       LSTGE-------------KKVDLIDAMIAAADDRVSDEDVKVMERSACPTCGSCSGMFTA
ILVD_RHOPA       LKGKT-------------HAVDLIDAMVAAADSAMSDEDVQTMERSACPTCGSCSGMFTA
ILVD_RHOP2       LKGKT-------------HAVDLIDAMVAAADSSMSDEDVQTMERSACPTCGSCSGMFTA
ILVD1_BRADU      LQGKT-------------KAVDLIDAMVAAADSKVSDEDVKVIERSACPTCGSCSGMFTA
ILVD_BARHE       WKDQD-------------LTVDLVDAMVAAAAENNSEEEVAEMERAACPTCGSCSGMFTA
ILVD_BART1       WKDQD-------------LRVDLVDAMIAAASEHNSEEEVAEMERAACPTCGSCSGMFTA
ILVD_RHOS4       LGDGRT------------VKMDLIDAMVAAADEKVSDDDLTRIEQAACPTCGSCSGMFTA
ILVD_RHOS1       LGDGRT------------VKMDLIDAMVAAADEKVSDDDLTRIEQAACPTCGSCSGMFTA
ILVD_PARDP       LGDGRK------------VSLDLVDAMVAAADDKISDADLAAIEEAACPTCGSCSGMFTA
ILVD_RUEPO       IADLEM------------TKIDLVDAMVAAANDKFTDEQVQHIEENACPTCGSCSGMFTA
ILVD_RUEST       IDSLDA------------KKIDLVDAMVAAASDKLTDEEVQHIEENACPTCGSCSGMFTA
ILVD_HYPNA       I-DGEL------------RAVDLIDAMIEAANPDRTDAEVDEFEKNACPTCGSCSGMFTA
ILVD_MAGSA       YQGET-------------HAVDLIDAMIKGADQNVSDEEALAFEKESCPTCGSCSGMFTA
ILVD_ACICJ       ADGET-------------RAADLITAMVVAADPTKTDEQAAVMERSACPTCGSCSGMFTA
ILVD_MAGMM       LTDGTA------------RKVDLIDSMIAAGNSAVSSEDLERYERSSCPTCGSCSGMFTA
ILVD_NOSS1       --------------GKDLTVVSSFEAVGEYSAGKIDENELLAVERNACPGAGSCGGMYTA
ILVD_TRIEI       --------------GKDLTVVSAFEAVGEYSAGKIDETELTEVERRACPGAGSCGGMFTA
ILVD_ACAM1       --------------GEDLTVVSAFEAVGQHSAGRISEAELTAVEKHACPGAGSCGGMYTA
ILVD_MICAN       --------------DCDLTVVSSFEAVGQYSAGKISEEDLIGIERNACPGAGSCGGMFTA
ILVD_SYNY3       --------------GEDLTVVSAFEAVGQYSAGKIDEETLYGIERNACPGAGSCGGMFTA
ILVD_THEEB       --------------GQDLTVVSAFEAVGQFSAGKMDEATLHAIEHHACPGAGSCGGMFTA
ILVD_SYNJB       --------------GRDLTIVSAFEAVGEFSAGRISEEELLAVERHACPGAGSCGGMYTA
ILVD_SYNJA       --------------GRDLTIVSAFEAVGEYSAGRISEDELLAVERHACPGAGSCGGMYTA
ILVD_GLOVI       --------------DQDLTVVSAFEAVGQYSAGKIDQTTLVEIERRACPGAGSCGGMYTA
ILVD_NITEU       --------------GRDLTIVSAFEAVGQHTAHKIDDHELLEVERHACPGAGSCGGMYTA
ILVD_NITEC       --------------GRDLTIVSAFEAVGQHSAHKIDDQELLEVERHACPGAGSCGGMYTA
ILVD_NITMU       --------------GKDLTIVSAFEAVGQYTSHKIDAKELLEVERHACPGAGSCGGMFTA
ILVD_CHLAA       --------------GRDLTIVSAFEAVGEYSAGRIDEHELLEIERHACPGAGSCGGMYTA
ILVD_DEIGD       --------------GKDLTIVSVFEAVGAYGAGKMSREDFEQIEKRACPGNGSCGGMYTA
ILVD_HALHL       --------------GEDLTVVSAFEAVGQYNAGNLSEADLKGVEENACPGAGACGGMFTA
ILVD_PROMS       --------------GEDLTVVSAFEAVGQLTSGKINEERLIQVEKNCIPGAGSCGGMFTA
ILVD_PROM9       --------------GEDLTVVSAFEAVGQLTAGKINEERLIQVEKNCIPGAGSCGGMFTA
ILVD_PROM0       --------------GEDLTVVSAFEAVGQLTSGKITEERLIQVEKNCIPGAGSCGGMFTA
ILVD_PROM2       --------------GEDLTVVSAFEAVGQLTSGKINEKRLIEVEKNCIPGAGSCGGMFTA
ILVD_PROM5       --------------GEDLTVVSAFEAVGQLTSGKINEKRLNEVEKNCIPGAGSCGGMFTA
ILVD_PROMP       --------------GEDLTVVSAFEAVGQLTSGKINEKRLIEVEKNCIPGAGSCGGMFTA
ILVD_PROMA       --------------GEDLTVVSAFEAVGQLTSGKITKEKLIEVEKHCIPGAGSCGGMFTA
ILVD_PROM3       --------------DRDLTVVSAFEAVGQHASGKINEEQLTAIEKNACPGAGSCGGMFTA
ILVD_PROMM       --------------DRDLTVVSAFEAVGQHASGKINEEQLTAIEKNACPGAGSCGGMFTA
ILVD_SYNSC       --------------GCDLTVVSAFEAVGQLTSGKIDEVQLTAVEKNACPGAGSCGGMFTA
ILVD_SYNPX       --------------GCDLTVVSAFEAVGQLTSGNIDEDQLTAVEKNACPGAGSCGGMFTA
ILVD_SYNS9       --------------GCDLTVVSAFEAVGQITSGKIDEEQLTAVEKNACPGAGSCGGMFTA
ILVD_SYNR3       --------------GCDLTVVSAFEAVGQLSSGKIDEAQLTAVEKNACPGAGSCGGMFTA
ILVD_PROMT       --------------GCDLTVVSSFEAVGQLASGKIDKDRLIAVEKNAIPGPGSCGGMFTA
ILVD1_AROAE      --------------GRDLNIVSVFEAVGEFIAGQLDPVDFKEIEKRACPGSGSCGGMYTA
ILVD3_AROAE      --------------GRDLNIISVFEAVGEFTAGRLDPVDFKEIEKRACPGSGSCGGMYTA
ILVD3_BORBR      --------------GKDLTIVSVFEAVGEYTMGRMDETDFKAIEQCAIPGSGSCGGMYTA
ILVD2_BORPA      --------------GKDLTIVSVFEAVGEYTMGRMDETDFKAIEQCAIPGSGSCGGMYTA
ILVD2_BORPE      --------------GKDLTIVSVFEAVGEYTMGRMDETDFKAIEQCAIPGSGSYGGMYTA
ILVD_BURMA       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURM9       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURM7       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURMS       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURPS       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURP6       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURP1       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURP0       --------------GHDLTIVSSFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD_BURTA       --------------GKDLTIVSAFEAVGEFTAGRMSQEDFEGVEKNACPTTGSCGGMYTA
ILVD2_BURL3      --------------GRDLTIVSSFEAVGEFTAGRMSQEDFEGVERNACPTSGSCGGMYTA
ILVD1_CUPPJ      --------------GKDLTIVSSFEAVGEFTAGRMSEEDFEGVERNACPSTGSCGGMYTA
ILVD_RALSO       --------------GKDLTIVSSFEAVGEFTAGRMSEEDFEGVERNACPTSGSCGGMYTA
ILVD_HERAR       --------------GKDLTIVSAFEAVGEFTAGRMSQEDFDGIERNACPSSGSCGGMYTA
ILVD_JANMA       --------------GKDLTIVSAFEAVGEFTAGRMSQEDFDGIERNACPSAGSCGGMYTA
ILVD_POLNA       --------------GKDLNIVSVFEAVGENAAGRMSDEDLLQIERRAIPGTGSCGGMYTA
ILVD_POLSJ       --------------GKDLNIVSVFEAVGENAAGRMSDEDLLQIERRAIPGTGSCGGMYTA
ILVD_RHOFT       --------------GQDLNIVSVFEAVGENAAGRMSDEDLLEIERRAIPGPGSCGGMYTA
ILVD_VEREI       --------------GRELNIVSVFEAVGENAAGKLSDHDLREIEKRAIPGTGSCGGMYTA
ILVD_METPP       --------------GQDLNIVSVFEAVGQFTAGNMSEEDFCQIERRAIPGSGSCGGMYTA
ILVD_TREPR       --------------ARELTVVSSFEAVGAMGRQGMSIDAMREVERHACPTTGSCGGMYTA
ILVD_CHRSD       ----------------HTDLVSVFEAMGAYSQGNKSLIEVKQIEEVAIPGPGSCGGMYTA
ILVD2_PSEHT      ----------------HTDIVSVFEAVGSYAAGDIPITQLEHIEKTAIPGAGSCGGMYTA
ILVD2_ACIAD      ----------------HTDMISVFEAVGQYAKGEINAIQVKQIEEVALPGPGSCGGMYTA
ILVD_METCA       --------------GKKLDVVSVFEAVGARANHRIDDAELHAIESNAIPGPGSCGGMYTA
ILVD_RUTMC       ----------------HTDVVSVFEAVGQFANHTIDAIELENIEKIAIPGPGSCGGMYTA
ILVD_LACLS       --------------GEKLNIVSAFEALGQKITGNISEEDYHGVICNAIPGQGACGGMYTA
ILVD_LACLA       --------------GEKLNIVSAFESLGQKITGNISDEDYHGVICNAIPGQGACGGMYTA
ILVD_CYTH3       --------------GEKLNIVSAFEALGKKVAGTITEEDYQGVIKNACPGAGACGGMYTA
ILVD_FRATN       --------------GKPIDIVTAFQSYGACLSGQITEQERQETIKKACPGAGACGGMYTA
ILVD_FRATT       --------------GKPIDIVTAFQSYGACLSGQITEQERQETIKKACPGAGACGGMYTA
ILVD_FRAP2       --------------GKPIDIVTAFQSYGACLSGQISEQERQETIKKACPGAGACGGMYTA
ILVD_RHOBA       --------------DEKLDIVSAFQCYGQFIAGQISEEERSEIVRRSCPGAGACGGMYTA
ILVD_LEPBJ       --------------GQDVDIVSIFEAVGKFNAGKISREEFIRIEQNACPGAGSCGGMYTA
ILVD_LEPBL       --------------GQDVDIVSIFEAVGKFNAGKISREEFIRIEQNACPGAGSCGGMYTA
ILVD_LEPIN       --------------GQDVDIVSIFEAVGKFNAGKISREEFIRIEQNAIPGAGSCGGMYTA
ILVD_LEPIC       --------------GQDVDIVSIFEAVGKFNAGKISREEFIRIEQNAIPGAGSCGGMYTA
ILVD_STRPN       --------------GKDIDLVSVFEGIGKWNHGDMTAEDVKRLECNACPGPGGCGGMYTA
ILVD_STRR6       --------------GKDIDLVSVFEGIGKWNHGDMTAEDVKRLECNACPGPGGCGGMYTA
ILVD_STRP2       --------------GKDIDLVSVFEGIGKWNHGDMTAEDVKRLECNACPGPGGCGGMYTA
ILVD_STRT2       --------------GKDIDLVSVFEGIGKWNHGDMTAEEVKNLECNACPGPGGCGGMYTA
ILVD_STRT1       --------------GKDIDLVSVFEGIGKWNHGDMTAEEVKNLECNACPGPGGCGGMYTA
ILVD_STRSY       --------------GKDIDLVSVFEGIGKWNNGDLTAEEVRQIECNACPGPGGCGGMYTA
ILVD_STRS2       --------------GKDIDLVSVFEGIGKWNNGDLTAEEVRQIECNACPGPGGCGGMYTA
ILVD_STRSV       --------------GKDIDLVSVFEGIGKWNHGDLTAEEVRRIECNACPGPGGCGGMYTA
ILVD_STRMU       --------------GKDIDLVSVFEGVGHWNHGDMTKEEVKALECNACPGPGGCGGMYTA
ILVD_OCEIH       --------------GKDIDIVSVFEGVGQHNAGAIDDNQLRKVECNACPGAGACGGMYTA
ILVD2_STAS1      --------------GKDLDAVSAFEGVGQYNNGEIDKEALHKVECAACPGAGACGGMFTA
ILVD_ROSCS       --------------GKEITIQHVYEAIGAVAAGKMTDEELKEIEDAACPGPGACGGQYTA
ILVD_ROSS1       --------------GKEITIQHVYEAIGAVAAGKMTDEELKEIEDAACPGPGACGGQYTA
ILVD_KORVE       --------------AQKVTIQDVFEAVGTHARGKMSDADLEELEHNACPGAGACGGQFTA
ILVD_THET2       --------------GRKLTIVEVFEAVGQRAAGKISEEELLEIERRAIPGPGACGGQYTA
ILVD_THET8       --------------GRKLTIVEVFEAVGQRAAGKISEEELLEIERRAIPGPGACGGQYTA
ILVD_HALMA       --------------GREVTIQNVFEGVGAVADGEMSEGELDEMERHACPGAGSCGGMFTA
ILVD_NATPD       --------------GRDVTIVQVFEGVGAYAQGEMSGDELDDLERNACPGAGSCGGMFTA
ILVD2_BORBR      --------------SGQVTILDTIEAVGRVQHGTMPAAELKAMERTCTPSAGSCPGQFTA
ILVD3_BRADU      --------------GRTLTVLDSYEAVGSFMTGEIDSATLERIERACLPTIGACAGQFTA
ILVD2_BRADU      --------------GQQVTVQDMFEAVGKHSVGAMSDEDLDEIERVACPSAGACGAQFTA
ILVD2_RHILO      --------------GRQITVQDVFEAVGQHSVGTIGDAELLEIEQAACPSAGSCGAQFTA
ILVD_PARL1       --------------GKDVTVVDVFEAVGQHSAGNMEDEELHALECVACPSAGACGGQFTA
ILVD_PELUB       --------------GKDVTVVDVFEAVGKHSAGKMSAKELRKLELVACPSAGACGGQFTA
ILVD_DINSH       --------------GEDVTVQDVFEAVGKHQAGNYTDAELEVLERVACPSAGACGGQFTA
ILVD_PYRAR       --------------ERELTIEDAFESVGAYLAGKITLDELKRVEELSFPTYGTCQGMFTA
ILVD_PYRIL       --------------ERELTIEDTFETVGSYLAGKITLEELKRIEELSFPTYGTCQGLFTA
ILVD_PYRAE       --------------ERELTIEDTFEAVGAYLAGRITLEDLKRIEELSFPSYGTCQGLFTA
ILVD_PYRCJ       --------------ERELTVEDVFEAVGAYYAGRITLEELKRVEELSFPTYGTCQGMFTA
ILVD_AERPE       --------------GETVTVQSAFEAVGAYLKGLIDEERLYEIEKAAMPTPGTCQGLFTA
ILVD_METS5       --------------GRDIAIGDVYEAVGAFSAGKITAEDLRIMEDNAIPGPGACGGLYTA
ILVD_SULTO       --------------GKPITIQDVYEAVGAYSKGKITAEDLRLMEDNAIPGPGTCGGLYTA
ILVD_PICTO       --------------GKKIAVGDVYEAVGSYQAGRMTVEELKIMENSAVPTAGACGGLYTA
ILVD_SULAC       --------------GRRLTIEDVHEAIGAFIAGKIDEHELYEIEKRAHPTVGTCSGMFTA
ILVD_SACS2       --------------GKRLTIEDVHEAIGAYLAKRITENELYEIEKRAHPTLGTCSGLFTA
ILVD_MYCA1       LSDGS---------EREVTIIDAFEAVGACARGLMPREDVDAIERAICPGEGACGGMYTA
ILVD_MYCPA       LSDGS---------EREVTIIDAFEAVGACARGLMPREDVDAIERAICPGEGACGGMYTA
ILVD_MYCUA       LSDGS---------EREVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTA
ILVD_MYCBO       LSDGS---------ERDVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTA
ILVD_MYCTU       LSDGS---------ERDVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTA
ILVD_MYCLE       LSDGT---------EHEVTLIDAFEAVGACSRGLMPRADVDAIERAICPGEGACGGMYTA
ILVD_MYCSJ       LTDGS---------EREVTIIDAFEAVGACARGLMSREDVDIIERAICPGEGACGGMYTA
ILVD1_NOCFA      LSDGT---------EREVTIIDAFEAVGACARGLMSRADVDAIERAICPGEGACGGMYTA
ILVD_ACIC1       LGD------------RDINIVDAFEAVGGCLRGLVSREEVDAIERNFCPVEGACAGMFTA
ILVD_NOCSJ       GND--------------VTIIDAFEAVGACLAGKISRDEVDRIERAICPGEGACGGMYTA
ILVD_ARTS2       LEDGS---------EKEVTLIDAFEAVGACAAGKMSRGDLDRIERAICPGEGACGGMYTA
ILVD_RENSM       LEDGT---------EKDVTLIDAFEAVGACAAGKMSVGDLDRIERAICPGEGACGGMYTA
ILVD_CLAM3       LSDGT---------EKEVTIIDAFEAVGACKAGTMSQEDLTRIEKAICPGEGACGGMYTA
ILVD_CLAMS       LSDGT---------EKEVTIIDAFEAVGACKAGTMSQEDLTRIEKAICPGEGACGGMYTA
ILVD_LEIXX       LSDGT---------EKDVTIIDSFEAVGACKAGKMSEEDLKRIECAIAPGEGACGGMYTA
ILVD_TROW8       LKCGE---------SKEVTIIDSFEAVGAYKAGLIDQDDLGRIERAICPGEGACGGMYTA
ILVD_TROWT       LKCGE---------SKEVTIIDSFEAVGAYKAGLIDQDDLGRIERAICPGEGACGGMYTA
ILVD2_COREF      MSDGT---------EREVTLIDAFEAVGACRAGTMSREDVDAIERSVCPGEGACGGMYTA
                                                                        . :**

ILVD_CALS8       NTMNCLSEVLGMALPGNGTIPAVMAARIRLAKMAGMKIVELVERD-------IKPSDILT
ILVD_HUNT2       NSMNCLTEVLGMGLPGNGTVPAVYAERIRLAKKAGMKIVELVEKD-------IKPSDILT
ILVD_CALS4       NTMNCLTEALGLGLPGNGTIPAVYSERIRLAKEAGMKIVELVERN-------ITPSQILT
ILVD_CLOB8       NSMNCLTEVLGMGLQGNGTIPAVYSERIKLAKHAGMKIMELLEKN-------IRPRDIMT
ILVD_CLOK5       NSMNCLTEVLGMALGGNGTIPAVYSDRIKLAKHAGMKIMELLERN-------IRPRDVMT
ILVD_LACP7       NSMNCLTEALGMGLKGNGTIPAVYSERIRLAKHAGMKIMELLQNN-------IRPRDIMS
ILVD_CLOAB       NSMNCLSEVLGLALPYNGTIPAVFSERLRLAKKAGMKIVELVQKD-------IRPSDILT
ILVD_CARHZ       NSMNCLTEAIGMALPGNGTIPAVYAERLRLAKLSGEKVMELLSQN-------IRPRDIFT
ILVD_MOOTA       NTMNCMVEALGMGLPGNGTTPAVSGSRVRLAKEAGMQVMKLLQEN-------IRPLDIMT
ILVD_SYNFM       NSMNCLSEALGLALPGNGTIPAVTGARMRLAKLAGMRIVELIKAD-------IRPRQIAT
ILVD_SYNAS       NSMNCVTEALGLGLPGNGTIPAIHAARRRLAKEAGVRIMDLVSKN-------IRPRDIAT
ILVD_DESVH       NSMNCLAETIGLALPGNGTTPAVTAARIRLAKHAGMKVMEMLERN-------IRPRDIVT
ILVD_DESVV       NSMNCLAETIGLALPGNGTTPAVTAARIRLAKHAGMKVMEMLERN-------IRPRDIVT
ILVD_DESAG       NSMNCLSETIGLALPGNGTTPANSAARVRLAKHAGMRVMELLERD-------IKPRDIVT
ILVD_THEMA       NTMNSLAEALGIAPRGNGTVPAVHAKRLRMAKEAGMLVVELVKRD-------VKPRDIVT
ILVD_THEP1       NTMNSLAEALGIAPRGNGTVPAVHAKRLRMAKEAGMLVVELVKRD-------VKPRDIVT
ILVD_PYRAB       NTMNALTEALGISLPWNGTAPAVYAHRIRIAKQTGMQIMKLVEED-------LKPSDILT
ILVD_PYRFU       NTMNALTEALGISLPWNGTAPAPYAHRIRIAKETGMQIVKLVEKD-------VKARDILT
ILVD_CLONN       NSMNSLAEALGVALPGNGTIPAPYGRRKQLAKYAGVKIMELVKKK-------IKLRDILT
ILVD_IGNH4       NTMNMLSEAMGLMLPGASTVPAVEARRLWYAKLTGMRIVKMVEEG-------LTPDKILT
ILVD_GEOMG       NTMAILTETLGMSLPRCGTALAVSALKRRIAFASGEKIVDLVRNG-------VTPRQILT
ILVD_GEOSL       NTMAILTETMGMSLPRCGTALAVSALKRRIAFASGEKIVDLVRND-------ITPRQILT
ILVD_GEOUR       NTMAILTETLGMSLPRCGTALAVSALKRRIAFASGERIVDLVRNN-------VTPRSILT
ILVD_PELPD       NTMAILTETMGMSLPRCGTALAVSALKRRIAFASGEKIVELVQNN-------ITPRSILT
ILVD_PELCD       NTMAILTETLGMSLVGCGTALAVSSLKRQIAFASGERIVSLVREG-------ITPRQILT
ILVD_METMJ       NTMACVTEALGLSLPGCAAIPAVDAAKLRIARESGERVVGLVREG-------VRPRDLVT
ILVD_METB6       NTMACMTETMGMSLPGCAAVPAVEAAKLRIARESGEAIIPLVKKN-------STARDIVT
ILVD_METHJ       NTMACMTEALGMSLPGCAATPAVYADKIRLAYRTGKRIVDLVRKQ-------ILPRDIIT
ILVD_ARCFU       NSMQILTETLGLSLPYCSTSPCPSSRKLRIAKQSGKRVVELVMQN-------IKPLDFVN
ILVD_METTH       NTMACLTEALGMSLPGCATAHAVSSRKRQIARLSGKRIVEMVQEN-------LKPTMIMS
ILVD_METST       NTMACLTETMGMSLPGCATAHAVSDKKVEIARASAKKIFTLLEND-------IKPSDILT
ILVD_METS3       NTMACVTETLGLSLPFCATTHAADKANEKMAYNSGKQIIKLVEAD-------LKPSDILT
ILVD_METJA       NTMACLTEAMGLSLPYCATSHATTAEKIRIAKRSGMRIVDLVRNN-------ITPDKILT
ILVD_META3       NSMACLTETLGLSLPMCATTHATDAEKVRIAKRSGMKIVDLVKED-------IKPTDLLT
ILVD_METM5       NSMACLTEALGLSLPMCATIHAVDAQKVRIAKKTGSKIVDLVKED-------VKPTDILT
ILVD_METM7       NSMACLTEALGLSLPMCATIHAVDAQKVRIAKKTGSKIVDLVKED-------VKPTDILT
ILVD_METMP       NSMACLTEALGLSLPMCATTHAVDAQKVRLAKKSGSKIVDMVKED-------LKPTDILT
ILVD_METVS       NSMACLTEALGLSLPMCATTHAVDAQKVRIAKKSGSKIVDLVKQD-------IKPKDILT
ILVD1_METAC      NTMACMTEALGLSLPGCATAHAVDAKKVRIAKESGERIVALVKEN-------LTPRKIVT
ILVD_METMA       NTMACMTEALGLSLPGCATAHAVDAKKVRIAKESGERIVELVKQN-------ITPRKIVT
ILVD2_METAC      NTMACMTEALGLSLPGCATAHAVDAKKILIAKESGERIVELVKEN-------LTPRKIVT
ILVD_METBF       NTMACVTEALGLSLPGCATAHAVDAKKARIAKESGERIVEMVKEN-------LTPRKIVT
ILVD_METBU       NTMACMTEALGLSLPGCATAHAVDAKKMRMAKESGERIVEMVSEG-------LTARKIVT
ILVD_METTP       NSMACMAEALGLSLPGCATAHAVDAKKMRIAKLSGMMIVELVKRG-------LTARKIVS
ILVD_METKA       NTMACMTEVLGMSEFNCAATPATEAEKLRVAKLTGMRIVEAIEEG-------ITARDVLT
ILVD_DEHMB       NTMNCLTEALGMALPGNGTIPAVDSRRTQLAKSAGQQIMQLIKDN-------ICPKDIIT
ILVD_DEHMC       NTMNCLTEALGMALPGNGTIPAVDSRRTQLAKSAGQQIMQLIKDN-------ICPKDIIT
ILVD_DEHM1       NTMNCLTEALGMALPGNGTIPAVDSRRTQLAKDTGRQILKLIKDN-------TCPKDIIT
ILVD_ANADE       NSMNVLCEAMGVALPGNGTVLALTPEREALVRRAARRAVEIAADER------FRLRNLVN
ILVD_ANADF       NSMNVLCEAMGVALPGNGTALALTPEREALLRRAARRAVEIAGDER------FRLRRIVN
ILVD_ARCB4       NSMNTLMEAMGIALPGNGTILALTPQREVLYRQAARRICEIAKDKAS--REKYKLKNILN
ILVD_SULNB       NSMNTLMEAMGIALPGNGTILALTPERTELYKKAARRICEIAKSEAAE-REKFRMRNILN
ILVD_NITSB       NSMNTLMEAMGIALKGNGTILALTPEREELLRKAARRICEIAKDEKL--TQEYKIRNILN
ILVD_SULDN       NSMNTLCEAMGIALPGNGTVLAMTPRRIEMVKAAAKRIVEMAKADDS----KYNLKNVLN
ILVD_HELHP       NSMNTLCEAMGVALPGNGTILALSKEREELLRKAARRIVEIALDERK--TEQFRFRNILN
ILVD_WOLSU       NSMNTLCEAMGVALPGNGTIPALTKEREELIRKAARRIVEIALDER------YAFRNILN
ILVD_CAMFF       NSMNTLCEAMGVALEGNGTVLALTSEREELIRKAARRICEIALDER------YQIRNIIN
ILVD_CAMHC       NSMNTLCEAMGIALKGNGTILAMTKNRKKLAKKAARRICEIALDDK------FKIRNIIN
ILVD_CAMC5       NSMNTLCEAMGIALSGNGTILALTKEREELIRRAGRRICEIALDER------FKIRNILN
ILVD_CAMJE       NSMNTLCEAMGIALEGNGTILALSKEREELLRKAARRICEIALDER------FKIRNIIT
ILVD_CAMJR       NSMNTLCEAMGIALEGNGTILALSKEREELLRKAARRICEIALDER------FKIRNIIT
ILVD_CAMJD       NSMNTLCEAMGIALEGNGTILALSKEREELLRKAARRICEIALDER------FKIRNIIT
ILVD_CAMJJ       NSMNTLCEAMGIALEGNGTILALSKEREELLRKAARRICEIALDER------FKIRNIIT
ILVD_CAMJ8       NSMNTLCEAMGIALEGNGTILALSKEREELLRKAARRICEIALDER------FKIRNIIT
ILVD_AQUAE       NSMNCLTEVLGLALPGNGTILAIDPRREILARNAVKALFELLEKDV-------KPRDIVT
ILVD_BACVZ       NSMNCLSEALGLALPGNGTILATSPERREFVRKSAAQLMETIKKD-------IKPRDIVT
ILVD_BACSU       NSMNCLSEALGLALPGNGTILATSPERKEFVRKSAAQLMETIRKD-------IKPRDIVT
ILVD_BACP2       NSMNCLAEALGIALPGNGTILATSPERREFAKKSAKQLMELIKKD-------IKPRDIVT
ILVD_BACLD       NSMNCLSEALGIAMPGNGTILATSPDRREFAKQSARQLMELIKSD-------IKPRDIVT
ILVD_GEOKA       NSMNCLAEALGLALPGNGTILAVDPARKELVRQSAKQLMYLIEHD-------IKPRDIVT
ILVD_BACAH       NSMNCLCEVLGLALPGNGSILAIDPRREELIKQAAEKLKILIERD-------IKPRDIVT
ILVD_BACHK       NSMNCLCEVLGLALPGNGSILAIDPRREELIKQAAEKLKILIERD-------IKPRDIVT
ILVD_BACAN       NSMNCLCEVLGLALPGNGSILAIDPRREELIKQAAEKLKILIERD-------IKPRDIVT
ILVD_BACC1       NSMNCLCEVLGLALPGNGSILAIDPRREELIKQAAEKLKILIERD-------IKPRDIVT
ILVD_BACCZ       NSMNCLCEVLGLALPGNGSILAIDPRREELIKEAAEKLKILIERD-------IKPRDIVT
ILVD_BACCR       NSMNCLCEVLGLALPGNGSILAIDPRREELIKQAAEKLKILIERD-------IKPRDIVT
ILVD_BACCN       NSMNCLCEVLGLALPGNGSILATDSRREQLIQRAAESLKILMERD-------IKPRDIVT
ILVD_BACSK       NSMNSLMEMLGLALPGNGTLVATSTERHNLIKDAAKHLINLIEKD-------IRPRDIVT
ILVD_BACHD       NSMNSLMEMLGMALPGNGTIVATSEARHQLIKDAAKHLMNLIEKD-------IRPRDIIT
ILVD_LISMO       NSMNCLMEILGMAVPGNGTTLAVSDARRDLIRESAFHLMDLVKKD-------IRPRDIIT
ILVD_LISMF       NSMNCLMEILGMAVPGNGTTLAVSDARRDLIRESAFHLMDLVKKD-------IRPRDIIT
ILVD_LISW6       NSMNCLMEILGMAVPGNGTTLAVSDARRELIRESAFHLMDLVKKD-------IRPRDIIT
ILVD_LISIN       NSMNCLMEILGMAVPGNGTTLAVSDARRELIRESAFHLMDLVKKD-------IRPRDIIT
ILVD_STAAC       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAE       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAA2       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAA9       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAS       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAA1       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAM       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAW       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAN       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAA8       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAT       NSMNCLMEVLGLTLPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAA3       NSMNCLMEVLGLTLPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAB       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAAR       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFKLVENIKND-------LKPRDIVT
ILVD_STAES       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFRLVENIKND-------IKPRDIIT
ILVD_STAEQ       NSMNCLMEVLGLALPYNGTALAVSDQRREMIRQAAFRLVENIKND-------IKPRDIIT
ILVD_STAHJ       NSMNCLMEVLGLALPYNGTALAVSEQRREMIREAAFKLVDNIKKD-------IKPLDIVT
ILVD1_STAS1      NSMNCLMEVLGLALPYNGTALAVSDQRREMIREAAFKLVDNIKND-------LKPKDIVT
ILVD_LEUMM       NSMNTLMEVMGIALPFNGTALAISDERRDLIRDGAKQLMRMVKEN-------VKPRDLIT
ILVD_SYMTH       NSMNCLCEALGLALPGNGTALARSAEREALARAAARRIVEMALAGG------PRPRDIVT
ILVD_CHLCH       NSMNCLSEALGFALPGNGTIVAEDPRRLELVKAASRRIVDLVENN-------VRPRDILT
ILVD_CHLPD       NSMNCLSEALGLALPGNGTILASDPRRNELVKEASRKIIDLVRSN-------TRPRDILS
ILVD_PELLD       NSMNCLSEALGFALPGNGTILAGDPRRNELVREASRRIIDLVEKN-------VRPRDILS
ILVD_CHLPM       NSMNCLSEALGFALPGNGTILAVDPRRNELVREASRQIITLVKNN-------VRPRDILS
ILVD_CHLTE       NSMNCLCEALGFALPGNGTILAADPRRNELVKAAAGRIIDLVKKE-------VRPRQILT
ILVD_BIFAA       NSMNCLTEAIGLALPGNGTILASHSYRKDLFKRAAEQVVKIAKQYYDDDDDSVLPRSIAT
ILVD_BIFLO       NSMNCLTEAIGLALPGNGTILASHSYRKDLFKRAAKQVVKIAHQYYDDSDDSVLPRSIAT
ILVD_CORGL       NSMNCLTEALGLSLPGNGSTLATHAARRALFEKAGETVVELCRRYYGEEDESVLPRGIAT
ILVD_CORGB       NSMNCLTEALGLSLPGNGSTLATHAARRALFEKAGETVVELCRRYYGEEDESVLPRGIAT
ILVD1_COREF      NSMNCLTEALGLSLPGNGSTLATHSARRALFEKAGETVVKLCERYYGQEDESALPRSIAT
ILVD_CORDI       NSMNCLTEALGLSLPGNGTTLATHTARRELFETAGKLVVDLCQRYYGEEDESVLPRNIAT
ILVD_CORJK       NSMNCLTEALGLSLPGNGSTLATHAKRRDLFTKAGTTIVELCRRYYGEGDASVLPRNIAT
ILVD3_NOCFA      NSMNCLTEALGLALPGNGSTLATHAARRALFEKAGRVVVDIANRWYREDDASVLPRNVAN
ILVD_FRACC       NSMNCLTEAIGLSLPGNGSTLATAAARRELFVEAGRLVVDLARRYYEKDDEAVLPRSIAT
ILVD_SALAI       NSMNCLTEAIGLALPGNGSTLATHAARRSLFVDAGRTVVEIAKRWYDGDDATVLPRAVAN
ILVD_STRAW       NSMNCLTEAIGLSLPGNGSVLATHTARKGLYEDAARTVVDITRRYYEQDDESVLPRNIAT
ILVD_STRCO       NSMNCLTEAIGLSLPGNGSVLATHTARKTLYENAARTVLDLTRRYYEQDDDSVLPRNIAT
ILVD2_NOCFA      NSMNCLVEALGLALPGNGTTLATHTARRDLYEAAGATIMAITRRYYDRDDATVLPRAIAS
ILVD_THEFY       NSMNCLTEAIGLALPGNGTVLATHTARKKLYEEAGRVVVEAARRYYEKDDESVLPLSIAT
ILVD_BACFR       NSMNCLNEAIGLALPGNGTIVATHANRTQLFKDAAKQIVENTYKYYRDGDESVLPRSIAT
ILVD_BACFN       NSMNCLNEAIGLALPGNGTIVATHANRTQLFKDAAKLIVENTYKYYRDGDESVLPRSIAT
ILVD_BACTN       NSMNCLNEAIGLALPGNGTIVATHENRTKLFEDAAKLIVENAMKYYEEGDESVLPRSIAT
ILVD_PARD8       NSMNCLNEAIGLALPGNGTIVATHKNRIQLFRDAAKQIVENAYKYYRDGDDSVLPRNIAT
ILVD_BLOFL       NSMNCLMEVLGLAQPGNGSLLATHFDRKEMFLNAGRYIMNLSRLYYEKDNSIVLPRNIAN
ILVD_BLOPB       NSMNCLTEALGLAQPGNGSLLATHSDRKKLFLNAGKYIVHLAKSYYEENNYSVLPRNIAN
ILVD_BUCAI       NSMNCLTEAIGLALPGNGTLLATHIDRKNLFIKSAQIIVKITEDYYKKNNTNVLPRNIAN
ILVD_BUCDN       NSMNCLTEAIGLSLPGNGTLLATHVDRKNLFIKSAKTIVKITKEYYHHNNKKVLPRSIAS
ILVD_BUCAP       NSMNCLIEAIGLSLPGNGTLLATHIDRKKLFKKSARNIVKITKDYYLNNNKNVLPRNIAN
ILVD_BUCMH       NSMNCLTEALGLSLPGNGTLLATHVDRKKLFIQAGRLIVKITKDYYKNNNENLLPRNIAS
ILVD_BUCSC       NSMNCLTEALGLSLPGNGTLLATHIDRKKLFIDSGKLIVKITKEYYEDNNTSFLPRSIAS
ILVD_BUCBP       NSMNCLMEAIGLSLPGNGTILATHIDRKKLFVQAGKLIVKITQEYYKNNNEKFLPRNVAT
ILVD_BUCCC       NSMNCLTEVLGLSFPGNGSLLATHIDRKNLFLKAGKIIVRNTKNYYENNDSSLLPRSIVT
ILVD_ACTP2       NSMNCLTEALGLSLPGNGSMLATHADRKELFLTAGRQIVELCKRYYEQDDASVLPRSIAT
ILVD_MANSM       NSMNCLTEALGLSLPGNGSCLATHADRKQLFLDAATQIVELCKRHYEQDDYSVLPRSIAT
ILVD_HAES1       NSMNCLTEALGLSLPGNGSCLATHADRKQLFLAAGKQIVELCKRYYEQDDTSVLPRSIAT
ILVD_HISS2       NSMNCLTEALGLSLPGNGSCLATHADRKQLFLAAGKQIVELCKRYYEQDDTSVLPRSIAT
ILVD_PASMU       NSMNCLTEALGLSLPGNGSCLATHADRKQLFLDAGKQVVELCKRYYEQEDDSVLPRSIAN
ILVD_HAEI8       NSMNCLTEALGLSLPGNGSMLATHADRKELFLKAGRQIVELCKRYYEQDDASVLPRSIGT
ILVD_HAEIG       NSMNCLTEALGLSLPGNGSMLATHADRKELFLKAGRQIVELCKRYYEQDDASVLPRSIGT
ILVD_HAEIN       NSMNCLTEALGLSLPGNGSMLATHADRKELFLKAGRQIVELCKRYYEQDDASVLPRSIGT
ILVD_HAEIE       NSMNCLTEALGLSLPGNGSMLATHADRKELFLKAGRQIVELCKRYYEQDDVSVLPRSIGT
ILVD_ACTSZ       NSMNCLTEALGLSLPGNGSMLATHADRKELFLEAGRKIVEICKRHYEQDDYSVLPRSIAT
ILVD_AERHH       NSMNCLTEALGLSQPGNGSLLATHSDREQLFKLAGQRIVTLAKRWYEQDDASALPRNIAT
ILVD_AERS4       NSMNCLTEALGLSQPGNGSMLATHADREQLFKLAGQRIVTLAKRYYQQDDESALPRNIAT
ILVD_VIBCH       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLTAGQRIVELTKRYYEQDDASVLPRNIAN
ILVD_VIBC3       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLTAGQRIVELTKRYYEQDDASVLPRNIAN
ILVD_VIBVU       NSMNCLTEALGLSQPGNGSLLATHADRKQLFISAGQRIVELTKRYYEQDDESALPRNIAT
ILVD_VIBVY       NSMNCLTEALGLSQPGNGSLLATHADRKQLFISAGQRIVELTKRYYEQDDESALPRNIAT
ILVD_VIBPA       NSMNCLTEALGLSQPGNGSLLATHADRKELFINAGKRIVELTKRYYEQDDETALPRNIAT
ILVD_ALIF1       NSMNCLTEALGLSQPGNGSMLATHADREQLFINAGKRIVELTKRYYEQDDESALPRNIAD
ILVD_PHOPR       NSMNCLTEALGLSQPGNGSMLATHADREQLFINAGKRIVDLTKRYYLNDDDTALPRNIAN
ILVD_ECOLC       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_ECOHS       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_ECO24       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_SHIF8       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_SHISS       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_SHIFL       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_ECOLI       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_SHIBS       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_ECO57       NSMNCLTEALGLSQPGNGSLLATHSDRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_SHIDS       NSMNCLTEALGLSQPGNGSLLATHSDRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_ECOUT       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQDDESALPRNIAS
ILVD_ECOK1       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQDDESALPRNIAS
ILVD_ECOL5       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQDDESALPRNIAS
ILVD_ECOL6       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQDDESALPRNIAS
ILVD_SALPB       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_SALTY       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAS
ILVD_SALCH       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQNDESALPRNIAN
ILVD_SALPA       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQDDESALPRNIAN
ILVD_SALTI       NSMNCLIEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEQDDESALPRNIAN
ILVD_KLEP7       NSMNCLTEALGLSQPGNGSLLATHADRKELFLNAGKRIVELTKRYYEQDDASALPRNIAS
ILVD_ENT38       NSMNCLTEALGLSQPGNGSLLATHADREQLFLSAGTRIVELTKRYYEQDDASALPRNIAN
ILVD_YERPE       NSMNCLNEALGLALPGNGSLLATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIAN
ILVD_YERPA       NSMNCLNEALGLALPGNGSLLATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIAN
ILVD_YERPN       NSMNCLNEALGLALPGNGSLLATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIAN
ILVD_YERPP       NSMNCLNEALGLALPGNGSLLATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIAN
ILVD_YERP3       NSMNCLNEALGLALPGNGSLLATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIAN
ILVD_YERPS       NSMNCLNEALGLALPGNGSLLATHADRKQLFLDAGKYIVALTKRYYEQDDVSALPRNIAN
ILVD_YERE8       NSMNCLNEALGLALPGNGSLLATHADRKQLFLDAGKHIVELTKRYYEQDDISALPRSIAN
ILVD_PECAS       NSMNCLTEALGLSQPANGSLLATHADRRDLFLNAGTRIVGLAKRYYEQDDASVLPRNIAN
ILVD_SODGM       NSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGERIVGLAKRYYEQDDTSALPRSIAS
ILVD_PHOLL       NSMNCLTEALGLSQPGNGSLLATHADRKALFLNAGKRIVELTKRYYEQNDDSALPRSIAT
ILVD_COLP3       NSMNCLAEALGLALPGNGSMLATHADREQLFLKAGKQIVELTKRYYQDNDESALPRNIAC
ILVD_PSYIN       NSMNCLTEALGLSLPGNGSMLATHADREQLFLEAGERIVDITKRHYEQDDYSVLPRAIAC
ILVD_SHEB5       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMALAKRYYHQDDESALPRNIAN
ILVD_SHEB9       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMALAKRYYHQDDESALPRNIAN
ILVD_SHEB8       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMALAKRYYHQDDESALPRNIAN
ILVD_SHEPC       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMVLAKRYYHQDDESALPRNIAN
ILVD_SHESW       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMALAKRYYHQDDESALPRNIAN
ILVD_SHESM       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMALTKRYYEKDDASALPRNIAS
ILVD_SHESR       NSMNCLTEALGLSLPGNGSMLATHSDRRELFLEAGRRVMALTKRYYEQDDVSALPRNIAS
ILVD_SHESA       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMALTKRYYEQDDASALPRNIAS
ILVD_SHEON       NSMNCLTEALGLSLPGNGSMLATHSDRRELFLEAGRRVMALTKRYYEQDDTSALPRNIAC
ILVD_SHEDO       NSMNCLTEALGLSLPGNGSMLATHSDRRELFLEAGRRVMALTKRYYHDDDETALPRNIAS
ILVD_SHEFN       NSMNCLTEALGLSLPGNGSMLATHEDRRELFLEAGRRVMMLAERYYKHDDETALPRNIAS
ILVD_SHELP       NSMNCLTEALGLSLPGNGSLLATHSDRRELFLEAGRRVMALANRYYRDDDESALPRNIAS
ILVD_SHEAM       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRVMKLAKRYYGDDDASVLPRSIAS
ILVD_SHEHH       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRIMDLATRYYQHDDESALPRNIAN
ILVD_SHEPA       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRIMDLATRYYKHDDESALPRNIAN
ILVD_SHESH       NSMNCLTEALGLSLPGNGSMLATHADRRELFLEAGRRIMDLTTRYYKHDDESALPRNIAN
ILVD_PSEA6       NSMNCLTEALGLSLPGNGSMLATHADREGLFKQAGTQIVELCRRYYQQDDESVLPRNIAN
ILVD1_PSEHT      NSMNCLLEAIGLALPGNGTTLATHKDRKQLYVEAGARIVDLCREYYQKDNQEVLPRAIAN
ILVD1_BURL3      NSMNCLTEALGLSLPGNGTVVATHADREQLFKRAGRRIVELTRQHYEQDDERVLPRSVG-
ILVD_BURVG       NSMNCLTEALGLSLPGNGTVVATHADREQLFKRAGRRIVELTRQYYEQDDVRVLPRSVG-
ILVD2_CUPPJ      NSMNCLTEALGLSLPGNGTVVATHADREQLFKRAGSRIVELARQYYEQEDARVLPRSVG-
ILVD_ACIAC       NSMNCLTEALGLSLPGNGTVVATHADREQLFKRAGRRIVELARRYYEQDDERVLPRSVG-
ILVD_MARMS       NSMNCLTEALGLSLPGNGTTLATHSDRRRLFLDAGRRIVDITKRYYENDEANWAPRSIAS
ILVD_SACD2       NSMNCLTEALGLSLPGNGTVVATHSDRRALFERAGHLIVDLCKDYYERENANVLPRSIGN
ILVD_PSEAE       NSMNCLTEALGLSLPGNGSTLATHADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIAN
ILVD_PSEAB       NSMNCLTEALGLSLPGNGSTLATHADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIAN
ILVD_PSEA7       NSMNCLTEALGLSLPGNGSTLATHADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIAN
ILVD_PSEMY       NSMNCLTEALGLSLPGNGSTLATHADREQLFLRAGRLVVELCQRYYGEGDESVLPRNVAS
ILVD_PSEU5       NSMNCLTEALGLSLPGNGTTLATHADREQLFLRAGRIAVELCKRYYQDGDESVLPRNVAS
ILVD_PSEP1       NSMNCLTEALGLALPGNGSTLATHSDREQLFLTAGRTIVELCKRYYGENDESVLPRSIAN
ILVD_PSEPK       NSMNCLTEALGLALPGNGSTLATHSDREQLFLTAGRTIVELCKRYYGENDESVLPRSIAN
ILVD_PSEPG       NSMNCLTEALGLALPGNGSTLATHADREQLFLTAGRTIVELCKRYYGENDESVLPRSIAN
ILVD_PSEE4       NSMNCLTEALGLALPGNGSTLATHSDREQLFLTAGRTIVELCKRYYGENDASVLPRSIAN
ILVD_PSEPF       NSMNCLTEALGLALPGNGSTLATHSDREQLFLQAGRTIVELCKRYYGENDESVLPRNIAN
ILVD_PSEF5       NSMNCLTEALGLALPGNGSTLATHSDREELFLRAGRTIVELCQRYYGDNDESVLPRNIAN
ILVD_PSE14       NSMNCLTEALGLALPGNGSALATHSDREQLFLQAGRTIVDLCRQYYKENDDSVLPRNIAN
ILVD_PSEU2       NSMNCLTEALGLALPGNGSALATHSDREQLFLQAGRTIVDLCRQYYKENDDSVLPRNIAN
ILVD_PSESM       NSMNCLTEALGLALPGNGSALATHSDREQLFLQAGRTIVDLCRQYYKENDYSVLPRNIAN
ILVD_XANAC       NSMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIAT
ILVD_XANC5       NSMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIAT
ILVD_XANOR       NSMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIAT
ILVD_XANOM       NSMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIAT
ILVD_XANCP       NSMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIAT
ILVD_XANC8       NSMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIAT
ILVD_XYLFA       NSMNCLTEALGLSLPGNGTVVATHSDRKQLFLNAGRTVIELCHRWYGNEDATALPRGIAT
ILVD_XYLFT       NSMNCLTEALGLSLPGNGTVVATHSDRKQLFLNAGRTVIELCHRWYGAEDATALPRGIAT
ILVD_HAHCH       NSMNCLTEAIGLSLPGNGTTLATHSDREQLFLTAARRIVDLTKRYYQDEDTSVLPRSIAS
ILVD_RHORT       NSMNCLTEALGLSLPGNGSALATHVARRGLFEEAGRRIVDLAKRRYEHDDESTLPRAIAS
ILVD_HYDCU       NSMNCLAEALGIALPGNGTTLATHADRRHLFEEAGRRIVELAKLYYEKDDEGVLPRSIAT
ILVD_CAUVC       NSMNCLTEALGLSLPGNGSVLATHADREALFKEAGRVVVDLCQRWYEQEDATALPRGIAT
ILVD_GRABC       NSMNCLTEALGLSLPGNGSVLATHADREKLFREAGHLIVDLARRWYEQDDVSATPRGIAT
ILVD_ZYMMO       NSMNCLTEALGLSFPGNGSMLATHSDREQLFRKAGHTIVDMARSYYEQDDAAVLPRSIAT
ILVD_GLUOX       NSMNCLTEALGLSLPGNGSLLATHNDRRELFLSAGRRIVELARRWYEQDDASVLPRSIAT
ILVD_AZOSB       NSMNCLTEALGLSLPGNGTTLATHADREKLFREAGRRIVDLAKRYYEKDDATVLPRAIAS
ILVD2_AROAE      NSMNCLTEALGLSLPGNGTVLATHADREQLFLRAGRTIVDMARRYYEKDDASVLPRSIVT
ILVD_DECAR       NSMNCLTEAFGLSLPGNGTVVATHADRKQLFLRAGRQIVELCKRYYEQDDASVLPRAIAT
ILVD1_BORBR      NSMNCLTEAIGLALPGNGTIVATHAWRKGLFEQAGRLVVELCRRYYEQDDASVLPRSIAT
ILVD1_BORPA      NSMNCLTEAIGLALPGNGTIVATHAWRKGLFEQAGRLVVELCRRYYEQDDASVLPRSIAT
ILVD1_BORPE      NSMNCLTEAIGLALPGNGTIVATHAWRKGLFEQAGRLVVELCRRYYEQDDASVLPRSIAT
ILVD_BORA1       NSMNCLTEAIGLALPGNGTIVATHAWRRGLFEQAGRLVVDLCRRYYEQDDASVLPRSIAT
ILVD_NEIMA       NSMNCLTEALGLSLPGNGSYLATHVGRKELFLEAGRMIVEITKRYYEQNDETVLPRSIAT
ILVD_NEIMF       NSMNCLTEALGLSLPGNGSYLATHVGRKELFLEAGRMIVEITKRYYEQNDETVLPRSIAT
ILVD_NEIMB       NSMNCLTEALGLSLPGNGSYLATHAGRKELFLEAGRMIVEITKRYYEQNDETVLPRSIAT
ILVD_NEIG1       NSMNCLTEALGLSLPGNGSYLATHAGRKELFLEAGRMIVEITKRYYEQDDETVLPRSIAT
ILVD_PSYA2       NSMNCLTEALGLALPGNGSLLATHSLRRELFLEAGRTIVSLAKRRYEQDDDSVLPRSIAT
ILVD_CHRVO       NSMNCLTEALGLSLPGNGSLVATHADRKELFLKAGRLIVELAKRHYEGEDYSILPRGIAT
ILVD_METFK       NSMNCLTEALGLSLPGNGSTLATHAARKELFLKAGRLIVEITKRYYEQDDESVLPRSIAN
ILVD_SYNP6       NSMNCLTEALGLSLPGNGSLLATHGDRKELFLEAGRLAVKLAKQYYEQDDESVLPRSIAS
ILVD_SYNE7       NSMNCLTEALGLSLPGNGSLLATHGDRKELFLEAGRLAVKLAKQYYEQDDESVLPRSIAS
ILVD_NITOC       NSMNCLTEALGLALPGNGSLLATHADRKELFLEAGRLIVALAKRYYEQDDETVLPRSIAN
ILVD_NOVAD       NSMNCLTEALGLSLPGNGSTLATHADRQRLFLEAGRLVVDLCKRYYEQDDESVLPRSIAT
ILVD_SPHAL       NSMNCLTEALGLSLPGNGSTLATHADRKELFLRAGRIVVEMCRRHYEEGDDSVLPRNIAT
ILVD1_ACIAD      NSMNCLTEALGLSLPGNGSIVATHANRKKLFLKAGELIVSLAKRYYEQDDSSILPRSIAT
ILVD_DEIRA       NSMNCLTEALGLSLPGNGSVLATHSDRQNLFKRAGHLIVDLAKRYYEGDDESVLPRSVAT
ILVD_RHIEC       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDVKALPRTIAS
ILVD_RHIL3       NSMNCLTEALGLSLPGNGSTLATHLDRKRLFVEAGHLIVDLARRYYEQDDVKALPRTIAS
ILVD_RHIME       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQEDERVLPRNIAT
ILVD_SINMW       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDIARRYYEQEDERVLPRSIAS
ILVD_AGRFC       NSMNCLTEALGLSLPGNGSTLATHSDRKRLFVEAGHLIVDLARRYYEQDDETVLPRTIAN
ILVD1_RHILO      NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLAQRYYEQDDETALPRSIAS
ILVD_BRUAB       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIAT
ILVD_BRUA2       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIAT
ILVD_BRUO2       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIAT
ILVD_BRUC2       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIAT
ILVD_BRUSU       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIAT
ILVD_BRUME       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIAT
ILVD_BRUSI       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIAT
ILVD_OCHA4       NSMNCLTEALGLSLPGNGSTLATHADRKRLFVEAGHLVVDLARRYYEQDDESVLPRSIAS
ILVD_RHOP5       NSMNCLTEALGLSLPGNGSVLATHADRQRLFVEAGHLIVDITRRYYEQNDDSVLPRNVAS
ILVD_NITHX       NSMNCLTEALGLALPGNGSVLATHADRKGLFVEAGHLIVDLARRYYEQDDARVLPRAIAS
ILVD_NITWN       NSMNCLTEALGLALPGNGSVLATHADRKGLFVEAGHLIVDMARRYYEQNDERVLPRSVAS
ILVD_AZOC5       NSMNCLTEALGLALPGNGSVLATHADRERLFVEAGHLVVDLARRYYEQDDAGVLPRTIAS
ILVD_RHOPA       NSMNCLTEALGLSLPGNGSVLATHADRKRLFVEAGHTIVDLARRYYEGDDASVLPRNIAN
ILVD_RHOP2       NSMNCLAEALGLALPGNGSVLATHADRKRLFVEAGHTIVDLARRYYEGDDESVLPRKVAS
ILVD1_BRADU      NSMNCLTEALGLALPGNGSVVATHADRKRLFVEAGHTIVDLVRRYYEQDDASVLPRNVAN
ILVD_BARHE       NSMNCLTEALGLSLPGNGSMLATHADRQMLFEEAGRQIVTLVKRYYEKGDETVLPRSIAS
ILVD_BART1       NSMNCLTEALGLSLPGNGSVLATHRDRRMLFEEAGRQIVALVKRYYEKDDETVLPRSIAS
ILVD_RHOS4       NSMNCLTEALGLSLPGNGSTLATHAYRKELFLEAGRRAVELCRRYYEQEDEGVLPRAIAT
ILVD_RHOS1       NSMNCLTEALGLSLPGNGSTLATHAYRKELFLEAGRRAVELCRRYYEQEDEGVLPRAIAT
ILVD_PARDP       NSMNCLSEALGLSLPGNGSTLATHAFRKNLFLEAGRRIVEVTRRHYEQDDASVLPRAIAS
ILVD_RUEPO       NSMNCLAEALGLALPGNGSTLATHSDRKALFLEAGRRIVEITKRHYEGEEKGLLPREIAT
ILVD_RUEST       NSMNCLAEALGLALPGNGSTLATHSDRKQLFLEAGRKIVEITKRHYEQNEKGLLPREIAT
ILVD_HYPNA       NSMNCLAEALGLALPGNGSTLATHADREALFRRAGRRIVELTKAYYEGGDTGVSARGIAT
ILVD_MAGSA       NSMNCLIEALGLGLPGNGTVVATHADRKELFLEAGRRIVDLARRAYEGDDASVLPRSIAT
ILVD_ACICJ       NSMNCLTEALGLALPGNGSLLATHADRKRLFVEAGWQIVDLARRYYEQDDEGVLPRRIGG
ILVD_MAGMM       NSMNCLTEALGLSLPGNGTVLATHTARKKLFLDGAKRIVELTRRFYEQDDVSALPRSIAT
ILVD_NOSS1       NTMSSAFEALGMSLPYSSTMAAEDDEKADSTEESAKVLVEAIRHQ-------LLPRQIIT
ILVD_TRIEI       NTMSSAFEAMGMSLMYSSTMAAEDAEKADSTEKSAHVLVEAIRKQ-------ILPSQIIT
ILVD_ACAM1       NTMSSAFEAMGMSLMYSSTMAAEDEEKAVSAEQSAAVLVEAIHKQ-------ILPRDILT
ILVD_MICAN       NTMSSIFEAMGMSLPYSSTMAAEDAEKADSTEESAKVLVEAVRKQ-------ILPSQILT
ILVD_SYNY3       NTMSSAFEAMGMSLPYSSTMAAVDGEKADSTEESAKVLVEAIKKQ-------ILPSQILT
ILVD_THEEB       NTMSSAFEAMGMSLMYSSTMTAEDAEKADSTELAGKVLVEAIRKN-------IRPRDIIT
ILVD_SYNJB       NTMSSAFEAMGMSLPYSSTMAAEDEEKAESAAQSAKVLAEAIKAN-------IRPRDIIT
ILVD_SYNJA       NTMSSAFEAMGMSLPYSSTMAAEDEEKAESAAQSAKVLAEAIQAN-------IRPRDIIT
ILVD_GLOVI       NTMSSAFEAMGMSLVYSSTMAAEDPEKADSTALSAKVLVEAIQAQ-------ILPSAILT
ILVD_NITEU       NTMSSAIEAMGMSLPYSSTMAAEDEEKRISAIRSAEVLVDAVKKQ-------ILPRSLIT
ILVD_NITEC       NTMSSAIEAMGMSLPHSSTMAAEDEEKRISATRSAEVLVEAIKKQ-------ILPRSLIT
ILVD_NITMU       NTMSSAFEAMGMSLPYSSTMAAEDGEKLTSAARSAEVLVDAIRKQ-------IRPRDIIT
ILVD_CHLAA       NTMSSAIEALGLSLPGSSTMAAEDEEKALSAARSGEVLVEAIRAN-------RTARQMLT
ILVD_DEIGD       NTMSSAFEAMGMSLPYSSTMSAVDAEKAVSAADSARALIRLIEQD-------IRPLDILT
ILVD_HALHL       NTMSSAFEAMGMSLMGSSTVSAEDDEARDVAAEASRVLMDAVHHD-------RRPSSILT
ILVD_PROMS       NTMSAVIEVLGLSLPHSSTMAAEDLEKELSADKSAEILVSAIEKD-------IRPLDLMT
ILVD_PROM9       NTMSAVIEVLGLSLPHSSTMAAEDLEKELSADKSAEILVSAIEKD-------IRPLDLMT
ILVD_PROM0       NTMSAVIEVLGLSLPHSSTMAAEDLEKELSADKSAEILVSAIKKD-------IRPLDLMT
ILVD_PROM2       NTMSAVIEVLGLSLPHSSTMAAEDLEKELSAEKSAEILVSAIKKN-------IRPLDLMT
ILVD_PROM5       NTMSAVIEVLGLSLPHSSTMAAEDYEKVVSAEKSAEILVDAIKKD-------IRPLDLMT
ILVD_PROMP       NTMSAVIEVLGLSLPYSSTMAAEDYEKEVSAEKSAEILVDAIRKD-------IRPLTLMT
ILVD_PROMA       NTMSAAIEAMGLSLPHSSTMAAEDQEKIKSTQKSAEVLIKAIKEN-------IRPLDLLT
ILVD_PROM3       NTMSAAIETLGLSLPYSSTMAAEDEEKANSAARSAEVLVDAIKAN-------ICPLDLLT
ILVD_PROMM       NTMSAAIETLGLSLPYSSTMAAEDEEKANSAARSAEVLVDAIKAN-------ICPRDLLT
ILVD_SYNSC       NTMSAAIETMGLSLPYSSTMAAEDEEKADSAARSAEVLVEAVKAN-------IRPLDLLT
ILVD_SYNPX       NTMSAAIETMGLSLPYSSTMAAEDEEKADNAARSAEVLLDAVKAN-------IRPLDLLT
ILVD_SYNS9       NTMSAAIETMGLSLPYSSTMAAEDQEKADSAARSAEVLVDAVKAN-------IRPLDLLT
ILVD_SYNR3       NTMSAAIETMGLSLPFSSTMAAEDPEKAESAARSAEVLVEAIAAN-------IRPLDLLT
ILVD_PROMT       NTMSAAIETMGFSLPFSSTMAAVDDEKAESAAESAQVLVNAVKNN-------IRPLDLLT
ILVD1_AROAE      NTMSAAFEALGMSLPYSSTMANEDAEKLASAAESARVLVEAIKRG-------LRPRDIVT
ILVD3_AROAE      NTMSAAFEALGMSLPYSSTMANEDAEKLASAAESARVLVEAIKRG-------LRPRDIVT
ILVD3_BORBR      NTMSSAFEAMGMSLPHSSTMANEDQEKVASAAESARVLVEAVRRQ-------LRPRDIIT
ILVD2_BORPA      NTMSSAFEAMGMSLPHSSTMANEDQEKVASAAESARVLVEAVRRQ-------LRPRDIIT
ILVD2_BORPE      NTMSSAFEAMGMSLPYSSTMANEDQEKVASAAESARVLVEAVRRQ-------LRPRDIIT
ILVD_BURMA       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURM9       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURM7       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURMS       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURPS       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURP6       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURP1       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURP0       NTMSSSFEALGMSLLYSSTMANPDQEKADSAAESARVLVEAVKKD-------LKPRDIIT
ILVD_BURTA       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKKD-------LKPRDIIT
ILVD2_BURL3      NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVKRD-------LKPRDIIT
ILVD1_CUPPJ      NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAIKKD-------IKPRDIIT
ILVD_RALSO       NTMSSSFEALGMSLLYSSTMANPDQEKVDSAAESARVLVEAVRRD-------LKPRDIIT
ILVD_HERAR       NTMSSSFEALGLALPYSSTMANPDDEKVGSAAESARVLIEAIKKD-------LKPRDIVT
ILVD_JANMA       NTMSSSFEALGLALPYSSTMANPDDEKVGSAAESARVLIEAIKND-------LKPRDIVT
ILVD_POLNA       NTMSSAFEALGISLPYSSTMANPHDEKLNSAKESARVLIEAVKKD-------IKPRDIVT
ILVD_POLSJ       NTMSSAFEALGISLPYSSTMANPHDEKMNSARESAKVLVEAIKKD-------IKPRDLVT
ILVD_RHOFT       NTMSSAFEALGISLVYSSTMANPHDEKLNSAQESAKVLIEAIKND-------LKPRDIVT
ILVD_VEREI       NTMSSAFEALGISLPYSSTMANPHDEKTNSAKASAKVLIEAIRND-------LKPRDIVT
ILVD_METPP       NTMSSAFEALGMSLPFASTMANVEDPIVAHTKEAARVLVEAVKAD-------LKPRDIVT
ILVD_TREPR       NTMSASFEALGMSLLYSSTAPSPGIEGELSISTSARSLINAVRRG-------IRPRDVVT
ILVD_CHRSD       NTMASAIEAMGMSLPNSSAQDAVSQSKKDDSRAAGEAVLKLLELD-------IKPSDIMT
ILVD2_PSEHT      NTLASAIEALGMSMPNSSAQNAISQNKKQDCIDAGKAIVYLLEHD-------IKPSDIMT
ILVD2_ACIAD      NTMASAIEALGMSLPGSSAQDAISEEKRQDCHRAGEAVMNLLRLD-------IRPRDIMT
ILVD_METCA       NTMASAIEALGMSLPGSSAQVAISRAKELDCERAGAQVLKLLDLG-------LKPRDIMT
ILVD_RUTMC       NTMASAIEALGMSLPNSSAQDAISDDKNNDCVQAGQAVLNLLNKD-------IKPRDIMT
ILVD_LACLS       NTLASAIETLGMSLPYSASNPAVSQEKEDECDEIGLAIKNLLEKD-------IKPSDIMT
ILVD_LACLA       NTLAAAIETLGMSLPYSSSNPAVSQEKQEECDEIGLAIKNLLEKD-------IKPSDIMT
ILVD_CYTH3       NTMASAIEAMGLTLPYSSTAPATSEKKKAETLALGKAMMHLLEKD-------IKPRDIMT
ILVD_FRATN       NTMACAIEALGMSLPFSSSTPATSVEKVQECDKAGETIKNLLELD-------IKPRDIMT
ILVD_FRATT       NTMACAIEALGMSLPFSSSTSATSVEKVQECDKAGETIKNLLELD-------IKPRDIMT
ILVD_FRAP2       NTMACAIEALGMSLPFSSSTPATSVEKVQECDKAGETIKNLLELD-------IKPRDIMT
ILVD_RHOBA       NTMATAIEALGMALPYSASIPAEHPEKKEECKRAGLAILELLKKD-------IKPRDIMT
ILVD_LEPBJ       NTMSSAIEALGMSLPGSASMPAVSSRKSEDCYEAGKALINLIQKG-------VTPKRILT
ILVD_LEPBL       NTMSSAIEALGMSLPGSASMPAVSSRKSEDCYEAGKALINLIQKG-------VTPKRILT
ILVD_LEPIN       NTMSSAIEALGMSLPGSASMPAVSSRKANDCYEAGKALINLIQKG-------ITPKQILT
ILVD_LEPIC       NTMSSAIEALGMSLPGSASMPAVSSRKANDCYEAGKALINLIQKG-------ITPKQILT
ILVD_STRPN       NTMATAIEVLGMSLPGSSSHPAESADKKEDIEAAGRAVVKMLELG-------LKPSDILT
ILVD_STRR6       NTMATAIEVLGMSLPGSSSHPAESADKKEDIEAAGRAVVKMLELG-------LKPSDILT
ILVD_STRP2       NTMATAIEVLGMSLPGSSSHPAESADKKEDIEAAGRAVVKMLELG-------LKPSDILT
ILVD_STRT2       NTMATAIEVMGMSLPGSSSHPAESAEKKADIEEAGRAVVKMLEMG-------LKPSDILT
ILVD_STRT1       NTMATAIEVMGMSLPGSSSHPAESAEKKADIEEAGRAVVKMLEMG-------LKPSDILT
ILVD_STRSY       NTMATAIEVMGMSIPGSSSHPAESPEKKADIEEAGRAVVRMLELG-------IKPSDIMT
ILVD_STRS2       NTMATAIEVMGMSIPGSSSHPAESPEKKADIEEAGRAVVRMLELG-------IKPSDIMT
ILVD_STRSV       NTMATAIEVLGMSLPGSSSHPAESKDKQEDIEAAGRAVVKMLKMG-------LKPSDILT
ILVD_STRMU       NTMATAIEVLGLSLPGSSSHPAESAEKKADIEEAGRAVVKMLEMG-------LKPSDILT
ILVD_OCEIH       NTMASAAEALGISLPGSSSNPAESEEKQGDVEAAGEAIKDLLEKG-------IYPKDILT
ILVD2_STAS1      NTMSSAIEAMGMSLPGSASHPAVSTNKSKDSRAAGKAVYKLLEKG-------IYPKDIMT
ILVD_ROSCS       NTMATVMEIIGLSPIGTAAVPAADPRKDSVGYRAGQLIMDVLRRD-------LKPRDILT
ILVD_ROSS1       NTMATVMEIIGLSPMGTAAVPAADPRKDSVGYRAGQLIMDVLRRD-------LKPRDILT
ILVD_KORVE       NTMSMCGEFLGISPMGANSVPAMTVEKQQVARRCGHLVMELVRRD-------IRPSQIIT
ILVD_THET2       NTMAMALEALGLSPVGYNAIPAVHPEKERATKEAGKILAWAIAHD-------WKPKDFLT
ILVD_THET8       NTMAMALEALGLSPVGYNAIPAVHPEKERATKEAGKILAWAIAHD-------WKPKDFLT
ILVD_HALMA       NTMASISEALGFAPLGSASPPAEHESRYEEARRAGELAVEVVQER-------RSPSDFLT
ILVD_NATPD       NTMASLSEALGLAPLGSASPPAENHERYAVARRAGELAVEVVEED-------RHPSDILT
ILVD2_BORBR      NTMAMVGEALGLSPLGSAMMPAVYSERLAIAQRAGEHVMRALAAGG------PLPRQLVT
ILVD3_BRADU      NTMGMVSEAMGLTIPNVSMVPGVYAERAQISRRAGRLIMEMLERGG------PLPRDIVT
ILVD2_BRADU      NTMATVSEAIGLALPYSAGAPAPYEIRDAFCMTAGEKVMELIDQN-------IRPRDIVT
ILVD2_RHILO      NTMATVAEAIGLALPYSCGAPAPYEMRDRFNFASGEKIMELIAKN-------IRPRDIIT
ILVD_PARL1       NTMACVSEAMGLALPGSAGAPAPYESRDEYAEASGRAVMHLLANN-------IRPRDIVT
ILVD_PELUB       NTMACVSEAIGLALPYSAGTPAPYEERDKYALLSGKTVMNLLQKN-------IRPRDIVT
ILVD_DINSH       NTMACVSEAIGLALPNSAGAPAPYESRDQYGEASGRAVMDLIEKG-------IRARDIVT
ILVD_PYRAR       NTMATLGEALGLSLLGSASPPATSARRRKYAVESGRAVLKAAELG-------VTPRKVVT
ILVD_PYRIL       NTMAILSEALGLALLGSASPPATSARRKAYAVASGRAVLKAAELG-------ITPRKVVT
ILVD_PYRAE       NTMAMIGEALGLSLLGSASPPATSSRRRAFAIASGRAVLKAAELG-------ITPRKVVT
ILVD_PYRCJ       NTMALLAEAMGVSLLGSATPPATSARRRKFAVESGKAAVRALELG-------IKPRDVVT
ILVD_AERPE       NTMAILAEALGLSPLGSASPPATSSERARELARAGALAVGLVETG-------LTPRRILT
ILVD_METS5       NTMAMLSEALGLSLPGSSAPPAVSSDRTKFAKETGRTLMKVMEIG-------LKPRDILT
ILVD_SULTO       NTMGLMTEALGLALPGSASPPAVDSARVKYAYETGKALMNLIEIG-------LKPRDILT
ILVD_PICTO       NTMAFMSEGLGMALTGSASPPAVDSGKTKFAFETGAAIKTLVEND-------IKPRDVMT
ILVD_SULAC       NTMGSMSEALGMALPGSASPTATSSRRIMYVRETGKAVSRLLENG-------VKSRDILT
ILVD_SACS2       NTMGSMSEALGMALPGSASPTATSSRRVMYVKETGKALGSLIENG-------IKSREILT
ILVD_MYCA1       NTMASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRG-------ITARDILT
ILVD_MYCPA       NTMASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRG-------ITARDILT
ILVD_MYCUA       NTMASAAEALGMSLPGSAAPPATDRRRDGFARQSGQAVIELLRQG-------ITARDIMT
ILVD_MYCBO       NTMASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRG-------ITARDILT
ILVD_MYCTU       NTMASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRG-------ITARDILT
ILVD_MYCLE       NTMASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVIELLRRG-------ITARDILT
ILVD_MYCSJ       NTMASAAEALGMSLPGSASPVAIDKRRDEYARRSGEAVVEMLRRG-------ITARDILT
ILVD1_NOCFA      NTMASAAEALGMSLPGSAAPPATDRRRDGYARRSGQAVVELLRRG-------ITARDILT
ILVD_ACIC1       NTMASAAEALGMSLPGSASPPAPDRRRDGFARASGEAVVNLLRRG-------ITARDIMT
ILVD_NOCSJ       NTMASIAEAIGMSLPGSAAPPAVDRRRDGFAHRSGEAVVNLLRQG-------ITARQIMT
ILVD_ARTS2       NTMACIGEALGMSLPGSAAPPSADRRRDEFARKSGEAVVNLLRLG-------ITARDIMT
ILVD_RENSM       NTMACIGEALGMSLPGSAAPPSADRRRDMFAHRSGEAVVELLRRG-------IRSRDIMT
ILVD_CLAM3       NTMASVAEALGMSLPGSAAPPSADRRRDYFAHRSGEAVVNLIAEG-------ITARDIMT
ILVD_CLAMS       NTMASVAEALGMSLPGSAAPPSADRRRDYFAHRSGEAVVNLIAKG-------ITARDIMT
ILVD_LEIXX       NTMASVAEALGMSLPGSAAPPSADRRRDSFAHRSGEAVVSLLKQG-------ITARDILT
ILVD_TROW8       NTMASVAEALGMSLLGSASPPSADRRRDVYAHKSGEAVVELLKRG-------ITARDILT
ILVD_TROWT       NTMASVAEALGMSLLGSASPPSADRRRDVYAHKSGEAVVELLKRG-------ITARDILT
ILVD2_COREF      NTMASAAEAMGMSLPGSAAPPAIHQDRTLYARRSGEAVVELLRRG-------IRARDIIT
                 *::    * :*.                                             .  

ILVD_CALS8       IEAFENALTVDMALGGSTNTILHLPAIANE-LGIKLNLDIINDISDKTPNLCKLSPAGH-
ILVD_HUNT2       PKAFENALAVDMALGCSTNSVLHLPAIANE-VGMEINLDIINEISSKVPNLCKLAPAGH-
ILVD_CALS4       KEAFVNAFSLDMALGGSTNTVLHLKAIAHE-AGVDIPLEEINDISDRVPNLCKLSPAGK-
ILVD_CLOB8       EDAFMNAMTMDMALGCSTNSMLHLPAIAHE-VGFDLNVDIANEISSKTPNLCHLAPAGH-
ILVD_CLOK5       EAAFKNALTMDMALGCSTNSMLHLPAIAHE-AGIELNVDMANEISAKTPNLCHLAPAGH-
ILVD_LACP7       EKAFLNALAVDMALGCSTNSMLHLPAIAHE-AGVDLNVDIANEISAKTPNLCHLAPAGH-
ILVD_CLOAB       EAAFMNAVAMDMALGGSTNSLLHLPAIAYE-CDVDINFDKINEISEKIPHVCKLSPAGF-
ILVD_CARHZ       RESLLNGLAVDMALGCSTNTVLHLAAVAYE-AGVEFDLNLVNEVSERTPNLCRLSPAGP-
ILVD_MOOTA       ATAFRNAVAVDMALGGSTNTCLHLPAIAHE-AGVKLDLNTFNEINRRTPQICKLSPAGS-
ILVD_SYNFM       QKAFENAITVDMALGCSTNTVLHVPAIARE-AGIDLDLGLFNTLSSRTPHLCSLRPGGP-
ILVD_SYNAS       LDAFKNALAVDMALGCSTNTVLHIPAIAHE-AGIRLDLDLFNEISARTPNLCHLSPAGP-
ILVD_DESVH       EKAVANAVAVDMALGCSTNTVLHLPAVFAE-AGLDLTLDIFDKVSRKTPNLCKLSPAGH-
ILVD_DESVV       EKAVANAVAVDMALGCSTNTVLHLPAVFAE-AGLDLTLDIFDKVSRKTPNLCKLSPAGH-
ILVD_DESAG       EKAVANAVAADMALGCSTNTVLHLPAVFAE-AGLDLTLGIFDEVSRKTPNLCKLSPAGD-
ILVD_THEMA       LDSFMNAVMVDLATGGSTNTVLHLKAIAES-FGIDFDIKLFDELSRKIPHICNISPVGP-
ILVD_THEP1       LDSFMNAVMVDLATGGSTNTVLHLKAIAES-FGIDFDIKLFDELSRKIPHICNISPVGP-
ILVD_PYRAB       PEAFEDAIAVDMALGGSTNTVLHLMAIARE-AGVKLTLDTFDEISEKTPTLVKISPAGK-
ILVD_PYRFU       REAFEDAIAVDMALGGSTNTVLHLMAIANE-AKVDLSLEDFDRISEKTPTLAKLSPAGK-
ILVD_CLONN       KEAFKNAIALDMAIGGSSNTTLHLMAIAHE-AKVYLTLEDFDEISRRIPHITKLSPAGT-
ILVD_IGNH4       RKALENAIAVDMALGGSTNSVLHLEALAYE-LGIDLPLEVFDEISRKVPHIASISPSGR-
ILVD_GEOMG       RAAFENAIRVDLALGGSSNTVLHLLAIARE-AGVDLPLETFDILSKETPQIASMNPAGE-
ILVD_GEOSL       RDAFENAIRVDLALGGSSNTVLHLLAIARE-AGVDLPLETFDTLAKETPQISSMNPAGE-
ILVD_GEOUR       RAAFENAIRVDLALGGSSNTVLHLLAIAHE-AGVELPLETFDILAKETPQLASMNPAGE-
ILVD_PELPD       REAFENAIRVDLALGGSSNTVLHLLAIANE-AGVELPLETFDILAKETPQLASMNPAGE-
ILVD_PELCD       REAFENAIRVDLALGGSSNTVLHLLSIAHE-AEVDLPLDLFDKLSRETPQLASMNPGGK-
ILVD_METMJ       PKSLANAIRVDMALGGSSNTVLHLMAVARE-AAVPLDLEAFNAVAEVTPHICHMMPGGP-
ILVD_METB6       KKSLENAIRVDMALGGSTNTVLHLMAIATE-AEIPLSLADFNRIADEIPHICHMLPAGP-
ILVD_METHJ       PASLRNAIRVDMALGGSTNTVLHLMAIATE-AGVPFDLQEFNRLSEQIPHIASMMPAGP-
ILVD_ARCFU       ERSFENAITMDMLVGGSTNTVLHLPAIAKE-AGIRLSLDLFDEISRRTPHIVSIDPASK-
ILVD_METTH       QEAFENAVMVDLALGGSTNTTLHIPAIAAEIDGLNINLDLFDELSRVIPHIASISPAGE-
ILVD_METST       QEAFENAIKVDLALGGSTNTTLHIPAIANEVDGVDVTIDLFDKLSHEVPYICSIRPGGN-
ILVD_METS3       QEAFNNAITVDMALGGSSNTALHIPAIANEVEDVEVTLDLFDKISRVVPHICLISPAGT-
ILVD_METJA       KEAFENAILVDLALGGSTNTTLHIPAIANEVKPKFITLDDFDRLSGEVPHIASLRPGGE-
ILVD_META3       KESFENAILVDLALGGSSNTTLHIPALAYEIAPEFITLDDFDRLCDEVPHIASLRPGGD-
ILVD_METM5       KEAFENAILVDLALGGSTNTTLHIPAIANEIENKFITLDDFDRLSDEVPHIASIKPGGE-
ILVD_METM7       KEAFENAILVDLALGGSTNTTLHIPAIANEIENKFITLDDFDRLSNEVPHIASIKPGGE-
ILVD_METMP       KEAFENAILVDLALGGSTNTTLHIPAIANEIENKFITLDDFDRLSDEVPHIASIKPGGE-
ILVD_METVS       KEAFENAILVDLALGGSTNTTLHIPAIANEIENKFITLDDFDRLSDEVPHIASIKPGGE-
ILVD1_METAC      QKSFENAIMVDMAVGGSTNTTLHLPALAHE-FGLELPLKTFDELSRTTPHLISLRPGGP-
ILVD_METMA       YKSFENAIMVDMAVGGSTNTTLHLPALAHE-FGLELPLEAFDELSRKTPHLISLRPGGP-
ILVD2_METAC      QKSFENAIMVDMAVGGSTNTTLHLPALAHE-FGLGLPLEAFDELSRKTPHLISLRPGGP-
ILVD_METBF       FKSFENAIMVDMAVGGSTNTTLHLPALAHE-FGLNLPLEKFDELSRETPHLISLRPGGP-
ILVD_METBU       DKSFENAIRVDLAVGGSTNTTLHLPAIAHE-FGLELPLEKFNELSKTTPHLIGLRPGGE-
ILVD_METTP       RESFENAVRVDMAIGGSTNTALHLPAIAAE-FDIDLELDVFDRLSRETPHLVNLRPGGP-
ILVD_METKA       REAFLDAIRVDMALGGSTNTVLHLLAIARE-ADVELSLDDFDELSRETPHLCAMRPGGP-
ILVD_DEHMB       PDAIHNAFSLDVALGGSTNSVLHVMAVAHE-AGADFSLEQINRISDCTPNLCKLRPSGP-
ILVD_DEHMC       PDAIHNAFSLDVALGGSTNSVLHVMAVAHE-AGADFSLEQINRISDCTPNLCKLRPSGP-
ILVD_DEHM1       PDAIYNAFSLDVALGGSTNSVLHVMAVAHE-AGADFSLEEINRVSDTTPNLCKLRPSGP-
ILVD_ANADE       RDAIHNAMVVDMAMGGSSNTVLHMLAISREAGA-PLSLRDIEEIAGKVSHIAKIAPSLAT
ILVD_ANADF       ADAIHNAMVVDMAMGGSSNTVLHMLAIAREAGV-EFGLRQIEAVAAKVGHIAKIAPSLST
ILVD_ARCB4       ENAVKNAFAVDMAMGGSSNTVLHMLAISKEAGV-NFELKDINAISKRVSHIAKISPSLST
ILVD_SULNB       ENAVRNAFAVDMAMGGSSNTVLHMLAIAKEAEV-DFNLEDINMISKRVSHIAKISPSLTT
ILVD_NITSB       EKAIHNAFVVDMAMGGSTNTVLHMMAISKEAGV-DFPLSKLNEISKHVAHIAKISPSLQT
ILVD_SULDN       EKAVHNAFVVDMAMGGSSNTVLHMLAIAREAGV-DFPIEKINEIADNVAHIAKISPSLTT
ILVD_HELHP       KKAVHNAFVVDMAMGGSTNTILHMLAIAKEAEV-DFNLDSINAIASQVAHIAKIAPALST
ILVD_WOLSU       KEAIHNAFVVDMAMGGSTNTVLHMMAIAKEREA-DFDLRKINEIAKEVSHIAKISPALYT
ILVD_CAMFF       EKTIKNAMVVDMAMGGSSNTILHMLAISREAGY-PLDIASLNDISRSVPHITKIAPSLPS
ILVD_CAMHC       KKAVENAMVVDMAMGGSSNTILHMLAISREAGC-ALDIKELNEISKKTPHIAKIAPSKPE
ILVD_CAMC5       EKAVRNALVVDMAMGGSSNTVLHMLAISREAGV-NLQISQLNKISQNIAHIAKISPSLPN
ILVD_CAMJE       QKAVRNAMVVDMAMGGSSNTVLHMLAISREAGV-ALDIKDLNFISSKVAHIAKIAPSLNS
ILVD_CAMJR       QKAVRNAMVVDMAMGGSSNTVLHMLAISREAGV-ALDIKDLNFISSKVAHIAKIAPSLNS
ILVD_CAMJD       QKAVRNAMIVDMAMGGSSNTVLHMLAISREAGV-ALDIKDLNFISSKVAHIAKIAPSLNS
ILVD_CAMJJ       QKAVRNAMVVDMAMGGSSNTVLHMLAISREAGV-ALDIKDLNFISSKVAHIAKIAPSLNS
ILVD_CAMJ8       QKAVRNAMVVDMAMGGSSNTVLHMLAISREAGV-ALDIKDLNFISSKVAHIAKIAPSLNS
ILVD_AQUAE       EEALDDAFTVDIAMGGSSNTILHLLAIAREAGI-EYNLAKINEISKRTPTICKISPA-SH
ILVD_BACVZ       EKAIDNAFALDMALGGSTNTVLHTLALANEAGV-EYSLERINEVAERVPHLSKLAPASDV
ILVD_BACSU       VKAIDNAFALDMALGGSTNTVLHTLALANEAGV-EYSLERINEVAERVPHLAKLAPASDV
ILVD_BACP2       EKAIDNAFALDMALGGSTNTVLHTLAIANEAGV-EYSLERINEVAERVPHLSKLAPASDV
ILVD_BACLD       EKAIDNAFALDMALGGSTNTILHTLAIANEAGV-DYSLERINEVAARVPHLSKLAPASDV
ILVD_GEOKA       EKAIDNAFALDMALGGSTNTVLHTLAIANEAGI-DYSLERINEVASRVPHLAKLAPASDV
ILVD_BACAH       EEAIDDAFALDMAMGGSTNTVLHTLALAQEAGL-DYDMNRIDAVSRRVPHLCKVSPASNW
ILVD_BACHK       EEAIDDAFALDMAMGGSTNTVLHTLALAQEAGL-DYDMNRIDAVSRRVPHLCKVSPASNW
ILVD_BACAN       EEAIDDAFALDMAMGGSTNTVLHTLALAQEAGL-DYDMNRIDAVSRRVPHLCKVSPASNW
ILVD_BACC1       EEAIDDAFALDMAMGGSTNTVLHTLALAHEAGL-DYDMSRIDAVSRRVPHLCKVSPASNW
ILVD_BACCZ       EEAIDDAFALDMAMGGSTNTVLHTLALAHEAGL-DYDMSRIDAVSRRVPHLCKVSPASNW
ILVD_BACCR       EEAIDDAFALDMAMGGSTNTVLHTLALAQEAGL-DYDMNRIDAVSRRVPHLCKVSPASNW
ILVD_BACCN       EEAIDDAFALDMAMGGSTNTVLHTLAIAQEAGL-DYDMNRIDAVSRKVPHLCKVSPASNW
ILVD_BACSK       EETIDDAFALDMAMGGSTNTVLHTLAIANEAEI-DYDLTRINEVAERVPYLCKISPASDY
ILVD_BACHD       KETIDDAFALDMAMGGSTNTVLHTLAIANEAEI-EYDLNRINEVAERVPYLCKISPASDY
ILVD_LISMO       KDAIDDAFALDMAMGGSTNTVLHTLALANEAGIEDYDLERINDIAKRVPYLSKIAPSSSY
ILVD_LISMF       KDAIDDAFALDMAMGGSTNTVLHTLALANEAGIEDYDLERINDIAKRVPYLSKIAPSSSY
ILVD_LISW6       KDAIDDAFALDMAMGGSTNTVLHTLALANEAGIEDYDLERINDIAKRVPYLSKIAPSSSY
ILVD_LISIN       KDAIDDAFALDMAMGGSTNTVLHTLALANEAGIEDYDLERINDIAKRVPYLSKIAPSSSY
ILVD_STAAC       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAE       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAA2       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAA9       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAS       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAA1       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAM       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAW       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAN       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAA8       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAT       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAA3       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAB       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAAR       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINAIAKRTPYLSKIAPSSSY
ILVD_STAES       QDAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINEIAKKTPYLSKIAPSSSY
ILVD_STAEQ       QDAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINEIAKKTPYLSKIAPSSSY
ILVD_STAHJ       REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLERINEIAKKTPYLSKIAPSSSY
ILVD1_STAS1      REAIDDAFALDMAMGGSTNTVLHTLAIANEAGI-DYDLTRINEIAKKTPYLSKIAPSSSY
ILVD_LEUMM       KEALDDAMALDMAMGGSTNTVLHVLSIAHEAGI-DYDQADINEIAKKVPYLSKIAPSSKW
ILVD_SYMTH       PEAIDNAFALDIAMGGSTNTVLHTLAVATEAGI-AYPLERINALSARVPYLCKVSPATAE
ILVD_CHLCH       RQALLNAFALDFAMGGSTNTILHTLAIANEAGL-SFDFSELNALSAKTPYICQVSPATMA
ILVD_CHLPD       RKALLNAFALDFAMGGSTNTILHTLAIANEAEL-DFDFSELNALSAKTPYICKVSPATMA
ILVD_PELLD       RSALLNAFALDFAMGGSTNTILHTLAIANEAEL-DFDFSELNGLSAKTPYICKVSPATMD
ILVD_CHLPM       REALLNAFALDFAMGGSTNTILHTLAIANEAEL-DFDFSELNALSARTPYICKVSPATMA
ILVD_CHLTE       RTSMLNAFALDLAMGGSTNTILHTLAIASEAEL-DFDFSELNDLSAKTPYICKVSPATTE
ILVD_BIFAA       KKAFENAMTMDVAMGGSTNTVLHILAMAQSADV-DFTLDDIERISHTVPCICKASPSGE-
ILVD_BIFLO       KEAFENAMTMDVAMGGSTNTVLHILAMAQSADV-DFTLDDIERISHTVPCICKASPSGK-
ILVD_CORGL       KKAFENAMALDMAMGGSTNTILHILAAAQEGEV-DFDLADIDELSKNVPCLSKVAPNS--
ILVD_CORGB       KKAFENAMALDMAMGGSTNTILHILAAAQEGEV-DFDLADIDELSKNVPCLSKVAPNS--
ILVD1_COREF      KKAFENAMALDMAMGGSTNTILHILAAAQEGEV-DFDLADIDALSKRVPCLSKVAPNS--
ILVD_CORDI       KKAFINAMALDMAMGGSTNTVLHTLAAAQEGEI-DFDLSDIDALSHRIPCLSKVAPNG--
ILVD_CORJK       REAFENAMALDMAMGGSSNTVLHILAAAQEGEI-DFDLHSIDQLSREVPCLSKVSPNS--
ILVD3_NOCFA      AKAFRNAMALDVAMGGSTNTVLHTLAAAQEGEI-DFDLETIDEISRKVPCLSKVSPNS--
ILVD_FRACC       AAAFRNAFAVDVAMGGSTNTVLHLLAAAVEAGV-DVTLADIDQISRTVPCLCKVAPSST-
ILVD_SALAI       RAAFENAVALDVAMGGSTNTILHLLAAAREAEL-DFGVADIDTISRRVPCLAKVAPNSP-
ILVD_STRAW       HAAFENAMALDIAMGGSTNTILHLLAAAQEAGV-PFGLDEINEVSRRVPCLAKVAPNVAK
ILVD_STRCO       PAAFGNAMALDIAMGGSTNTILHLLAAAQEAEV-SYGLAEMDALSRSVPCLAKVAPNVAK
ILVD2_NOCFA      RAAFDNAMALDLAMGGSTNTVLHLLAAAHEAGL-DYTLADIEKRSRAVPCLCKVAPN---
ILVD_THEFY       PAAFANAMALDVAMGGSTNTILHLLAAATEAGV-DFGLDDIDALSRRVPCLCKVAPN---
ILVD_BACFR       REAFLNAMTLDIAMGGSTNTVLHLLAIAHEAEA-DFKMDDIDMLSRKSPCLCKVAPNTQ-
ILVD_BACFN       REAFLNAMTLDIAMGGSTNTVLHLLAIAHEAEA-NFKMDDIDMLSRKSPCLCKVAPNTQ-
ILVD_BACTN       RQAFLNAMTLDIAMGGSTNTVLHLLAVAHEAGV-DFKMDDIDMLSRKTPCLCKVAPNTQ-
ILVD_PARD8       RQAFLNAMSLDIAMGGSTNTVLHLLAVAQEAGA-DFHMEDIDMLSRKTPCLCKVAPNTH-
ILVD_BLOFL       KMAFENAAMLDIAMGGSTNTVLHLLAAAQEGEI-SFTMKDIDRLSRKVPHLCKIAPNSD-
ILVD_BLOPB       KSSFENAMMLDIAMGGSTNTVLHLLAAAQEGEI-DFTMADIDKLSRKVPHLCKVAPNTQ-
ILVD_BUCAI       KESFENAMMLDIAMGGSTNTILHLLAAAQEAKV-DFKMSNINKLSKKIPHICKVAPSTS-
ILVD_BUCDN       KESFENAMILDIAMGGSTNTILHLLAAAQEAEI-DFNMSNIDELSRKIPHICKVSPSTS-
ILVD_BUCAP       KESFENAMALDIAMGGSTNTILHLLAAAYEGKV-DFKMSDINNLSKKIPHICKVAPSTN-
ILVD_BUCMH       RQSFLNAMSLDIAMGGSTNTILHLLAIAKEGNI-DFTMSDIDSLSKKVPHLCKISPNST-
ILVD_BUCSC       RESFLNAMSLDISTGGSTNTILHLLAMAQEGQV-DFKMSDIDLLSRKIPNLCKIAPNSD-
ILVD_BUCBP       KEAFCNAMALDIAMGGSTNTVLHLLAAAREGCV-DFTMLDVDLLSRKIPNLCKLSPNTT-
ILVD_BUCCC       KENLKNAIILDISMGGSSNTVLHLLAMAYEANI-NFKMIDIDLLSRKVPHLCKISPSSS-
ILVD_ACTP2       KAAFENAMSLDIAMGGSTNTVLHLLAAAQEAEV-DFTMADIDRLSRKVPCLSKVAPNTN-
ILVD_MANSM       KAAFENAMSLDIAMGGSTNTVLHLLAVAQEAEV-DFTMADIDRLSRIVPCLSKVAPNTN-
ILVD_HAES1       KEAFDNAMSLDIAMGGSTNTVLHLLAAAQEAEV-NFTMADIDRLSRVVPCLSKVAPNTQ-
ILVD_HISS2       KEAFDNAMSLDIAMGGSTNTVLHLLAAAQEAEV-NFTMADIDRLSRVVPCLSKVAPNTQ-
ILVD_PASMU       KKAFENAMSLDIAMGGSTNTVLHLLAAAQEAEV-DFTMADIDRLSRQVPCLSKVAPNTQ-
ILVD_HAEI8       FDAFENAMSLDIAMGGSSNTVLHLLAAAQEAGV-DFKMEDIDRLSRKVPCLSKIAPNTN-
ILVD_HAEIG       FDAFENAMSLDIAMGGSSNTVLHLLAAAQEAGM-DFKMEDIDRLSRKVPCLSKIAPNTN-
ILVD_HAEIN       FDAFENAMSLDIAMGGSSNTVLHLLAAAQEAGV-DFKMEDIDRLSRKVPCLSKIAPNTN-
ILVD_HAEIE       FKAFENAMSLDIAMGGSSNTVLHLLAAAQEAGV-DFKMEDIDRLSRKVPCLSKIAPNTN-
ILVD_ACTSZ       FEAFENAMSLDIAMGGSSNTVLHLLAVAQEAGV-DFKMADIDRLSRVVPCLSKIAPNTN-
ILVD_AERHH       KAAFENAMALDIAMGGSTNTVLHLLAAAQEAGV-DFTMADIDRMSRKVPQLCKVAPSTQ-
ILVD_AERS4       KAAFENAMALDIAMGGSTNTVLHLLAAAQEAGV-DFTMADIDRMSRKVPQLCKVAPSTQ-
ILVD_VIBCH       KAAFENAIALDIAMGGSTNTVLHLLAAAQEGEV-EFDMTDIDRMSRQVPHLCKVAPSTQ-
ILVD_VIBC3       KAAFENAIALDIAMGGSTNTVLHLLAAAQEGEV-EFDMTDIDRMSRQVPHLCKVAPSTQ-
ILVD_VIBVU       KAAFENAMALDIAMGGSTNTVLHLLAAAQEGEV-DFDMTDIDRMSRMVPHLCKVAPSTQ-
ILVD_VIBVY       KAAFENAMALDIAMGGSTNTVLHLLAAAQEGEV-DFDMTDIDRMSRMVPHLCKVAPSTQ-
ILVD_VIBPA       KAAFENAMALDIAMGGSTNTVLHLLAAAQEGEV-DFDMTDIDRMSRQVPHLCKVAPSTQ-
ILVD_ALIF1       RAAFENAMALDIAMGGSSNTVLHLLASAQEGEI-DFDMGDIDEMSRRVPHLCKVAPSTP-
ILVD_PHOPR       KKAFENAMALDIAMGGSTNTVLHLLAAAKEGDI-DFDMDDIDRMSRLIPHLCKVAPSTP-
ILVD_ECOLC       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECOHS       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECO24       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SHIF8       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SHISS       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SHIFL       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECOLI       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SHIBS       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECO57       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SHIDS       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECOUT       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECOK1       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECOL5       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ECOL6       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SALPB       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SALTY       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SALCH       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SALPA       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_SALTI       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_KLEP7       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTQ-
ILVD_ENT38       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMSDIDKLSRKVPQLCKVAPSTP-
ILVD_YERPE       KAAFENAMILDIAMGGSTNTVLHLLAAAQEGEI-DFSMTDIDHLSRKVPHLCKVAPSTQ-
ILVD_YERPA       KAAFENAMILDIAMGGSTNTVLHLLAAAQEGEI-DFSMTDIDHLSRKVPHLCKVAPSTQ-
ILVD_YERPN       KAAFENAMILDIAMGGSTNTVLHLLAAAQEGEI-DFSMTDIDHLSRKVPHLCKVAPSTQ-
ILVD_YERPP       KAAFENAMILDIAMGGSTNTVLHLLAAAQEGEI-DFSMTDIDHLSRKVPHLCKVAPSTQ-
ILVD_YERP3       KAAFENAMILDIAMGGSTNTVLHLLAAAQEGEI-DFSMTDIDRLSRKVPHLCKVAPSTQ-
ILVD_YERPS       KAAFENAMILDIAMGGSTNTVLHLLAAAQEGEI-DFSMTDIDRLSRKVPHLCKVAPSTQ-
ILVD_YERE8       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEGDI-DFDISDIDRLSRKVPHLCKVAPSTQ-
ILVD_PECAS       KAAFENAMILDIAMGGSTNTVLHLLAAAQEGEI-DFTMSDIDRLSRKVPHLCKVAPSGQ-
ILVD_SODGM       KAAFENAMTLDIAMGGSTNTVLHLLAAAQEGEV-DFTMADIDRLSRKVPHLCKVAPSTQ-
ILVD_PHOLL       KAAFENAMMLDIAMGGSTNTVLHLLAAAQEGEV-DFTMADIDRLSRQIPHLCKVAPSTQ-
ILVD_COLP3       KEALHNAMCLDIAMGGSTNTILHLLATAQEAEI-DYTMEDMDKLSRIVPQLCKVAPSTP-
ILVD_PSYIN       REAFENAMALDIAMGGSTNTILHLLACAQEAEL-DYTVADMDEMSRRIPQLCKVAPSTP-
ILVD_SHEB5       FKAFENAMTLDIAMGGSSNTVLHLLAAAQEADV-DFTMADIDRMSRLVPHLCKVAPSTP-
ILVD_SHEB9       FKAFENAMTLDIAMGGSSNTVLHLLAAAQEADV-DFTMADIDRMSRLVPHLCKVAPSTP-
ILVD_SHEB8       FKAFENAMTLDIAMGGSSNTVLHLLAAAQEADV-DFTMADIDRMSRLVPHLCKVAPSTP-
ILVD_SHEPC       FKAFENAMTLDIAMGGSSNTVLHLLAAAQEADV-DFTMADIDRMSRLVPHLCKVAPSTP-
ILVD_SHESW       FKAFENAMTLDIAMGGSSNTVLHLLAAAQEADV-DFTMADIDRMSRLVPHLCKVAPSTP-
ILVD_SHESM       FKAFENAMALDIAMGGSSNTVLHLLAAAQEADV-AFTMDDIDRMSRQVPHLCKVAPSTA-
ILVD_SHESR       FKAFENAMALDIAMGGSSNTVLHLLAAAQEADV-AFTMDDIDRMSRQVPHLCKVAPSTA-
ILVD_SHESA       FKAFENAMALDIAMGGSSNTVLHLLAAAQEADV-AFTMDDIDRMSRQVPHLCKVAPSTA-
ILVD_SHEON       FKAFENATALDIAMGGSSNTVLHLLAAAQEAEV-AFTMDDIDRMSRLVPHLCKVAPSTP-
ILVD_SHEDO       FKAFENATALDIAMGGSSNTVLHLLAAAQEAEV-DFTMADIDRISRKVPHLCKVAPSTP-
ILVD_SHEFN       FKSFENAMVLDVAMGGSSNTVLHLVAAAQEAEI-DFTMADIDRISRLVPHLCKVAPSTP-
ILVD_SHELP       FKAFENAMALDIAMGGSSNTVLHLLAAAQEAKV-DFTMADIDRLSRQVPHLCKVAPSTP-
ILVD_SHEAM       FKAFENAMALDVAMGGSSNTVLHLLAAAQEAEV-DFTMDDIDRISRKVPHLCKVAPSTP-
ILVD_SHEHH       FKAFENAMTLDIAMGGSSNTVLHLLASAQEGEV-DFTMDDIDRLSRLVPHLCKVAPSTP-
ILVD_SHEPA       FKAFENAMTLDIAMGGSSNTVLHLLAAAQEAEV-DFTMDDIDRLSRLVPHLCKVAPATP-
ILVD_SHESH       FNAFENAMTLDIAMGGSSNTVLHLLAAAQEGEV-DFTMEDIDRLSRLVPHLCKVAPSTP-
ILVD_PSEA6       FKAFENAMSLDIAMGGSTNTILHLLAAAVEGEV-PFTLDDIDRLSRNVPHLCKVAPSTP-
ILVD1_PSEHT      KTAFMNAMVVDIAMGGSSNTVLHLLAAAQEAGV-DFDMSHIDALSRKTPFLCKVAPATP-
ILVD1_BURL3      FKAFENAMTLDIAMGGSTNTILHLLAIAQEAGI-DFTMKDIDRLSRVVPQLCKVAPNTN-
ILVD_BURVG       FNAFENAMTLDIAMGGSTNTILHLLAIAREAGI-DFTMRDIDRLSRVVPQLCKVAPNTN-
ILVD2_CUPPJ      FKAFENAMTLDIAMGGSTNTILHLLAIAQEAGI-DFSMNDIDRLSRVVPQLCKVAPNTN-
ILVD_ACIAC       FKAFENAMTLDIAMGGSTNTILHLLAIAQEAGI-DFTMADIDRLSRVVPQLCKVAPNTN-
ILVD_MARMS       FEAFENAMTLDIAMGGSTNTILHLLAIAREAGV-DFSMEDIDRLSRKVPQLCKVAPNSP-
ILVD_SACD2       KAAFENAITLDIAMGGSTNTILHLLAIAQEAEL-DFTMEDIDRISRYVPQLCKVAPNTQ-
ILVD_PSEAE       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEV-PFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEAB       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEV-PFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEA7       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEV-PFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEMY       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEL-AFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEU5       RKAFENAMTLDIAMGGSTNTILHLLAAAQEAEV-DFDLRDIDALSRKVPQLCKVAPNIQ-
ILVD_PSEP1       FKAFENAMMLDIAMGGSTNTILHLLAAAQEGEV-AFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEPK       FKAFENAMMLDIAMGGSTNTILHLLAAAQEGEV-AFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEPG       FKAFENAMMLDIAMGGSTNTILHLLAAAQEGEV-EFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEE4       FKAFENAMMLDIAMGGSTNTILHLLAAAQEAEV-DFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEPF       FKAFENAMMLDIAMGGSTNTILHLLAAAQEAEI-DFDLRDIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEF5       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEI-DFDLRDIDRLSRHVPQLCKVAPNIQ-
ILVD_PSE14       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEI-DFDLRHIDRLSRKVPQLCKVAPNIQ-
ILVD_PSEU2       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEI-DFDLRHIDHLSRKVPQLCKVAPNIQ-
ILVD_PSESM       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEI-DFDLHHIDRLSRKVPQLCKVAPNIQ-
ILVD_XANAC       FEAFENAMTLDIAMGGSTNTILHLLAAAQEGEV-AFGMQDIDRLSKRVPQLCKVAPNTP-
ILVD_XANC5       FEAFENAMTLDIAMGGSTNTILHLLAAAQEGEV-AFGMHDIDRLSKRVPQLCKVAPNTP-
ILVD_XANOR       FEAFENAMTLDIAMGGSTNTILHLLAAAQEGEV-PFGMQDIDRLSKRVPQLCKVAPNTP-
ILVD_XANOM       FEAFENAMTLDIAMGGSTNTILHLLAAAQEGEV-PFGMQDIDRLSKRVPQLCKVAPNTP-
ILVD_XANCP       FEAFENAMTLDIAMGGSTNTILHLLAAAQEGEV-PFGMRDIDRLSKRVPQLCKVAPNTP-
ILVD_XANC8       FEAFENAMTLDIAMGGSTNTILHLLAAAQEGEV-PFGMRDIDRLSKRVPQLCKVAPNTP-
ILVD_XYLFA       FAAFENAITLDIAMGGSTNTILHLLAAAQEAEV-PFTMQDIDRLSRNVPQLCKVAPNTQ-
ILVD_XYLFT       FAAFENAITLDIAMGGSTNTILHLLAAAQEAEV-SFTMQDIDRLSRNVPQLCKVAPNTQ-
ILVD_HAHCH       FKAFENAMTLDIAMGGSTNTILHLLAAAQEAEV-DFSMTHIDHLSRKVGQFCKVAPNTP-
ILVD_RHORT       FKAFENAMSVDIAMGGSTNTVLHLLAAAQEGEV-PFTMADIDRLSRRIPHLCKVSPSTA-
ILVD_HYDCU       VEAFENAMALDVAMGGSTNTVLHLLAIAREAEV-NFTMADMDRISRNVPCLVKVAPNSK-
ILVD_CAUVC       RAAFENAMSLDIAMGGSTNTVLHLLAAAHEGGI-DFSMADIDRLSRHVPCLSKVAPAKS-
ILVD_GRABC       HAAFENAMSLDIAMGGSTNTVLHLLAAAQEAGV-DFTMADIDRLSRRVPCLCKVAPAKS-
ILVD_ZYMMO       LEAFENAMSLDIAMGGSTNTVLHLLAVAQEGNV-PFTMADIDRLSRHVPCLCKVAPAKN-
ILVD_GLUOX       RAAFENAMTLDIAMGGSTNTVLHLLAAAREGEV-DFHMHDIDRLSRRVPNLCKVAPAKN-
ILVD_AZOSB       FAAFENAISLDVAMGGSTNTVLHLLAAAKEAGV-DFTMKDIDRISRHVPCLCKVAPAVP-
ILVD2_AROAE      FQAFENAITLDVAMGGSTNTVLHLLAAAREAGV-DFTMADIDRISRKVPCLCKVAPAVA-
ILVD_DECAR       KAAFENAMTLDVAMGGSTNTVLHILATAQEAGV-DFTMADIDRISRSVPCLCKVAPMTD-
ILVD1_BORBR      KSAFENAMTLDVAMGGSTNTVLHLLAAAQEAGV-DFTMSDIDRISRRVPCLCKAAPATD-
ILVD1_BORPA      KSAFENAMTLDVAMGGSTNTVLHLLAAAQEAGV-DFTMSDIDRISRRVPCLCKAAPATD-
ILVD1_BORPE      KSAFENAMTLDVAMGGSTNTVLHLLAAAQEAGV-DFTMSDIDRISRRVPCLCKAAPATD-
ILVD_BORA1       KAAFENAMSLDVAMGGSTNTVLHLLAAAQEAGV-DFTMADIDRISRKVPCLCKAAPATD-
ILVD_NEIMA       KKAFENAMTMDIAMGGSTNTILHLLAVANEAGV-DFKMADIDRLSRVVPCICKTAPNNH-
ILVD_NEIMF       KKAFENAMTMDIAMGGSTNTILHLLAVANEAGV-DFKMADIDRLSRVVPCICKTAPNNH-
ILVD_NEIMB       KKAFENAMTMDIAMGGSTNTILHLLAVANEAGV-DFKMADIDRLSRVVPCICKTAPNNH-
ILVD_NEIG1       KKAFENAMTMDIAMGGSTNTILHLLAVANEAGV-DFKMADIDRLSRVVPCICKTAPNNH-
ILVD_PSYA2       KAAFENAMTLDIAMGGSTNTILHLLAAANEAEV-DFKMHDIDRLSRGVPCLAKVAPASQ-
ILVD_CHRVO       KQAFENAMSLDVAMGGSTNTVLHLLAAASEAGV-DFKMADIDRISRGVPCLSKVAPATQ-
ILVD_METFK       FKAFENAMSLDVAMGGSTNTVLHLLAAAHEAEV-DFTMADIDRISRGVPCICKVAPATA-
ILVD_SYNP6       FKAFENAICLDIAMGGSTNTVLHLLAAAHEAGV-DFTMKDIDRLSRKIPNLCKVAPSTQ-
ILVD_SYNE7       FKAFENAICLDIAMGGSTNTVLHLLAAAHEAGV-DFTMKDIDRLSRKIPNLCKVAPSTQ-
ILVD_NITOC       FGAFENAMSLDIAMGGSTNTVLHLLAAAQEGGV-DFTMADIDRLSRKVPNLCKVAPATP-
ILVD_NOVAD       FEAFENAMSLDIAMGGSTNTVLHLLAAAHEAGV-NFTMSDIDHLSRKVPCLSKVAPAKS-
ILVD_SPHAL       FEAFENAMSLDIAMGGSTNTVLHLLAAAHEAGV-DFTMEDIDRLSRRVPCLSKVAPAKS-
ILVD1_ACIAD      KAAYENAMTLDIAMGGSTNTVLHLLAAASEAEV-DFTMDDIDRLSRNVPVLCKVAPAKQ-
ILVD_DEIRA       YDAFENAMTLDISMGGSTNTVLHLLAAAHEAGV-DFTMQDIDQLSRRVPVLCKVAPAKN-
ILVD_RHIEC       KQAFENAMALDIAMGGSTNTVLHILAAAHEGEV-DFTMADIDALSRRVPCLSKVAPAKS-
ILVD_RHIL3       KQAFENAMTLDIAMGGSTNTVLHILAAAHEGEI-DFTMADIDALSRRVPCLSKVAPAKS-
ILVD_RHIME       KQAFENAMALDIAMGGSTNTVLHILAAAYEGEI-DFTMDDIDRLSRKVPCLSKVAPAKA-
ILVD_SINMW       KQAFENAMALDIAMGGSTNTVLHILAAAYEGEI-DFTMDDIDRLSRKVPCLSKVAPAKA-
ILVD_AGRFC       KAAFENAMSLDIAMGGSTNTVLHILAAAHEGGV-DFGMEDIDRLSRKVPCLSKVAPAKQ-
ILVD1_RHILO      KGAFENAMTLDIAMGGSTNTVLHILAAAHEGEV-DFTMEDIDRLSRRVPVLCKVAPAKS-
ILVD_BRUAB       FSAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPAVS-
ILVD_BRUA2       FSAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPAVS-
ILVD_BRUO2       FSAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPAVS-
ILVD_BRUC2       FSAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPAVS-
ILVD_BRUSU       FSAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPAVS-
ILVD_BRUME       FSAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPAVS-
ILVD_BRUSI       FSAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPAVS-
ILVD_OCHA4       FPAFENAMTLDIAMGGSTNTVLHLLAAAQEAEI-DFTMADIDRLSRRVPVLCKVAPANN-
ILVD_RHOP5       FAAFENAMSLDIAMGGSTNTVLHLLAAAQEGEV-NFTMTDIDRLSRRVPCLCKVAPSVA-
ILVD_NITHX       FKAFENAMTLDISMGGSTNTVLHLLAAAYEGEV-PFTMKDIDRLSRRVPVLCKVAPSVV-
ILVD_NITWN       FKAFENAMTLDISMGGSTNTVLHLLAAAYEGEV-PFTMADIDRLSRRVPVLCKVAPSVA-
ILVD_AZOC5       FKAFENAMTLDISMGGSTNTVLHLLAAANEGEV-PFTMADIDRLSRKVPVLCKVAPAVA-
ILVD_RHOPA       FKAFENAMTLDIAMGGSTNTVLHLLAAAREAEL-DFSMKDIDRLSRRVPCLSKIAPSVS-
ILVD_RHOP2       FEAFENAMTLDIAMGGSTNTVLHLLAAAREAEL-DFSMKDIDRLSRKVPCLSKIAPSVS-
ILVD1_BRADU      FKAFENAMTLDIAMGGSTNTVLHLLAAAHEGQV-AFTMKDIDRLSRRVPVLCKVAPSVA-
ILVD_BARHE       RKAFENAMTVDISMGGSTNTVLHLLAAAQEGEV-DFTMTEIDRLSRRVPVLCKVAPAVA-
ILVD_BART1       RKAFENAMTVDIAMGGSTNTVLHLLAAAQEGEV-DFTMTDIDHLSRRVPVLCKVAPAVA-
ILVD_RHOS4       KEAFENAMALDIAMGGSTNTVLHILAAAQEGGV-DFTMDDIDALSRRVPCLCKVAPNKA-
ILVD_RHOS1       KEAFENAMALDIAMGGSTNTVLHILAAAQEGGV-DFTMDDIDALSRRVPCLCKVAPNKA-
ILVD_PARDP       KAAFLNAMSLDIAMGGSTNTVLHLLAIAQEGGV-DFTMDDIDALSRKVPCLCKVAPNTA-
ILVD_RUEPO       FEAFENAMSLDIAMGGSTNTVLHLLAIAHEGEV-DFTMTDMDRLSRKVPCLCKVAPNTA-
ILVD_RUEST       FEAFENAMSLDIAMGGSTNTVLHLLAIAHEGKV-DFTMQDIDRLSRKVPCLCKVAPNIE-
ILVD_HYPNA       KAAFENAITLDIAMGGSTNTILHLLAMAREGEV-DFTLADIDRLSRVTPCLCKVAPAVQ-
ILVD_MAGSA       FQAFENAMTLDIAMGGSTNTVLHLLAAAQEAGV-AFGMSDIDRLSRRVPCLCKVAPNVP-
ILVD_ACICJ       FKAFENAMSLDIAMGGSTNTVLHLLAAAREAEL-DFTMADIDRLSRRVPNLCKVSPSVS-
ILVD_MAGMM       FAAFENAMVLDIAMGGSTNTVLHLLAAAREAEV-NFTMADIDRLSRGVPCLCKVAPSTE-
ILVD_NOSS1       RKSIENAISVIMAVGGSTNAVLHFLAIARAAGV-ELNLDDFETIRGRVPVLCDLKPSGR-
ILVD_TRIEI       RKAIENAISVIMAVGGSTNAVLHLLAIAYAANV-KLSLDDFEIIRARVPVLCDLKPSGK-
ILVD_ACAM1       RKAFENAIAVIMAVGGSTNAVLHLLAISRAAGD-SLTLDDFETIRAQVPVICDLKPSGR-
ILVD_MICAN       RKAFENAISVIMAVGGSTNAVLHLLAISRTIGV-ELSIDDFETIRQRVPVICDLKPSGR-
ILVD_SYNY3       RKAFENAIAVIMAVGGSTNAVLHLLAIANTIGV-PLSLDDFETIRHKVPVLCDLKPSGK-
ILVD_THEEB       RKSIENAISVIMAVGGSTNAVLHFLAIAHSAEV-PLTIDDFETIRQRVPVLCDLKPSGK-
ILVD_SYNJB       RKSIENAISVIMAVGGSTNAVLHFLAIAHAAEV-PLTLDDFETIRARVPVLCDLKPSGR-
ILVD_SYNJA       RQSIENAISVIMAVGGSTNAVLHFLAIAHAAEV-PLTLDDFETIRARVPVLCDLKPSGR-
ILVD_GLOVI       RKAFENAIAVIMAIGGSTNAVLHLLAIAHSARV-PLALDDFECIRARVPVLCDLKPSGR-
ILVD_NITEU       RKSIENAVSVVMAVGGSTNAVLHLLAIAHAAEV-EFSIDDFEAIRARVPVLCDLKPSGR-
ILVD_NITEC       RKSLENAVTVVMAVGGSTNAVLHLLAIAHAAEV-DFHIDDFEAIRARVPVLCDLKPSGR-
ILVD_NITMU       RKSIENAIAVIMAVGGSTNAVLHFLAIAHAAEV-TLTIDDFERMRGKVPVLCDLKPSGR-
ILVD_CHLAA       RKSLENAIAVVMALGGSTNAVLHLLAIAHAADV-PLTIDDFETIRQRVPVLCDLKPSGR-
ILVD_DEIGD       KKAFENAITVVMAVGGSTNAVLHLMAIAHACGV-DLTLEDFERIRERTPVFCDLKPSGK-
ILVD_HALHL       REAFENAFAVVMALGGSTNAVLHLLAIANTAEV-PFDLDDVERIRRKVPVLCDLKPSGR-
ILVD_PROMS       KKAFENAISVIMAIGGSTNAVLHILAIANTAGI-DININDFERIRQKVPVICDLKPSGK-
ILVD_PROM9       KKAFENAISVIMAIGGSTNAVLHILAIANTAGI-DININDFERIRQKVPVICDLKPSGK-
ILVD_PROM0       KKAFENAISVIMAIGGSTNAVLHILAIANTAGI-DININDFERIRQKVPVICDLKPSGK-
ILVD_PROM2       KKAFENAISVIMAVGGSTNAVLHILAIANTAGI-DINIDDFERIRQKVPVICDLKPSGK-
ILVD_PROM5       KESFENAISVIMAIGGSTNAVLHILAIANTAGI-EINIDDFERIRQKVPVICDLKPSGR-
ILVD_PROMP       KESFENAITVIMAIGGSTNAVLHILAIANTAGI-DINIDDFERIRQKVPVICDLKPSGK-
ILVD_PROMA       KQAFENAISVVMAVGGSTNAVLHLLAIAHSSGV-ELSLDEFEKIRQRVPVLCDLKPSGK-
ILVD_PROM3       KNAFENAISVVMAVGGSTNAVLHLLAIARSAGV-DLCIDDFERIRQRVPVICDLKPSGR-
ILVD_PROMM       KNAFENAISVVMAVGGSTNAVLHLLAIARSAGV-DLCIDDFERIRQRVPVICDLKPSGR-
ILVD_SYNSC       KEAFENAISVIMAVGGSTNAVLHLLAIARTAGV-DLSIDDFERIRQRVPVICDLKPSGR-
ILVD_SYNPX       NDAFENAISVIMAVGGSTNAVLHLLAIARTAGV-SLSIDDFERIRQRVPVICDLKPSGR-
ILVD_SYNS9       TEAFENAISVIMAVGGSTNAVLHLLAIARTAGV-DLSIDDFERIRQRVPVICDLKPSGR-
ILVD_SYNR3       REAFENAISVIMAVGGSTNAVLHLLAIARTAGV-PLSIDDFETIRQRVPVICDLKPSGR-
ILVD_PROMT       KEAFENAISVIMAVGGSTNSVLHLLAIARTAGV-DLTIDDFERIRQTVPVICDLKPSGK-
ILVD1_AROAE      REAIENAVSVIMATGGSTNAVLHFLAIAHAAEV-PWTIDDFERIRRRVPVIVDMKPSGR-
ILVD3_AROAE      REAIENAVSVIMATGGSTNAVLHFLAIAHAAEV-PWTIDDFECIRRRVPVIVDMKPSGH-
ILVD3_BORBR      RASIENAVAVIMATGGSTNAVLHFLAIAHAAEV-PWNIDDFERIRKRVPVICDLKPSGK-
ILVD2_BORPA      RASIENAVAVIMATGGSTNAVLHFLAIAHAAEV-PWNIDDFERIRKRVPVICDLKPSGK-
ILVD2_BORPE      LASIENAVAVIMATGGSTNAVLHFLAIAHAAEV-PWNIDDFERIRKRVPVICDLKPSGR-
ILVD_BURMA       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURM9       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURM7       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURMS       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURPS       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURP6       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURP1       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURP0       KQSIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD_BURTA       KQAIENAVSVIMATGGSTNAVLHYLAIAHAAEI-DWSIEDFERIRKRVPVICDLKPSGQ-
ILVD2_BURL3      KESIENAVSVIMATGGSTNAVLHYLAIAHAAEV-DWTIEDFERIRKRVPVICDLKPSGK-
ILVD1_CUPPJ      RKSIENAVALIMATGGSTNAVLHYLAIAHSAEV-EWTIDDFERIRRKVPVICNLKPSGQ-
ILVD_RALSO       RKSIENAVAVIMATGGSTNAVLHYLAIAHAAGV-EWTIDDFERVRQRVPVICNLKPSGQ-
ILVD_HERAR       RKAIENAVAVIMATGGSTNAVLHFLAIAHAAEI-DWTIDDFERMRKKVPVICDLKPSGK-
ILVD_JANMA       RKAIENAVAVIMATGGSTNAVLHFLAIAHAAEV-EWTIDDFERMRKKVPVICDLKPSGK-
ILVD_POLNA       KKSIENAVAVIMATGGSTNAVLHFLAIAHAAGV-EWTIDDFERVRQKTPVLCNLKPSGQ-
ILVD_POLSJ       KKAIENAVAVIMATGGSTNAVLHFLAIAHAAGV-DWTIDDFERVRQRTPVLCDLKPSGK-
ILVD_RHOFT       RKSIENAIAVVMAIGGSTNAVLHFLAIAHAAGV-EWTIDDFERVRQKTPVLCDLKPSGK-
ILVD_VEREI       RKAIENAVAVIMATGGSTNAVLHFLAIAHAAGV-PWSIDDFERVRQKTPVLCDLKPSGK-
ILVD_METPP       RKSIENAVAVIMATGGSTNAVLHFLAIAHAAGV-EWTIDDFERVRRKVPVLCDLKPSGR-
ILVD_TREPR       HRSIRNAMAVVMAVGGSTNAVLHYLAIAAAARS-ALSLHDVELIRRRVPVICNMKPSGL-
ILVD_CHRSD       RKAFENAITVVIALGGSTNAVLHLIAMANTIGV-ELSLDDFTEIGKRVPVLADLRPSGH-
ILVD2_PSEHT      KKAFENAITLIITLGGSTNAVLHLIAMADAVGV-EVTLDDFVRIGDKTPVIADLRPSGQ-
ILVD2_ACIAD      KAAFENAIKVVIALGGSTNAVLHLIAMAHTAEV-KLDLDDFVRIGQETPVVADLRPSGK-
ILVD_METCA       KKAFENAITVVIALGGSTNAVLHLLAMANACGV-DLKLDDFTRIGRKVPMLADLKPSGR-
ILVD_RUTMC       MKAFENAITVIIALGGSTNAVLHLIAMASAAEV-NLKIDDFTRIGQKVPVIADLKPSGK-
ILVD_LACLS       KEAFENAITIVMVLGGSTNAVLHIIAMANAIGV-EITQDDFQRISDVTPVLGDFKPSGK-
ILVD_LACLA       KEAFENAITIVMVLGGSTNAVLHIIAMANAIGV-EITQDDFQRISDITPVLGDFKPSGK-
ILVD_CYTH3       FEAFENAIRVILVLGGSTNAVMHLIAIAKAAGV-KLTIDDFQRIGNTTPLLADLKPSGK-
ILVD_FRATN       RKAFENAMVLITVMGGSTNAVLHLLAMASSVDV-DLSIDDFQEIANKTPVLADFKPSGK-
ILVD_FRATT       RKAFENAMVLITVMGGSTNAVLHLLAMASSVDV-DLSIDDFQEIANKTPVLADFKPSGK-
ILVD_FRAP2       RKAFENAMVLITVMGGSTNAVLHLLAMASSVDV-DLNIDDFQEIANKTPVLADFKPSGK-
ILVD_RHOBA       RGAFEDAMVTLMALGGSTNAVLHLIAMARSVDV-PLTIEDFQSVSDRTPFLADLKPSGK-
ILVD_LEPBJ       KKAFENAITVVLVLGGSTNAVLHLIAIAKEIGV-DLTLEDFDRISKKTPHLADLKPGGR-
ILVD_LEPBL       KKAFENAITVVLVLGGSTNAVLHLIAIAKEIGV-DLTLEDFDRISKKTPHLADLKPGGR-
ILVD_LEPIN       KKAFENAITVVLVLGGSTNAVLHLIAIAKEIGV-GLTLDDFDRISKKTPHLADLKPGGK-
ILVD_LEPIC       KKAFENAITVVLVLGGSTNAVLHLIAIAKEIGV-GLTLDDFDRISKKTPHLADLKPGGK-
ILVD_STRPN       REAFEDAITVTMALGGSTNATLHLLAIAHAANV-DLSLEDFNTIQERVPHLADLKPSGQ-
ILVD_STRR6       REAFEDAITVTMALGGSTNATLHLLAIAHAANV-DLSLEDFNTIQERVPHLADLKPSGQ-
ILVD_STRP2       REAFEDAITVTMALGGSTNATLHLLAIAHAANV-DLSLEDFNTIQERVPHLADLKPSGQ-
ILVD_STRT2       REAFEDAITVTMALGGSTNATLHLLAIAHAANV-DLTLEDFNDFQERVPHLADLKPSGQ-
ILVD_STRT1       REAFEDAITVTMALGGSTNATLHLLAIAHAANV-DLTLEDFNDFQERVPHLADLKPSGQ-
ILVD_STRSY       REAFEDAITVTMALGGSTNATLHLLAIAHAANV-DLTLEDFNDFQERVPHLADLKPSGK-
ILVD_STRS2       REAFEDAITVTMALGGSTNATLHLLAIAHAANV-DLTLEDFNDFQERVPHLADLKPSGK-
ILVD_STRSV       REAFEDAITVTMALGGSTNATLHLLAMAHAANV-ELTLDDFNVIQEKVPHLADLKPSGQ-
ILVD_STRMU       REAFEDAITVTMALGGSTNSTLHLLAIAHAANV-ELTLDDFNTFQEKVPHLADLKPSGQ-
ILVD_OCEIH       KKAFENAITVVMALGGSTNAILHLLAVSHAAEV-DLTIDDFNRIQKKVPHLADLKPSGR-
ILVD2_STAS1      KEAFENAITVVMALGGSTNAILHLLAIAHTIEV-DLTLDDFEKIRKRVPHIADLRPSGK-
ILVD_ROSCS       RAAFENAIASVALTGGSTNAVLHLLALAREAGV-PLTLDDFDTISRRTPLCCDLMPSGK-
ILVD_ROSS1       RAAFENAIASVALTGGSTNAVLHLLALAREAGV-PLTLDDFDAISRRTPLCCDLMPSGK-
ILVD_KORVE       RKAIENAIASVAASGGSTNAVLHLLAIAHEMDV-ELNIEDFDKISSRTPLLCELKPAGR-
ILVD_THET2       RKSFLNAVAAVAATGGSTNAVLHLLALAKEAGV-ELSLDDFDQISRKTPVIADLRPWGT-
ILVD_THET8       RKSFLNAIAAVAATGGSTNAVLHLLALAKEAGV-ELSLDDFDQISRKTPVIADLRPWGT-
ILVD_HALMA       RESFENAIALQVAVGGSTNAVLHLLALAAEAGI-DLDIETFNEISARTPKIADLQPGGE-
ILVD_NATPD       RTSFENAIALQTAMGGSTNAVLHLLALAAEAGI-DLDIEDFDAISRRTPKIADLQPGGD-
ILVD2_BORBR      RASLENACAAVAATGGSTNAALHIPAIAHEAGI-AFTLDDVARVFKRTPLIADLQPGGR-
ILVD3_BRADU      RKSLENGAAIVAATGGSTNAALHLPAIANEAGI-AFTIDDVGEVFARTPLIGNLRPGGK-
ILVD2_BRADU      RKALENAAAVVAASGGSTNAALHLPAIAHECGI-KFDLFDVAEIFKKTPYVADLKPGGR-
ILVD2_RHILO      LKALENAATVVSATGGSTNAALHLPAIAHEAGI-KFDLFDVARIFEKTPYIADLKPGGK-
ILVD_PARL1       RKALENAAVIVAATGGSTNGGLHLPAIAHEAGI-DFDLMEVAEIFKKTPYITDLKPGGN-
ILVD_PELUB       KKSLENAATIVAATGGSTNAALHLPAIANEIGI-KFDLMDVAKIFKKTPYLADLKPGGK-
ILVD_DINSH       RKSLENAARIVACTGGSTNAGLHLPAIAHEAGI-EFTLQDVCDIFRDTPYFVDLKPGGK-
ILVD_PYRAR       YDALYNAAVTLFATAGSTNAILHLLAIAHEANV-KFTLDDFDEISRRVPVIAALRPAGP-
ILVD_PYRIL       YDAIYNAAVTLFATAGSTNAILHLLAIAYEAGV-KFTLDDFDEISRRVPVIAALRPAGP-
ILVD_PYRAE       YDALYNAAVTLFATAGSTNAILHLLAIAHEAGV-KFTLDDFDEISKKVPVIAALRPAGP-
ILVD_PYRCJ       YDALYNAAVALFATAGSTNAILHLLAIAHEAGV-KFALEDFDKIGKRVPVIAALRPAGP-
ILVD_AERPE       YEAFYNAIVTLMAISGSTNAVLHLLAIAREAGV-KLALDDFDEASRKVPVIAALAPAGK-
ILVD_METS5       FEAFENGIALLMASGGSTNGVLHLLAIAHEAGV-SLTLDDFDRISKKVPEIVNMKPGGD-
ILVD_SULTO       FEAFENAITVLMASGGSTNAVLHLLAIAYEAGV-KLTLDDFDRISQRTPEIVNMKPGGE-
ILVD_PICTO       YEAFENAITLLMASGGSTNVVLHLLAIAHEAHV-NIKLDDFDRIGNKVPEIVNMKPGGP-
ILVD_SULAC       FEAFENAIAVLMAMGGSTNAVLHLLAIAYEAGV-KLTLDDFNRISKRTPYIGSLKPGGD-
ILVD_SACS2       FEAFENAITTLMAMGGSTNAVLHLLAIAYEAGV-KLTLDDFNRISKRTPYIASMKPGGD-
ILVD_MYCA1       KEAFENAIAVVMAFGGSTNAVLHLLAIAHEADV-ALSLDDFSRIGSKVPHLADVKPFGR-
ILVD_MYCPA       KEAFENAIAVVMAFGGSTNAVLHLLAIAHEADV-ALSLDDFSRIGSKVPHLADVKPFGR-
ILVD_MYCUA       REAFENAIAVVMAFGGSTNAVLHLLAIAHEANV-ELTLDDFSRIGSKVPHLADVKPFGR-
ILVD_MYCBO       KEAFENAIAVVMAFGGSTNAVLHLLAIAHEANV-ALSLQDFSRIGSGVPHLADVKPFGR-
ILVD_MYCTU       KEAFENAIAVVMAFGGSTNAVLHLLAIAHEANV-ALSLQDFSRIGSGVPHLADVKPFGR-
ILVD_MYCLE       KEAFENAIAVVMAFGGSTNAILHLLAIAHEADV-TLSLEDFSRIGFKVPHIADVKPFGR-
ILVD_MYCSJ       KEAFENAIAVVMAFGGSTNAVLHLLAIAWEANV-KLTLEDFTRVGQKVPHLADVKPFGR-
ILVD1_NOCFA      KEAFENAIAVVMAFGGSTNAVLHLLAIAHEARV-ELTLDDFARVGRRVPHLADVKPFGA-
ILVD_ACIC1       REAFENAIAVVMALGGSTNAVLHLLAIAREANV-DLAIDDFNRIGDRVPHLADVKPFGR-
ILVD_NOCSJ       RAAFENAITVAMALGGSTNAVLHLLAMAREADV-DLTIDDFNRIGDKVPHLGDLKPFGK-
ILVD_ARTS2       KKAFENAIAVTMAFGGSTNAVLHLLAIAREAEV-ELTLDDFNRIGDKIPHLGDLKPFGR-
ILVD_RENSM       KEAFENAIAVTMAFGGSTNAVLHLLAIAREAEV-DLQLEDFNRIGDKIPHLGDLKPFGR-
ILVD_CLAM3       KEAFENAISVVMAFGGSTNAVLHLLAIAREAEV-DLQLSDFNRIADRVPHLGDLKPFGR-
ILVD_CLAMS       KEAFENAISVVMAFGGSTNAVLHLLAIAREAEV-DLQLSDFNRIADRVPHLGDLKPFGR-
ILVD_LEIXX       KKAFENAIAVAMAFGGSTNVVLHLLAIAREAEV-DLTIDDFNRIGETVPHIGDLKPFGT-
ILVD_TROW8       KEAFENAIAVVMALGGSTNAVLHLLAIAHEAHV-PLTIDDFNKIGNRVPHIADLKPFGR-
ILVD_TROWT       KEAFENAIAVVMALGGSTNAVLHLLAIAHEAHV-PLTIDDFNKIGNRVPHIADLKPFGR-
ILVD2_COREF      RESLLNAVAVVMALGGSTNAVLHLMAIAHEAEV-DLTLEDFNAVGDKVPHLGDLKPFGR-
                      :.       . *:*  :*  :                             *    

ILVD_CALS8       ---YHIEDLYFAGGVQAVMNELSKKGLIHL----------DLLTVTGKS--------VGE
ILVD_HUNT2       ---HHVQDLYAAGGIPAVMKELSKKNLLHL----------DLITVTGKT--------VRE
ILVD_CALS4       ---YHIEDLHFAGGVSAVLKELSKAGLLHL----------DALTVTGRT--------LGE
ILVD_CLOB8       ---TYIEDLNDAGGIYAVMNEINKLGLLKT----------NLITCTGKT--------VGE
ILVD_CLOK5       ---NYVEELNEAGGIYAVMNEINKLNLLST----------DLITCTGKT--------VAE
ILVD_LACP7       ---TYMEDLNEAGGVYAVMNELDKKGLLYT----------DLITCTGKT--------IKE
ILVD_CLOAB       ---HHIEDLHMAGGIPAVVNGIIKKGLLNG----------ECMTVTGKT--------LYE
ILVD_CARHZ       ---HHMEDLYFAGGIPAVMKELSKKGLIRE----------DLLTVSGKT--------VGE
ILVD_MOOTA       ---QHIQDLDEAGGIPAVMNELYRHGLIDG----------SALTVTGRT--------VAD
ILVD_SYNFM       ---HFLENLDQAGGVQAVMKELLARDLIHR----------DAMTVTGLT--------VGK
ILVD_SYNAS       ---HHIEELDAAGGIQAVMKVISKLGVIQE----------SALTVSGRT--------VGE
ILVD_DESVH       ---HHIQDLHAAGGIPAVMAELDRIGLIDR----------SAMTVTGRT--------VGE
ILVD_DESVV       ---HHIQDLHAAGGIPAVMAELDSIGLIDR----------SAMTVTGRT--------VGE
ILVD_DESAG       ---QHIQDLHRAGGIPAVMAELDKAGRIHR----------DALTVTGRT--------VGE
ILVD_THEMA       ---YHIQDLDDAGGIYAVMKRLQENGLLKE----------DVMTIYLRK--------IGD
ILVD_THEP1       ---YHIQDLDDAGGIYAVMKRLQENGLLKE----------DAMTIYLRK--------IGD
ILVD_PYRAB       ---HFVLDLYEAGGVLAIMKRLSELGLIHE----------DRITVSLKT--------VGE
ILVD_PYRFU       ---HFVVDLYEAGGILGVMKRLSELGLIHE----------DRLTVSLKT--------VGE
ILVD_CLONN       ---HHMVDLDEAGGISAVLKELMDANLIFK----------DQLTVTGKT--------LEE
ILVD_IGNH4       ---HFVVDLDRAGGIPAVLKELGEAGLIHK----------DALTVTGKT--------VWE
ILVD_GEOMG       ---YFMEDLDAAGGVVGVLKQL--GGTIK-----------DSPTVLGLT--------TRE
ILVD_GEOSL       ---YFMEDLDAGGGVMGVLRQL--GSLVR-----------DNPTVMGLS--------TLQ
ILVD_GEOUR       ---YFMEDLDAAGGVAGVLMQL--GDKIK-----------DNPTVMGMT--------TLQ
ILVD_PELPD       ---HFMEDLDVAGGVSGVMKQL--GDKIK-----------DTQTLFGLT--------TRQ
ILVD_PELCD       ---HFMEDLDAAGGVPGVLYQL--RDQIH-----------DNPTLNGVG--------VKQ
ILVD_METMJ       ---HSMLALYRAGGIPAVLKML--ERHLD-----------DAPTVSGRS--------ILE
ILVD_METB6       ---YSMQALYRAGGIPAVLKRL--EKHLD-----------DCPTVSGLS--------LYQ
ILVD_METHJ       ---HSMQALHHAGGIPAVFRQI--RSHLE-----------NCQTVSGMD--------IYT
ILVD_ARCFU       ---EMVVDLDESGGVPMLIKKA--RKYFH-----------DEMTVSGKT--------LYE
ILVD_METTH       ---HMMLDLDRAGGIPAVLKTL--EDHINR----------ECVTCTGRT--------VQE
ILVD_METST       ---NRMIDVENAGGIPAVMKNM--ESILNT----------DCITCTSNS--------VKE
ILVD_METS3       ---DTMMDLHKAGGIPGVLKTL--GDKIDT----------SAITVTTKT--------LGE
ILVD_METJA       ---HFIIDLHRAGGIPAVLKVL--EEKIRK----------ECLTVSGKT--------IGE
ILVD_META3       ---HFISDLHRAGGIPAVLKIL--EQKIR-----------DANTVSGKS--------IKE
ILVD_METM5       ---HYMIDLHNAGGIPAVLKVL--KEKIR-----------NTKTVDGRS--------TLE
ILVD_METM7       ---HYMIDLHNAGGIPAVLNVL--KGKIR-----------DTKTVDGRS--------TLE
ILVD_METMP       ---HYMIDLHNAGGIPAVLNVL--KEKIR-----------DTKTVDGRS--------ILE
ILVD_METVS       ---HFMIDLHNAGGIPAVFNVL--KEKIR-----------DTNTVSGKT--------TLE
ILVD1_METAC      ---NFMLHFDRAGGVEAVVQRL--ASKLHL----------DQLTVNGKT--------IGE
ILVD_METMA       ---NFMLHFDRAGGVEAVMQRL--SSKLHL----------DQLTVNGKT--------IGE
ILVD2_METAC      ---NFILHFDRAGGVEAVMQRL--ASKLHL----------DQLTVNGKT--------IGE
ILVD_METBF       ---NFMLHFDRAGGVQAVMQRL--SSKLHL----------DQLTVNGKT--------IGE
ILVD_METBU       ---NFMIDFERAGGVQAIMKRL--VTKLNL----------DEKTITGKT--------VGE
ILVD_METTP       ---HHMLDLDRAGGVQAVMHRL--SSKLDL----------SVLTVTGKT--------LGA
ILVD_METKA       ---YTMRDLYEAGGVPAVMKEL--ADDLHL----------DRIDFAGRS--------MRE
ILVD_DEHMB       ---YHIENLDQSGGIGSVLKEL--KPWLKN----------DARTVSGKT--------IGQ
ILVD_DEHMC       ---YHIENLDQSGGIGSVLKEL--KPWLKN----------DARTVSGKT--------IGQ
ILVD_DEHM1       ---YHIENLDQAGGIGSVLKEL--KPWLKN----------DARTVSGKT--------IGQ
ILVD_ANADE       V---HMEDIHRAGGVPAVLREAARRGG---------IVREDALTVTGET--------VGE
ILVD_ANADF       V---HIEDVHRAGGVPAVLHEVARRGG---------VVREDALTVTGET--------VGE
ILVD_ARCB4       V---HMEDINKAGGVNAVMKEMTKRGN--------DIL-ADNLTISGET--------VLE
ILVD_SULNB       V---HMEDINTAGGVSSVMHEMHKRGD--------DIL-IDNPTITGES--------LYE
ILVD_NITSB       V---HMEDINKAGGVSAVMKEASKRSD--------TVLYLDNPVIEGGT--------IGD
ILVD_SULDN       V---HMDDIDKAGGVNAVMKEISRRG---------GLLYLENPTVTGET--------LGE
ILVD_HELHP       I---HMEDINRAGGVSAVMNEVAKRNASLGSHSADSILYLDALTITGET--------LGE
ILVD_WOLSU       V---HMEDINRAGGVNAVMNEINRRGG---------VLKTEALTVSGES--------MGE
ILVD_CAMFF       V---HMQDVAKAGGLSAVINEIAKFNS--------DLLSLDALTVSGES--------LGD
ILVD_CAMHC       I---HMQDVHNAGGINAIMNEV----K--------DLLHLDNLTVTGET--------LGE
ILVD_CAMC5       V---HMEDIGRAGGMNAVIKEISRRDN--------GMLHLENLTVSGET--------LGE
ILVD_CAMJE       V---YMDDIHKAGGVSAVMAEISSRQG--------HILELDALTITGES--------LKE
ILVD_CAMJR       V---YMDDIHKAGGVSAVMAEISSRQG--------HILELDALTITGES--------LKE
ILVD_CAMJD       V---YMDDIHKAGGVSAVMAEISSRQG--------HILELDALTITGES--------LEE
ILVD_CAMJJ       V---YMDDIHKAGGVSAVMAEISSRQG--------HILELDALTITGES--------LEE
ILVD_CAMJ8       V---YMDDVHKAGGVSAVMAEISSRQG--------HILELDALTITGES--------LKE
ILVD_AQUAE       Y---HIEDLDRVGGIPTIMKELSKLGL----------LHTERKTVSGKT--------IGE
ILVD_BACVZ       ----FIEDLHEAGGVSAALNELAKKEG---------ALHLDALTVTGRT--------LGE
ILVD_BACSU       ----FIEDLHEAGGVSAALNELSKKEG---------ALHLDALTVTGKT--------LGE
ILVD_BACP2       ----YIEDLHEAGGVTAALNELSKKEG---------ALHLDTMTVTAKT--------LGE
ILVD_BACLD       ----FIEDLHEAGGVSAVLNELSKKEG---------ALHLDTLTVTGKT--------LGE
ILVD_GEOKA       H---YIEDLHEAGGVSAVLNELSKKEG---------ALHLDTLTVTGKT--------LGE
ILVD_BACAH       ----HMEDIDRAGGISAILKEMSRKEG---------VLHLDRITATGQT--------LRE
ILVD_BACHK       ----HMEDIDRAGGISAILKEMSRKEG---------VLHLDRITATGQT--------LRE
ILVD_BACAN       ----HMEDIDRAGGISAILKEMSRKEG---------VLHLDRITATGQT--------LRE
ILVD_BACC1       ----HMEDIDRAGGISAILKEMSRKEG---------VLHLDRITATGQT--------LRE
ILVD_BACCZ       ----HMEDIDRAGGISAILKEMSRKEG---------VLHLDRITATGQT--------LRG
ILVD_BACCR       ----HMEDIDRAGGISAILKEMSRKEG---------VLHLDRITATGQT--------LRE
ILVD_BACCN       ----HMEDIDRAGGMSAILKELSRKEG---------VLHFDRITVTGKT--------LRE
ILVD_BACSK       ----SMDDVHKAGGVAAIMKELIEM-G---------AVKGDRITITGKS--------LYE
ILVD_BACHD       ----SMDDVHHAGGVAAIIKELCEIDG---------AIHPDRITITGKS--------IYE
ILVD_LISMO       ----SMHDVHEAGGVSAIVKELVDLGG---------AIHPDRITVTGKT--------IRE
ILVD_LISMF       ----SMHDVHEAGGVSAIVKELVDLGG---------AIHPDRITVTGKT--------IRE
ILVD_LISW6       ----SMHDVHEAGGVSAIVKELVDLGG---------AIHPDRITVTGKT--------IRE
ILVD_LISIN       ----SMHDVHEAGGVSAIIKELVDLGG---------AIHPDRITVTGKT--------IRE
ILVD_STAAC       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAE       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAA2       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAA9       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAS       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAA1       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAM       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAW       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAN       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAA8       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAT       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAA3       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAB       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAAR       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRITVTGKT--------LRE
ILVD_STAES       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRLTVTGKT--------LRE
ILVD_STAEQ       ----SMHDVHEAGGVPAIINELMKKDG---------TLHPDRLTVTGKT--------LRE
ILVD_STAHJ       ----SMHDVHEAGGCPAIINELMKKEG---------TLHPDRLTVTGKT--------LRE
ILVD1_STAS1      ----SMHDVHEAGGVPAIINELFKKEG---------TLHPDRITATGKT--------LRE
ILVD_LEUMM       ----AMEDVHNAGGVPAIINELIRMGD---------VLHPDRMTVTGKT--------LRE
ILVD_SYMTH       V---HIEDVHAAGGVMAILKELSRKEG---------TLHPHCLTVTGKT--------IGE
ILVD_CHLCH       V---HIEDVDRAGGISAILKELSSIDG---------LLDLSAITVTGKT--------LGE
ILVD_CHLPD       V---HIEDVDRAGGVSAILLELSKIDG---------LLDLSAPTVSGKT--------LGE
ILVD_PELLD       V---HIEDVDRAGGISAILHELSKIDG---------LLDLSVPTVTGKS--------LGE
ILVD_CHLPM       V---HIEDVDRAGGISAILHELSKVEG---------LLDLSVPTVTGHT--------LGE
ILVD_CHLTE       V---HIEDVDRAGGISAILKELSKVEG---------LLDLSAPTVTGKT--------LGE
ILVD_BIFAA       ---WEISDVHRAGGITGILGELDRAGK----------LHRDVHSIDYKS--------LED
ILVD_BIFLO       ---WEISDVHRAGGITGILGELDRAGK----------LHTNVHSIDYPT--------LEA
ILVD_CORGL       --DYHMEDVHRAGGIPALLGELNRGGL----------LNKDVHSVHSND--------LEG
ILVD_CORGB       --DYHMEDVHRAGGIPALLGELNRGGL----------LNKDVHSVHSND--------LEG
ILVD1_COREF      --DYHMEDVHRAGGIPAILGELNRGGL----------LNKDVHSVFSDD--------LES
ILVD_CORDI       --NYHIEDVHRAGGIPAILGELRRRDL----------LEKGVHTVLYKE--------MDS
ILVD_CORJK       --DYHMEDVHRGGGIPAILGELYRAGK----------LNEGVHSVHSAT--------LKE
ILVD3_NOCFA      --DYHMEDVHRAGGIPAILGELRRAGL----------LHTDVTTVHTPT--------LEE
ILVD_FRACC       --RYYMEDVHRAGGIPAILGELDRAGL----------LDPDPHTVHSAS--------LRE
ILVD_SALAI       --LYHMEDVHRAGGIPAILGELDRAGL----------LNREVHAVHSPS--------LAT
ILVD_STRAW       DRTYYMEDVHRAGGIPALLGELHRAGL----------LNEDVHSVHSPS--------LSD
ILVD_STRCO       DRTYYMEDVHRAGGIPALLGELHRGGL----------LNEDVHSVHSPS--------LAD
ILVD2_NOCFA      -GSHLMEDVHRAGGIPAILGELRRGGH----------LHTTVRAVHSES--------LDG
ILVD_THEFY       SDKYHIEDVHRAGGIPAIMGELARAGL----------VDTSLPMVHGMT--------VGE
ILVD_BACFR       --KYHIQDVNRAGGIMGIMGQLAKAGL----------IDTSVVRIDGMT--------LGE
ILVD_BACFN       --KYHIQDVNRAGGIMGIMGQLAKAGL----------IDTSVVRIDGMT--------LGE
ILVD_BACTN       --KYHIQDVNRAGGIIAILAELAKGGL----------IDTSVLRVDGMS--------LAE
ILVD_PARD8       --TYHVQDVNRAGGILGIMNELMKAGL----------VDGSTRRADGLT--------LAE
ILVD_BLOFL       --RYYMEDFHRAGGVMGILGELQRCGL----------LYENTYNILNKS--------LLD
ILVD_BLOPB       --RYHMEDFHRAGGVMGVLGELHRCGL----------LHEDTRNILNKS--------LLE
ILVD_BUCAI       --LYHVEDVHRAGGVMGILGELNRFNL----------LHKNTRNILQLN--------LEE
ILVD_BUCDN       --LYHMEDVHRAGGVMGILGELNRANL----------LNKQTQNILQLN--------LEE
ILVD_BUCAP       --LYHVEDVHRAGGVMRILGELNRSNL----------LNKKTENILGLN--------LEK
ILVD_BUCMH       --TYHMEDFHRAGGVMGLLAELNRINL----------LNKNINNVLGLN--------LET
ILVD_BUCSC       --VYHMEDFHRAGGVIGLLAELNRVSL----------LNNNVKNILGLS--------LDV
ILVD_BUCBP       --FYHIEDFHRAGGVFGVLDELNKVNL----------LYKQTFNILGLN--------LEE
ILVD_BUCCC       --KYYMEDFHRAGGVFGILSELNKINL----------LNTSILNILRMS--------LEK
ILVD_ACTP2       --KYHMEDVHRAGGIMAILGELERADL----------LHSDTRTVLGMT--------IGE
ILVD_MANSM       --KYHMEDVHRAGGVMAILGELDRANL----------LHHDTKTVLGLT--------FAE
ILVD_HAES1       --KYHMEDVHRAGGIMAILGELDRAGL----------LNSQTRTILGMS--------IGE
ILVD_HISS2       --KYHMEDVHRAGGIMAILGELDRAGL----------LNSQTRTILGMS--------IGE
ILVD_PASMU       --KYHMEDVHRAGGIMAILGELDRANL----------LHNDTRTVLGMS--------LAE
ILVD_HAEI8       --KYHMEDVHRAGGIMGLLGELDRAGL----------IHKNTHTVLGMS--------MGE
ILVD_HAEIG       --KYHMEDVHRAGGIMGLLGELDRAGL----------IHKNTHTVLGMS--------MGE
ILVD_HAEIN       --KYHMEDVHRAGGIMGLLGELDRAGL----------IHKNTHTVLGMS--------MGE
ILVD_HAEIE       --KYHMEDVHRAGGIMGLLGELDRAGL----------IHKNTHTVLGMS--------MGE
ILVD_ACTSZ       --KYHMEDVHRAGGIMGIVGELDRAGL----------IHRKVKTILGLT--------MEE
ILVD_AERHH       --KYHMEDVHRAGGVVAILGQLEKAGL----------VHGDTRNVLGTS--------LVE
ILVD_AERS4       --KYHMEDVHRAGGVVAILGQLEKAGL----------VHGDTRTVLGGS--------LAE
ILVD_VIBCH       --KYHMEDVHRAGGVMGILGELQRAGL----------LKDQTRTVLGIS--------LQE
ILVD_VIBC3       --KYHMEDVHRAGGVMGILGELQRAGL----------LKDQTRTVLGIS--------LQE
ILVD_VIBVU       --KYHMEDVHRAGGVVGILGELNRAGL----------LHNQSKTVLGLT--------WEE
ILVD_VIBVY       --KYHMEDVHRAGGVVGILGELNRAGL----------LHNQSKTVLGLT--------WEE
ILVD_VIBPA       --KYHMEDVHRAGGVVGILGELNRAGL----------LHNQSKTVLGLT--------WEE
ILVD_ALIF1       --KYHMEDVHRAGGVMAILGELDRAGL----------LNNQTKTVLGLT--------MQE
ILVD_PHOPR       --KYHMEDVHRAGGVYSILGELDRAGL----------LHNDTHNILGQT--------FAE
ILVD_ECOLC       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECOHS       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECO24       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_SHIF8       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_SHISS       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_SHIFL       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECOLI       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_SHIBS       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECO57       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_SHIDS       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECOUT       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECOK1       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECOL5       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_ECOL6       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVKNVLGLT--------LPQ
ILVD_SALPB       --KYHMEDVHRAGGVLGILGELDRAGL----------LNRNVKNVLGLT--------LPQ
ILVD_SALTY       --KYHMEDVHRAGGVLGILGELDRAGL----------LNRNVKNVLGLT--------LPQ
ILVD_SALCH       --KYHMEDVHRAGGVLGILGELDRAGL----------LNRNVKNVLGLT--------LPQ
ILVD_SALPA       --KYHMEDVHRAGGVLGILGELDRAGL----------LNRNVKNVLGLT--------LPQ
ILVD_SALTI       --KYHMEDVHRAGGVLGILGELDRAGL----------LNRNVKNVLGLT--------LPQ
ILVD_KLEP7       --KYHMEDVHRAGGVLGILGELDRAGL----------LNREVKNVLGLT--------LPQ
ILVD_ENT38       --KYHMEDVHRAGGVLGILGELDRAGL----------LNREVKNILGLT--------LPQ
ILVD_YERPE       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVSNVLGLN--------LTQ
ILVD_YERPA       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVSNVLGLN--------LTQ
ILVD_YERPN       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVSNVLGLN--------LTQ
ILVD_YERPP       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVSNVLGLN--------LTQ
ILVD_YERP3       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVSNVLGLN--------LTQ
ILVD_YERPS       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRDVSNVLGLN--------LTQ
ILVD_YERE8       --KYHMEDVHRAGGVVGILGELDRAGL----------LNREVKNVLGLN--------LPQ
ILVD_PECAS       --KYHMEDVHRAGGVIGILGELDRAGL----------LNREVNNVLGKT--------LPE
ILVD_SODGM       --KYHMEDVHRSGGVIGILGELGRSGL----------LNGDVHNVLGLS--------LPE
ILVD_PHOLL       --KYHMEDVHRAGGVIGILGELDRAGL----------LNRQVKNVLGLD--------LLQ
ILVD_COLP3       --EYHMEDVHRAGGVISILGELSRAGL----------LKTDVPNVLGTT--------LAD
ILVD_PSYIN       --LYHMEDVHRAGGVMAILGELDRAGL----------LNSDIPTILSPT--------MKE
ILVD_SHEB5       --KYHMEDVHRAGGVMGILGELDRTGL----------LHTDVFHVAADNDGTPGSGTLKS
ILVD_SHEB9       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVFHVAADNDGTPGSGTLKS
ILVD_SHEB8       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVFHVAADNDGTPGSGTLKS
ILVD_SHEPC       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVFHVAADE-----GGNLKS
ILVD_SHESW       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVFHVAADE-----GGNLKS
ILVD_SHESM       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVPHVAADA-----GGNLKS
ILVD_SHESR       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVPHVAADA-----GGNLKS
ILVD_SHESA       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVPHVAADA-----GGNLKS
ILVD_SHEON       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVPHVAADA-----GGNLKS
ILVD_SHEDO       --KYHMEDVHRAGGVMSILGELDRADL----------LHTDVPHVAADS-----GENLSH
ILVD_SHEFN       --KYHMEDVHRAGGVMGILGELDRAGL----------IHNDVPHVAADN-----GGDLKS
ILVD_SHELP       --KYHMEDVHRAGGVMGILGELDRAGL----------LHTDVSHVAGEN--------LKA
ILVD_SHEAM       --KYHMEDVHRAGGVMAILGELDRAGL----------LHTDVNHVASED------GTLKS
ILVD_SHEHH       --KYHMEDVHRAGGVMGILGELDRANL----------LHNDVYHVAGSN--------LAD
ILVD_SHEPA       --KYHMEDVHRAGGVMGILGELDRANL----------LHNDAYHVAGEN--------LAA
ILVD_SHESH       --EYHMEDVHRAGGVMGILGELDRAGL----------IHNDAYHVAGAS--------LKE
ILVD_PSEA6       --QYHMEDVHRAGGVLGILAELNRAGL----------LHEDTPHVLGKS--------IGE
ILVD1_PSEHT      --EYHIEDVHRAGGMMAIVRELGKAGL----------VDMSVNHVAGST--------MAE
ILVD1_BURL3      --KYHIEDVHRAGGIMAILGELDRAGK----------LHTDVPTVHTPS--------LKD
ILVD_BURVG       --KYHIEDVHRAGGIMAILGELDRAGR----------LHTDVPTVHAPT--------LKD
ILVD2_CUPPJ      --KYHIEDVHRAGGIMAILGELERAGK----------LHTDVPTVHAPS--------LGD
ILVD_ACIAC       --KYHIEDVHRAGGIMAILGELDRAGR----------LHTDAPTVHAPT--------LGD
ILVD_MARMS       --KYHVEDVHRAGGIFALLGELDRGGI----------LHNQCHTVHSKT--------MLE
ILVD_SACD2       --KYHIEDVHRAGGIMSILGELARGNL----------LNVDCPTVHSPT--------MAD
ILVD_PSEAE       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDVPTVHSPS--------MAD
ILVD_PSEAB       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDVPTVHSPS--------MAD
ILVD_PSEA7       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDVATVHSPS--------MAD
ILVD_PSEMY       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDVPTVHSPS--------MAD
ILVD_PSEU5       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDASTVHSPS--------MAD
ILVD_PSEP1       --NYHMEDVHRAGGIFSILGSLARGGL----------LHTDLPTVHSRS--------MEE
ILVD_PSEPK       --KYHMEDVHRAGGIFSILGSLARGGL----------LHTDLPTVHSRS--------MEE
ILVD_PSEPG       --KYHMEDVHRAGGIFSILGSLARGGL----------LHTDLPTVHSRS--------MEE
ILVD_PSEE4       --KYHMEDVHRAGGIFSILGSLARGGL----------LHTDLPTVHSRS--------MEE
ILVD_PSEPF       --KYHMEDVHRAGGIFSILGSLARGGL----------LHTDLPTVHSRS--------MEE
ILVD_PSEF5       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDLPTVHSKT--------MAE
ILVD_PSE14       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDLPTVHSKT--------LAE
ILVD_PSEU2       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDLPTVHSKT--------LAE
ILVD_PSESM       --KYHMEDVHRAGGIFSILGELARGGL----------LHTDLPTVHSKT--------MAE
ILVD_XANAC       --KYHIEDVHRAGGIMAILGELARGGL----------LHTNAATVHART--------LAD
ILVD_XANC5       --KYHIEDVHRAGGIMAILGELARGGL----------LHTNAATVHART--------LAE
ILVD_XANOR       --KYHIEDVHRAGGIMAILGELARGGL----------LHTTAATVHART--------LAD
ILVD_XANOM       --KYHIEDVHRAGGIMAILGELARGGL----------LHTTAATVHART--------LAD
ILVD_XANCP       --KYHIEDVHRAGGIMSILGELARGGL----------LHTNAATVHTRT--------LAD
ILVD_XANC8       --KYHIEDVHRAGGIMSILGELARGGL----------LHTNAATVHTRT--------LAD
ILVD_XYLFA       --KYHIEDVHRAGGIFGILAELARGNL----------LHTDVATVHSKT--------LGE
ILVD_XYLFT       --KYHIEDVHRAGGIFGILAELARGNL----------LHTDVATVHSKT--------LGE
ILVD_HAHCH       --KYHIEDVHRAGGIMAILGELDRAGL----------LHTDVPTVHSDT--------MKD
ILVD_RHORT       --DFYMEDVHRAGGVMGIMGELSRAGL----------LHEDLPTVHTPT--------LKA
ILVD_HYDCU       --DYHMEDVHRAGGIMRILGELDRGEL----------LNRDVKTVHAST--------MAA
ILVD_CAUVC       --DVHMEDVHRAGGVMAILGELERGGL----------IDASQPTVHAPT--------MGE
ILVD_GRABC       --DVHMEDVHRAGGIMAILGELERAGL----------LDASRPTVHAPT--------LKD
ILVD_ZYMMO       --DVHMEDVHRAGGVMAILGQLDRAGL----------INTSLRTIHSPT--------LGA
ILVD_GLUOX       --DVHMEDVHRAGGIPAILGELDRAGL----------IHKDVPTVYAPT--------LGD
ILVD_AZOSB       --DVHIEDVHRAGGIMSILGELDRAGL----------LNRDVPTVHSKT--------LGE
ILVD2_AROAE      --DVHIEDVHRAGGIMAILGELNRAGL----------LHAELPTVHSKT--------MAE
ILVD_DECAR       --KYHIEDVHRAGGIMGILGELDRAGL----------INRDVPNVYAKN--------LGE
ILVD1_BORBR      --KYHIEDVHRAGGILGILGELGRADL----------LDLSCGNVHSGT--------LGE
ILVD1_BORPA      --KYHIEDVHRAGGILGILGELGRADL----------LDLSCGNVHSGT--------LGE
ILVD1_BORPE      --KYHIEDVHRAGGILGILGELGRADL----------LDLSCGNVHSGT--------LGE
ILVD_BORA1       --KYHIEDVHRAGGILGILGELGRANL----------LDLSCGNVHSGT--------LGQ
ILVD_NEIMA       --DYYMEDVHRAGGIFAILKELDKAGK----------LHTDVHTIHAPT--------LKD
ILVD_NEIMF       --DYYMEDVHRAGGIFAILKELDKAGK----------LHTDVHTIHAPT--------LKD
ILVD_NEIMB       --DYYMEDVHRAGGIFAILKELDKAGK----------LHTDVHTIHAPT--------LKD
ILVD_NEIG1       --DYYMEDVHRAGGIFAILKELDKAGK----------LHTDVYTIHAPT--------LKD
ILVD_PSYA2       --KYHMEDVHRAGGVFALLAELDRAGL----------LNTDLPTIHSAT--------MKE
ILVD_CHRVO       --KYHMEDVHRAGGVIGILAELDRAGL----------IHRDVATVHSPS--------LGA
ILVD_METFK       --KYHMEDVHRAGGVMAILSELSRAGL----------IHRDTPTVHSPT--------LGE
ILVD_SYNP6       --KYHMEDVHRAGGVIAILGELDRAGL----------LHREVPTVHSPS--------LGA
ILVD_SYNE7       --KYHMEDVHRAGGVIAILGELDRAGL----------LHREVPTVHSPS--------LGA
ILVD_NITOC       --EYHMEDVHRAGGVISILGELDRAGL----------IHRQMATVHSPT--------LGA
ILVD_NOVAD       --DVHMEDVHRAGGIYAILGELDRAGL----------LHTHLPTVHSRT--------LGD
ILVD_SPHAL       --DVHMEDVHRAGGIMAILGELDRAGL----------LHAHLPTVHSAT--------LGD
ILVD1_ACIAD      --DVHMEDVHRAGGIMSILGELDRAKL----------LNTTVSTVHEKT--------LQD
ILVD_DEIRA       --DVHMEDVHRAGGIMGILGELDRAGL----------LKTDVSTVHAPS--------MSA
ILVD_RHIEC       --DVHMEDVHRAGGIMSILGELDKGGL----------LNRDCPTVHAET--------LGD
ILVD_RHIL3       --DVHMEDVHRAGGIMSILGELDKGGL----------LNRDCPTVHAET--------LGD
ILVD_RHIME       --DVHMEDVHRAGGIMSILGELDKGGL----------INRDCPTVHAET--------LGD
ILVD_SINMW       --DVHMEDVHRAGGIMSILGELDKGGL----------INRDCPTVHAET--------LGD
ILVD_AGRFC       --DVHMEDVHRAGGIMRILGELERGGL----------INRDTYTVHEAT--------LGD
ILVD1_RHILO      --DVHMEDVHRAGGIMAILGQLDNAGL----------INRDLPTVHTSS--------LGE
ILVD_BRUAB       --SVHMEDVHHAGGIMGILGQLDNAGL----------LTTSIPTVHSET--------LAK
ILVD_BRUA2       --SVHMEDVHHAGGIMGILGQLDNAGL----------LTTSIPTVHSET--------LAK
ILVD_BRUO2       --SVHMEDVHHAGGIMGILGQLDNAGL----------LTTSIPTVHSET--------LAK
ILVD_BRUC2       --SVHMEDVHHAGGIMGILGQLDNAGL----------LTTSIPTVHSET--------LAK
ILVD_BRUSU       --SVHMEDVHHAGGIMGILGQLDNAGL----------LTTSIPTVHSET--------LAK
ILVD_BRUME       --SVHMEDVHHAGGIMGILGQLDNAGL----------LTTSIPTVHSET--------LAK
ILVD_BRUSI       --SVHMEDVHHAGGIMGILGQLDNAGL----------LTTSIPTVHSET--------LAK
ILVD_OCHA4       --TVHMEDVHRAGGIMGILGQLDKAGL----------INTDLPTVHSET--------VAK
ILVD_RHOP5       --TVHMEDVHRAGGIMSILGQLDAAGL----------LNGDTKTVHATS--------LRA
ILVD_NITHX       --DVHLEDVHRAGGIMGILGELDRAGL----------IDSSLPTVHSTS--------LKD
ILVD_NITWN       --DVHLEDVHRAGGIMGILGELDRAGL----------IDASLPTVHSNS--------LRE
ILVD_AZOC5       --NIHMEDVHRAGGIMGILGELDRAGL----------IHTDLPTVHAPS--------MKD
ILVD_RHOPA       --DVHMEDVHRAGGIMAILGELDRAGL----------LDTSCTTVHSET--------LGA
ILVD_RHOP2       --DVHMEDVHRAGGIMAILGELDRAGL----------IHNSCPTVHSET--------LGA
ILVD1_BRADU      --DVHVEDVHRAGGIMGILGELDRAGL----------IDTSVSTVHAPT--------MAD
ILVD_BARHE       --NVHMEDVHRAGGIMGLLGELDAVGL----------IDTSAYTVHAKT--------MKE
ILVD_BART1       --NVHMEDVHRAGGIMGLLGELDAAGL----------IDTSTYTVHAKT--------MKE
ILVD_RHOS4       --DVHIEDVHRAGGIMSILGELDRGGL----------LHRDTRTVHAPT--------LGA
ILVD_RHOS1       --DVHIEDVHRAGGIMSILGELDRGGL----------LHRDTRTVHAPT--------LGA
ILVD_PARDP       --NVHMEDVHRAGGIMAILGELDRAGL----------IDRDCPTVHAPT--------IGA
ILVD_RUEPO       --NVHMEDVHRAGGIFSILGELSRAGL----------LHDDCGTVHSAS--------MGE
ILVD_RUEST       --NVHMEDVHRAGGIFSILGELSRAGL----------LHNDVPTVHSDS--------MGE
ILVD_HYPNA       --NVHMEDVHRAGGIFGILGELGRAGK----------LDTSVRTIHEDT--------MAE
ILVD_MAGSA       --DVHIEDVHRAGGIMGILGQLDRGGL----------INRECGTIHART--------LAE
ILVD_ACICJ       --NVHMEDVHRAGGIMGILGALDRAGL----------IHRDCATVHEKT--------IGE
ILVD_MAGMM       --KYHVEDVHRAGGVFSILGELNRIGL----------INDHCLTVHAPN--------MAE
ILVD_NOSS1       ---YVATDLHKAGGIPQVMKMLLVHGL----------LHGDCMTITGKT--------IAE
ILVD_TRIEI       ---YVTTNLHQAGGIPLVMKMLLEHDL----------LHPDALTITGKT--------IGE
ILVD_ACAM1       ---YVATDLHKAGGIPLVMKMLLEHGL----------LHGDALTITGKT--------IAE
ILVD_MICAN       ---YVTVDLHKAGGIPQVMKILLVNGL----------LHGDALTISGQT--------IAE
ILVD_SYNY3       ---YVTTNLHAAGGIPQVMKILLVNGI----------LHGDALTITGQT--------IAE
ILVD_THEEB       ---YVTADLHRAGGIPQVMKMLLNAGL----------LHGDCLTITGET--------IAE
ILVD_SYNJB       ---FVATDLHRAGGIPQVMKMLLNHGL----------LHGDCLTISGQT--------IVE
ILVD_SYNJA       ---FVATDLHRAGGIPQVMKILLNHGL----------LHGDCLTISGQT--------IAE
ILVD_GLOVI       ---FVATDLHRAGGIPQVMKMLLVRGL----------LHGDALTVTGQT--------VAE
ILVD_NITEU       ---YVATDLHKAGGIPQVMKMLLVHDL----------LHGDCLTISGQT--------IAE
ILVD_NITEC       ---YVATDLHRAGGIPQVMKMLLVHGL----------LHGDCLTISGQT--------IAE
ILVD_NITMU       ---YVATDLHKAGGIPQVMKMLLDHGL----------LHGDCITISGQT--------IAE
ILVD_CHLAA       ---YVATDLHRVGGVPQVMKILLNAGL----------LHGDCMTITGQT--------IAE
ILVD_DEIGD       ---YVATDLHEVGGIPRVMKMLLKAGL----------LHGDCLTVTGQT--------VAE
ILVD_HALHL       ---FVTSQFHEVGGTPQVMRILLEQGL----------LHGHCQTITGQT--------IEA
ILVD_PROMS       ---YVTVDLHKAGGIPQVMKILLNAGL----------IHGDCKNIEGKT--------ISE
ILVD_PROM9       ---YVTVDLHKAGGIPQVMKILLNAGL----------IHGDCKNIEGKT--------ISE
ILVD_PROM0       ---YVTVDLHKAGGIPQVMKILLNAGL----------IHGDCKNIEGKT--------ISE
ILVD_PROM2       ---FVTVDLHNAGGIPQVMKILLNAGL----------IHGECKNIEGKT--------ITE
ILVD_PROM5       ---YVTVDLHNAGGIPQVMKILLNAGL----------INGDCKNIEGKT--------ISE
ILVD_PROMP       ---YVTVDLHKAGGIPQVMKILLNTGL----------IHGNCRNIEGKT--------VVE
ILVD_PROMA       ---YVTVDLHKAGGIPQVMKILLEAGL----------INENCRTIENKT--------IKE
ILVD_PROM3       ---YVTVDLHKAGGIPQVMKQLLDAGL----------LHGDCCNVEGKT--------LRE
ILVD_PROMM       ---YVTVDLHNAGGIPQVMKQLLDAGL----------LHGDCRNVEGKT--------LRE
ILVD_SYNSC       ---YVTVDLHNAGGIPQVMKLLLDAGL----------LHSDCRTVEGKS--------LKE
ILVD_SYNPX       ---YVTVDLHNAGGIPQVMRLLLDAGL----------LHGDCRTVEGKS--------LRE
ILVD_SYNS9       ---FVTVDLHNAGGIPQVMKLLLDAGL----------LHGDCQTVEGKS--------LNE
ILVD_SYNR3       ---FVTVDLHNAGGIPQVMKLLLDGGL----------LHGDCRTVEGKT--------LRE
ILVD_PROMT       ---YVTVDLHKAGGIPQVMKLLLDAGM----------LHGECKTIEGKT--------IKE
ILVD1_AROAE      ---YLATDLHQAGGIPQVMKLLLDAGL----------LHGACVTITGQT--------IAE
ILVD3_AROAE      ---YLATDLHQAGGIPQVMKLLLEAGL----------LHGECVTITGRT--------IAE
ILVD3_BORBR      ---YVATDLHRAGGIPQVMKILLNAGL----------LHGDCITITGKT--------VAE
ILVD2_BORPA      ---YVATDLHRAGGIPQVMKILLNAGL----------LHGDCITITGKT--------VAE
ILVD2_BORPE      ---YVATDLHRAGGIPQVMKILLNAGL----------LHGDCITITGKT--------VAE
ILVD_BURMA       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------LAE
ILVD_BURM9       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------LAE
ILVD_BURM7       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------LAE
ILVD_BURMS       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------LAE
ILVD_BURPS       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------LAE
ILVD_BURP6       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------LAE
ILVD_BURP1       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------LAE
ILVD_BURP0       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGGCMTITGRT--------LAE
ILVD_BURTA       ---YVATDLHAAGGIPQVMKLLLDAGL----------LHGDCMTITGRT--------IAE
ILVD2_BURL3      ---YVATDLHRAGGIPQVLKILLDAGL----------LHGDCMTITGRT--------IAD
ILVD1_CUPPJ      ---YVATDLHKAGGIPQVMKILLKAGL----------LHGDCLTITGRT--------LAE
ILVD_RALSO       ---YVATDLHKAGGIPQVMKILLNAGL----------LHGDCVTITGKT--------LAE
ILVD_HERAR       ---YVATDLHKAGGIPQVMKVLLDAGL----------LHGDCMTITGQT--------VAE
ILVD_JANMA       ---YVATDLHKAGGIPQVMKVLLDAGL----------LHGDCMTITGQT--------VAE
ILVD_POLNA       ---YLAVDLHQAGGIPQVMKMLLVAGL----------LHGDCITISGQT--------IAE
ILVD_POLSJ       ---YLAVDLHRAGGIPQVMKMLLAAGL----------LHGDCLTITGQT--------IAE
ILVD_RHOFT       ---YLAVDLHRAGGIPQVMKMLLSAGL----------LHGDCITITGQT--------VAE
ILVD_VEREI       ---YLAVDLHRAGGIPQVMKLLLNAGL----------LHGDCITIEGKT--------MAQ
ILVD_METPP       ---YLAIDLHRAGGIPQVMKTLLAAGL----------IHGDCITITGRT--------VAE
ILVD_TREPR       ---HSTADLHSAGGVPRVMHELALAGL----------IDESCLTITGRT--------IGA
ILVD_CHRSD       ---YLMSELVAIGGIQPMMKILLDAGL----------LHGDCLTVTGKT--------LAE
ILVD2_PSEHT      ---YLMSELIEIGGIQPLMKRLLDAGM----------LHGDCMTVTGKT--------MAE
ILVD2_ACIAD      ---YLMSELIKIGGIQPLMKRMLERGM----------LDGSCLTVTGKT--------LAE
ILVD_METCA       ---YSMAELVEIGGIQPLMKTLLDAGL----------LHGDCMTVTGKT--------LEE
ILVD_RUTMC       ---YMMSELVKIGGTLPLMKMLLDAGL----------LHGDCLTVTGKT--------LAE
ILVD_LACLS       ---YMMEDLHKIGGVPAVLKYLLKEGK----------LHGDCLTVTGKT--------LAE
ILVD_LACLA       ---YMMEDLHKIGGLPAVLKYLLKEGK----------LHGDCLTVTGKT--------LAE
ILVD_CYTH3       ---YMMEDMDAIGGVPSVMRLLAKHNL----------LHLDCMTVTGKT--------VGE
ILVD_FRATN       ---YVMADLHAIGGTPAVMKMLLKAGM----------LHGDCLTVTGKT--------LAE
ILVD_FRATT       ---YVKANLHAIGGTPAVMKMLLKAGM----------LHGDCLTVTGKT--------LAE
ILVD_FRAP2       ---YVMADLHAIGGTPAVMKMLLKAGM----------LHGDCLTVTGKT--------LAE
ILVD_RHOBA       ---FVQEDLHSVGGTPAVMKYLLEKGM----------IKGEHMTVTGKT--------LAE
ILVD_LEPBJ       ---YAMTDLDKVGGVHGVMKYLLKEGM----------LHGDCLTVTGKT--------IAE
ILVD_LEPBL       ---YAMTDLDKVGGVHGVMKYLLKEGM----------LHGDCLTVTGKT--------IAE
ILVD_LEPIN       ---YAMTDLDKVGGVHGVMKYLLKEGM----------LHGDCLTVTGKT--------IAE
ILVD_LEPIC       ---YAMTDLDKVGGVHGVMKYLLKEGM----------LHGDCLTVTGKT--------IAE
ILVD_STRPN       ---YVFQDLYEVGGVPAVMKYLLANGF----------LHGDRITCTGKT--------VAE
ILVD_STRR6       ---YVFQDLYEVGGVPAVMKYLLANGF----------LHGDRITCTGKT--------VAE
ILVD_STRP2       ---YVFQDLYEVGGVPAVMKYLLANGF----------LHGDRITCTGKT--------VAE
ILVD_STRT2       ---YVFQDLYNVGGVPAVMKYLLKNGF----------LHGDRITCTGKT--------VAE
ILVD_STRT1       ---YVFQDLYNVGGVPAVMKYLLKNGF----------LHGDRITCTGKT--------VAE
ILVD_STRSY       ---YVFQDLYNVGGVPAVMKYLLKNGF----------LHGDRITCTGKT--------VAE
ILVD_STRS2       ---YVFQDLYNVGGVPAVMKYLLKNGF----------LHGDRITCTGKT--------VAE
ILVD_STRSV       ---YVFQDLYEVGGVPAVMKYLLANGF----------LHGDRITCTGKT--------VAE
ILVD_STRMU       ---YVFQDLYKVGGVPAVMKYLLKNGF----------LHGDRITCTGKT--------VAE
ILVD_OCEIH       ---FVMQDLHRVGGVQAVMKLLHENGY----------LHGDCLTVTGKT--------IAE
ILVD2_STAS1      ---YVMAHLDEVGGIPAVMKLLHDKGL----------IHGDCLTVTGKT--------VAE
ILVD_ROSCS       ---YSAIHVDQAGGIQVIAKRLVDGGF----------AHGDAITVTGRT--------LAE
ILVD_ROSS1       ---YSAIHVDQAGGIQVIARRLVDGGF----------AHGDAITVTGRT--------LAE
ILVD_KORVE       ---FTATDLHDAGGIPLVAQRLLEANL----------LHADALTVTGKT--------IAE
ILVD_THET2       ---YTAWELYEAGGTALVFKRLLEAGL----------LFGEEKTLTGRT--------LAE
ILVD_THET8       ---YTAWELYEAGGTALVFKRLLEAGL----------LFGEEKTLTGRT--------LAE
ILVD_HALMA       ---RVMNDLHEVGGVPVVLRALNDAGL----------LHGDALTVTGNT--------IAE
ILVD_NATPD       ---RVMNDLHEIGGVPVVIRRLMEADL----------FDGSQLTVTGRT--------IEE
ILVD2_BORBR      ---YLARDLHEAGGVPVVLKALLDGGH----------IDGSVLTLDGRT--------LAE
ILVD3_BRADU      ---YTAKDVHDIGGAAVVIQELIRTGH----------IDGNCITITGRT--------LAE
ILVD2_BRADU      ---YVAKDMFEVGGIPLLMKTLLDNGF----------LHGDCITVTGRT--------IAE
ILVD2_RHILO      ---YVAKDMFEAGGIPLLMKTLLDHGY----------LHGDCLTVTGRT--------LAE
ILVD_PARL1       ---YVAKDLHEAGGVSMVLKVLLDGGY----------LHGDCLTVTGQS--------LAD
ILVD_PELUB       ---YVAKDMWLAGGVPMLLKTLFDGGF----------IHGDCMTVTGKT--------MKQ
ILVD_DINSH       ---YVAKDMYEAGGVPVVMRELRRAGL----------IHEDCMTVTGYS--------IGE
ILVD_PYRAR       ---YAMQDLDRIGGVPRVLKKLYKAGL----------LRPEALTVEGEP--------IGK
ILVD_PYRIL       ---YAMQDLDRIGGAPRILKKLYKAGL----------LRPEALTVEGET--------IGK
ILVD_PYRAE       ---YAMQDLDKIGGVPRILKKLYKAGL----------LRGEALTVEGET--------IGK
ILVD_PYRCJ       ---YAMQDLDRVGGVPRLLKKLYKAGL----------LRGEALTVEGEP--------IGK
ILVD_AERPE       ---YTMVDLHNVGGAPVILRKLLDRGL----------LYGEAVTVEGVE--------IGK
ILVD_METS5       ---YVMADLYRVGGTPVILKKLLDRGL----------LHGDTITVTGKT--------MAQ
ILVD_SULTO       ---YAMYDLHRVGGAPLIMKKLLEADL----------LHGDVITVTGKT--------VKQ
ILVD_PICTO       ---YTMAELNEIGGVPVVMKKLLDKGF----------LHGDVLTVTGKT--------LRE
ILVD_SULAC       ---YVMADLDEVGGVPLVMKKLLDAGL----------LNGDVLTVTGKT--------MKQ
ILVD_SACS2       ---YVMADLDEVGGVPVVLKKLLDAGL----------LHGDVLTVTGKT--------MKQ
ILVD_MYCA1       ---HVMTDVDHIGGVPVMMKALLDAGL----------LNGDCLTVTGAT--------VAQ
ILVD_MYCPA       ---HVMTDVDHIGGVPVMMKALLDAGL----------LNGDCLTVTGAT--------VAQ
ILVD_MYCUA       ---HVMSHVDHIGGVPVVMKTLLDAGL----------LHGDCLTVTGRT--------VAE
ILVD_MYCBO       ---HVMSDVDHIGGVPVVMKALLDAGL----------LHGDCLTVTGHT--------MAE
ILVD_MYCTU       ---HVMSDVDHIGGVPVVMKALLDAGL----------LHGDCLTVTGHT--------MAE
ILVD_MYCLE       ---HVMFDVDHIGGVPVVMKALLDAGL----------LHGDCLTVTGQT--------MAE
ILVD_MYCSJ       ---HVMKHVDEIGGVPVVMKALLDAGL----------MHGDCLTVTGET--------MAE
ILVD1_NOCFA      ---HVMTDVDRIGGVPVMMKTLLDAGL----------LHGDCLTVTGRT--------VAE
ILVD_ACIC1       ---YVMSDVDRVGGVPVVMKALLDAGL----------LHGDCLTVTGKT--------VAE
ILVD_NOCSJ       ---YVMNDVDKIGGIPVVMKALLDAGL----------MHGDALTVTGKT--------LAE
ILVD_ARTS2       ---YVMTDVDKIGGVPVIMKALLDAGL----------LHGDCLTVTGKT--------LAE
ILVD_RENSM       ---YVMNDVDRVGGVPVIMRALLDAGL----------LHGDALTVTGKT--------LAE
ILVD_CLAM3       ---FVMNDVDRVGGVPVVMKALLDAGL----------LHGDVMTVTGRT--------MRE
ILVD_CLAMS       ---FVMNDVDRVGGVPVVMKALLDAGL----------LHGDVMTVTGRT--------MRE
ILVD_LEIXX       ---YVMNDVDRHGGVPVVMKALLDAGL----------LHGDCLTVTGKT--------VAE
ILVD_TROW8       ---YVMNDVDRVGGIPVVINALMREGF----------IHGDVITVSGRT--------MAE
ILVD_TROWT       ---YVMNDVDRVGGIPVVINALMREGF----------IHGDVITVSGRT--------MAE
ILVD2_COREF      ---YVMNDVFKIGGIPVVMKALLDAGL----------INGDCLTITGRT--------VAE
                         .   **                                              

ILVD_CALS8       NIK--DAKVKD------------------------------------YNVIRPID-NPYS
ILVD_HUNT2       NIE--NAKVRD------------------------------------YEVIRSID-NPYS
ILVD_CALS4       NIK--DAKVRN------------------------------------RDVIRTIE-DPYS
ILVD_CLOB8       NIE--GCINKN------------------------------------PEVIRPVK-NPYS
ILVD_CLOK5       NIK--GCINKN------------------------------------KEVIRPVE-NPYS
ILVD_LACP7       NIE--GCVNRD------------------------------------PDTIRPIE-NPYS
ILVD_CLOAB       NVK--DAKIKN------------------------------------IDVIR-ID-NPYS
ILVD_CARHZ       NLK--NAVNKN------------------------------------PEVIRPID-NPYS
ILVD_MOOTA       NVS--GRVVSR------------------------------------REVIRPVE-DPYS
ILVD_SYNFM       NLE--SSKNTD------------------------------------PTVIRPIS-DPYH
ILVD_SYNAS       NLE--KARVLN------------------------------------EEVIRPLD-RAYR
ILVD_DESVH       NLDALGAKVRD------------------------------------ADVIRPVD-APYS
ILVD_DESVV       NLDALGAKVRD------------------------------------ADVIRSVD-APYS
ILVD_DESAG       NLDALGAAVRD------------------------------------HDVIRPME-KPYS
ILVD_THEMA       LVR--EAKILN------------------------------------EDVIRPFD-NPYH
ILVD_THEP1       LVR--EAKILN------------------------------------EDVIRPFD-NPYH
ILVD_PYRAB       LLR--DVSVLR------------------------------------DDVIRPVT-RPYL
ILVD_PYRFU       LLK--SAFVSR------------------------------------DDVIRPVT-NPYH
ILVD_CLONN       NIK--NSLVLN------------------------------------DSVIRPLN-NPYS
ILVD_IGNH4       NVK--DAAVLD------------------------------------REVIRPLD-NPYS
ILVD_GEOMG       LAS--TVESVD------------------------------------ERVIRPVS-DPVK
ILVD_GEOSL       LAS--TVESVD------------------------------------ERVIRPLS-NPVK
ILVD_GEOUR       LAA--SIANVD------------------------------------EAVIHPLT-DPVK
ILVD_PELPD       LAA--SVENVD------------------------------------ETVIRPLT-NPVK
ILVD_PELCD       IID--SVIDVD------------------------------------ETVIHPKE-DAVR
ILVD_METMJ       IAK--GARVAD------------------------------------PDVIRTTD-APVS
ILVD_METB6       VAR--NAMIKN------------------------------------EQVIRSLD-APVS
ILVD_METHJ       IAD--SVKYVD------------------------------------ESVIRPEQ-SPVH
ILVD_ARCFU       IAE--MAVLRG------------------------------------RDIIASPD-NPLH
ILVD_METTH       NIE--NVKVGH------------------------------------RDVIRPLD-SPVH
ILVD_METST       NLE--KVSDID------------------------------------YNVIHTLD-DPIR
ILVD_METS3       NIK--DVEVTN------------------------------------TDVIHPLD-NPIH
ILVD_METJA       IIK--EVKYID------------------------------------YSVIRPVD-NPVH
ILVD_META3       IIN--EVKYID------------------------------------YNIIRPVD-KPVH
ILVD_METM5       IAE--SVKYVN------------------------------------YDVIRKVE-APVH
ILVD_METM7       IAE--SVKYIN------------------------------------YDVIRKVE-APVH
ILVD_METMP       IAE--SVKYIN------------------------------------YDVIRKVE-APVH
ILVD_METVS       IAK--EVKYIN------------------------------------YDVIRKTE-APVH
ILVD1_METAC      NLD--ELEIVNP--------------------------------KLNAEIITTLE-NPIH
ILVD_METMA       NIS--ELEIINP--------------------------------KLNEEIIKTLE-NPIH
ILVD2_METAC      NLD--ELEIVNP--------------------------------KLNAEIITTLE-NPIH
ILVD_METBF       NLN--EFEIINP--------------------------------KLNKEIIATLE-KPIH
ILVD_METBU       NID--EFVIVNP--------------------------------KTNARVITTIE-EPLH
ILVD_METTP       VLA--EFKPVNP--------------------------------KANAEVIATLE-RPVH
ILVD_METKA       RVE--RTEVKD------------------------------------REVIRPKE-DPVH
ILVD_DEHMB       LAD--AAPKAD------------------------------------NKVIRFAS-NPYS
ILVD_DEHMC       LAD--AAPKAD------------------------------------NKVIRFAS-NPYS
ILVD_DEHM1       MAD--AAPKAD------------------------------------NKVIRFAS-NPYS
ILVD_ANADE       RIRGARTAD--------------------------------------PELIRPLE-NAYS
ILVD_ANADF       RIRGAEIKD--------------------------------------RSVIHPLE-EAYS
ILVD_ARCB4       KIKDAYIKD--------------------------------------TNIIHTID-NPYS
ILVD_SULNB       RIKDARILD--------------------------------------TNIIHTID-NPFS
ILVD_NITSB       RIKDAEVID--------------------------------------TSIIHPID-KPYS
ILVD_SULDN       RIADAKILN--------------------------------------EEIIHRNE-NAYS
ILVD_HELHP       RIANAQIVD--------------------------------------SSVIRHNE-NAYS
ILVD_WOLSU       RIAGAKILD--------------------------------------TQIIHTLE-NPYS
ILVD_CAMFF       RVKNAEILD--------------------------------------ESVIHTVQ-NAYS
ILVD_CAMHC       RIKGAKIKD--------------------------------------EDVIHKVE-NAYS
ILVD_CAMC5       RVGLSEIKD--------------------------------------ESVIHKVE-NAYS
ILVD_CAMJE       RLKNAKIKD--------------------------------------ENIIRKVD-NAYS
ILVD_CAMJR       RLKNAKIKD--------------------------------------ENIIRKVD-NAYS
ILVD_CAMJD       RLKNAKIKD--------------------------------------ENIIRKVD-NAYS
ILVD_CAMJJ       RLKNAKIKD--------------------------------------ENIIRKVD-NAYS
ILVD_CAMJ8       RLKNAKIKD--------------------------------------ENIIRKVD-NAYS
ILVD_AQUAE       IISDAPDAD--------------------------------------GEVVRTIE-NPYS
ILVD_BACVZ       TIAGHEVKD--------------------------------------YDVIHPLD-NPFT
ILVD_BACSU       TIAGHEVKD--------------------------------------YDVIHPLD-QPFT
ILVD_BACP2       NIAGHEVKD--------------------------------------YNVIYPID-KPFT
ILVD_BACLD       NIAGREVKD--------------------------------------YEVIHPID-QPFS
ILVD_GEOKA       NIAGCEVKN--------------------------------------YDVIRPID-NPYS
ILVD_BACAH       NIAHAEIKD--------------------------------------KEVIHSLE-NPHS
ILVD_BACHK       NIAHAEIKD--------------------------------------KEVIHSLE-NPHS
ILVD_BACAN       NIAHAEIKD--------------------------------------KEVIHSLE-NPHS
ILVD_BACC1       NIAHAEIKD--------------------------------------KEVIHSLE-NPHS
ILVD_BACCZ       NIAHAEIKD--------------------------------------KEVIHSLE-NPHS
ILVD_BACCR       NIAEAEIKD--------------------------------------KEVIHSLE-NPHS
ILVD_BACCN       NIADAEIQD--------------------------------------KEVIHSLE-NPHS
ILVD_BACSK       NVAHAQITN--------------------------------------TDVIRTKE-TAYS
ILVD_BACHD       NVKDAEITD--------------------------------------DVVIRRKD-NPYS
ILVD_LISMO       NVADAKINN--------------------------------------TDVIHPKE-NPYS
ILVD_LISMF       NVADAKINN--------------------------------------TDVIHPKE-NPYS
ILVD_LISW6       NVADAKINN--------------------------------------TDVIHPKE-NPYS
ILVD_LISIN       NVADAKINN--------------------------------------TDVIHPKE-NPYS
ILVD_STAAC       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAE       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAA2       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAA9       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAS       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAA1       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAM       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAW       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAN       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAA8       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAT       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAA3       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAB       NNEGKEIKN--------------------------------------FDVIHPLD-APYD
ILVD_STAAR       NNEGKEIKN--------------------------------------FDVIHSLD-APYD
ILVD_STAES       NNEGKNIKN--------------------------------------FDVIHPLE-NPYD
ILVD_STAEQ       NNEGKNIKN--------------------------------------FDVIHPLE-NPYD
ILVD_STAHJ       NNEGKEIKN--------------------------------------FDVIHSLD-DPYD
ILVD1_STAS1      NNEDKEILN--------------------------------------SDVIRHLD-NPYD
ILVD_LEUMM       NVADHEIIN--------------------------------------DEIIRKFDVNPYS
ILVD_SYMTH       LWAEAENRN--------------------------------------REVIRPVE-DPYA
ILVD_CHLCH       NIANAEVLD--------------------------------------RSVIRSIS-DPYS
ILVD_CHLPD       NIAGAEIKD--------------------------------------EKVIRTID-NPYS
ILVD_PELLD       NIKNAEVLN--------------------------------------RKVIRSIE-DPYS
ILVD_CHLPM       NIADAEVKD--------------------------------------RSVIRSVE-DPYS
ILVD_CHLTE       NIASAEVLD--------------------------------------RTVIRSVE-EPYS
ILVD_BIFAA       KLNDWDIMRDTCTEEAKQMYLAAPGHIVSPEPWTHTTLFDSLDRDRVNGAIHDID-HPAV
ILVD_BIFLO       KLADWDIMRPTCTEEAQQMYKAAPGHIISPEPWTHTTLFDSLDRDRTNGAIHDIN-HPEI
ILVD_CORGL       WLDDWDIRSGKTTEVATELFHAAPGGIRTTEAFSTENRWDELDTDAAKGCIRDVE-HAYT
ILVD_CORGB       WLDDWDIRSGKTTEVATELFHAAPGGIRTTEAFSTENRWDELDTDAAKGCIRDVE-HAYT
ILVD1_COREF      WLDEWDIRSGKASEEAIDLFHAAPGGIRTTEAFSTDNRWDSLDTDAENGCIHSIE-HAHT
ILVD_CORDI       WLDDWDIRGGKATDKAIELFHAAPGGVRTTEPFSQSNRWDSLDTDQARGCIHDVD-HAYS
ILVD_CORJK       WLLSWDIRSGAATEEAIELFHAAPGGVRTTAPFSTENRWSSLDTDAEGGVIRDVE-HAYT
ILVD3_NOCFA      WLDTWDIRSGKASAEAIELFHAAPGGVRTTEPFSTDNRWSSLDTDAAGGCIRDKE-HAYT
ILVD_FRACC       FLDRWDVRGPSPSPDAIELFHAAPGGVRTIEPFSSTNRWDTLDTDARDGCIRSVE-HAYS
ILVD_SALAI       WLADWDVRGDAATPEAVDLFHAAPGGVRTVEPFSTTNRWSTLDTDAAGGCVRDRA-HAYT
ILVD_STRAW       WLKTWDVRAGSPSPEAIELWHAAPGCVRSSEAFSQSERWEALDEDAEGGCIRSAE-HAYS
ILVD_STRCO       WLKTWDVRGGSPSKEAVELWHAAPGCVRSAEAFSQSERWDTLDEDAEGGCIRSVE-HAYS
ILVD2_NOCFA      WLAEWDVRGPNPAQAAVDLFHAAPGGVRSATAFSQSARWAALDLDAESGCIRDVA-HAYS
ILVD_THEFY       YVDAWDIASPNVRPEAVELFHAAPGGQRSTEAFSQSTRWDSLDLDRESGCIRSVK-HAYT
ILVD_BACFR       AIDKYDITSPNVCEEAIKKYKSAAAGKFNLVLGSQDVYYKELDTDRAEGCIRDIE-HAYS
ILVD_BACFN       AIDKYDITSPNVCEEAIKKYKSAAAGKFNLVLGSQDVYYKELDTDRAEGCIRDIE-HAYS
ILVD_BACTN       AIDQYSITSPNVTEKAMSKYSSAAGNRFNLVLGSQGAYYQELDKDRANGCIRDLE-HAYS
ILVD_PARD8       AVDKYAVTSPNVTEEAIRKYKSAPAHRFSIQMGSQESYYKELDTDRAEGCIRDVE-HAYS
ILVD_BLOFL       TLRQYDIKL-CQDLEIKRMYAAAPAGVRTIKPFSQNNRWNSLDIDRFAGCIRSQE-YAYS
ILVD_BLOPB       TLLNYDIFS-CDNFESKNMYAAAPAGIRSTQAFIQKNRWTSLDTDRRSGCIRSRE-HAYS
ILVD_BUCAI       TLDEYDIFS-TNNPDVINMFQAGPGGIRTTKAYSQNFRWTRLDYDRKNGCIRSCK-HAYS
ILVD_BUCDN       TLKEYDIVL-SKNPDILKMFKAKPAGIRTIQPYSQENRWLTLDYDRKTGCIRSCK-NAYS
ILVD_BUCAP       TLKKYDILS-TKNKNVIKMFHAGPGGNRTIKPFSQNYRWNKLDKDRVNGCIRSHE-NAYS
ILVD_BUCMH       TLNIYDILT-TKDKNIINMFRAGPFGKKTIIPFTQSYRWPKLDKDRQKGCIRSYE-FAFS
ILVD_BUCSC       VLNKYDILK-TKNQDVIEMFHAGPLGNKTSIPFTQSYRWKSLDKDRKKGCIRSYE-NAFS
ILVD_BUCBP       MLSKYSILT-GNDKNIIKMFYAAPSGQKTIKPFSQSCRWNSLDIDRKLGCIRDYN-SAFS
ILVD_BUCCC       TINKFDILK-TKDKKIISFYSSGPGNKKTIYPFSQSFRWKKLDKDRISGCIRSKK-YAYS
ILVD_ACTP2       QIAKYDITL-TKDEAVHKFFRAGPAGIRTTKAFSQDCRWDTVDDDRQNGCIRSKE-FAYS
ILVD_MANSM       QLAKYDIKL-TRDEAVKTFYRSGPAGIRTTEAFSQDCRWETLDDDRENGCIRDKA-HAYS
ILVD_HAES1       QIAKYDIKL-TQDKAIHKFFRAGPAGIRTTQAFLQDCRWDTVDDDRENGCIRSKE-FAYS
ILVD_HISS2       QIAKYDIKL-TQDKAIHKFFRAGPAGIRTTQAFSQDCRWDTVDDDRENGCIRSKE-FAYS
ILVD_PASMU       QIAKYDIVL-TKDEAVHKFFRAGPAGIRTTEAFSQDCRWDTVDDDRENGCIRSKT-FAYS
ILVD_HAEI8       QLDQYDIIR-NQDEELHKFFRAGPAGIRTTQAFSQDCRWDTVDNDRVNGCIRNKE-NAIS
ILVD_HAEIG       QLDQYDIIR-NQDEELHKFFRAGPAGIRTTQAFSQDCRWDTVDNDRVNGCIRNKE-NAIS
ILVD_HAEIN       QLDQYDIIR-NQDEELHKFFRAGPAGIRTTQAFSQDCRWDTVDNDRVNGCIRNKE-NAIS
ILVD_HAEIE       QLDQYDIIR-NQDEELHKFFRAGPAGIRTTQAFSQDCRWDSVDNDRVNGCIRNKE-NAIS
ILVD_ACTSZ       QLNQYDIIR-NKDEKLNKFFRAGPAGIRTTEAFSQDCRWDTVDDDRANGCIRDRA-HAVT
ILVD_AERHH       LLAEYDVSR-QPSQEVVDFYRAGPAGIRTTKAFSQDCRWPELDLDRAEGCIRSLD-NAYS
ILVD_AERS4       LLNEYDVSR-QPSQEVVDFYRAGPAGIRTTKAFSQDCRWPELDVDRAEGCIRSLE-HAYS
ILVD_VIBCH       QLAQYDVKQ-TQDPAVHTMFRAGPAGIRTTQAFSQDCRWDTLDDDRQEGCIRDKA-HAFS
ILVD_VIBC3       QLAQYDVKQ-TQDPAVHTMFRAGPAGIRTTQAFSQDCRWDTLDDDRQEGCIRDKA-HAFS
ILVD_VIBVU       QLAQYDIML-TDSEEVKRFYRAGPAGIRTTQAFSQDCRWDTLDDDRAQGCIRTKE-NAFS
ILVD_VIBVY       QLAQYDIML-TDSEEVKRFYRAGPAGIRTTQAFSQDCRWDTLDDDRAQGCIRTKE-NAFS
ILVD_VIBPA       QLAKYDIML-TDSEEVKSFYRAGPAGIRTTQAFSQDCRWDTLDDDRAEGCIRTKE-NAFS
ILVD_ALIF1       QLAQYDIMQ-TEDEEILKFFRAGPAGIRTTKAFSQDCRWDRLDDDRKEGCIRTKE-NAFS
ILVD_PHOPR       SLAEYDIAV-TESQAVKDFFRAGPAGIRTTKAFSQSCRWDTLDDDRTNGCIRSKE-HAFS
ILVD_ECOLC       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLE-HAYS
ILVD_ECOHS       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLE-HAYS
ILVD_ECO24       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLE-HAYS
ILVD_SHIF8       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLE-HAYS
ILVD_SHISS       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLE-HAYS
ILVD_SHIFL       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLE-HAYS
ILVD_ECOLI       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLE-HAYS
ILVD_SHIBS       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLE-HAYS
ILVD_ECO57       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLE-HAYS
ILVD_SHIDS       TLEQYDVML-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLE-YAYS
ILVD_ECOUT       TLEQYDIIV-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRSNGCIRSLE-HAYS
ILVD_ECOK1       TLEQYDIIV-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRSNGCIRSLE-HAYS
ILVD_ECOL5       TLEQYDIIV-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRSNGCIRSLE-HAYS
ILVD_ECOL6       TLEQYDIVV-TQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRSNGCIRSLE-HAYS
ILVD_SALPB       TLEQYDITV-TQDEAVKKMFRAGPAGIRTTQAFSQDCRWDSLDDDRAAGCIRSLE-YAYS
ILVD_SALTY       TLEQYDITV-TQDEAVKKMFRAGPAGIRTTQAFSQDCRWDSLDDDRAAGCIRSLE-YAYS
ILVD_SALCH       TLEQYDITV-TQDEAVKKMFRAGPAGIRTTQAFSQDCRWDSLDDDRAAGCIRSLE-YAYS
ILVD_SALPA       TLEQYDITV-TQDEAVKKMFRAGPAGIRTTQAFSQDCRWDSLDDDRAAGCIRSLE-YAYS
ILVD_SALTI       TLEQYDITV-TQDEAVKKMFRAGPAGIRTTQAFSQDCRWDSLDDDRAAGCIRSLE-YAYS
ILVD_KLEP7       TLEQYDVMV-TQDDAVKKMFRAGPAGIRTTQAFSQDCRWDTLDDDRAEGCIRSLE-HAYS
ILVD_ENT38       SLEQYDIML-TKDDAVKSMFRAGPAGIRTTKAFSQNCRWDTLDDDRAEGCIRSLE-HAYS
ILVD_YERPE       TLEAYDVML-TQDEGVKQMYAAGPAGIRTTKAFSQDCRYPSLDTDREEGCIRTRE-HAYS
ILVD_YERPA       TLEAYDVML-TQDEGVKQMYAAGPAGIRTTKAFSQDCRYPSLDTDREEGCIRTRE-HAYS
ILVD_YERPN       TLEAYDVML-TQDEGVKQMYAAGPAGIRTTKAFSQDCRYPSLDTDREEGCIRTRE-HAYS
ILVD_YERPP       TLEAYDVML-TQDEGVKQMYAAGPAGIRTTKAFSQDCRYPSLDTDREEGCIRTRE-HAYS
ILVD_YERP3       TLEAYDVML-TQDEGVKQMYAAGPAGIRTTKAFSQDCRYPSLDTDREEGCIRTRE-HAYS
ILVD_YERPS       TLEAYDVML-TQDEGVKQMYAAGPAGIRTTKAFSQDCRYPSLDTDREEGCIRTRE-HAYS
ILVD_YERE8       TLEAYDVML-TKDEGVKQMYSAGPAGIRTTKAFSQDCRFPSLDTDRQEGCIRTRE-HAYS
ILVD_PECAS       TLEAYDVML-TKDESVKRMYSAGPAGIRTTKAFSQDCRWDSLDTDRQEGCIRSRE-YAYS
ILVD_SODGM       TLARYDVMV-SDDAAVKSMYAAGPAGIRTTQAFSQDCRWPSLDTDRQEGCIRARE-FAYS
ILVD_PHOLL       TLNQYDVMQ-TVDESVKEMYSAGPAGIRTTQAFSQDCRWPSLDTDRVEGCIRDIE-HAYS
ILVD_COLP3       VIAKYDITL-TDDEDIKKFYRAGPAGIRTTKAFSQDCRWDTLDDDRVNGCIRNLE-NAFS
ILVD_PSYIN       QLAKYDIMQ-TDDPKIIDFYRAGPAGIRTVKPFSQSCRWDTVDNDRAAGCVRSLE-HAFS
ILVD_SHEB5       VLAQYDVMQ-TQDEKVKHFFMAGPAGIPTTKAFSQDCRWPSLDNDRQEGCIRSRE-FAFS
ILVD_SHEB9       VLAQYDVMQ-TQDEKVKHFFMAGPAGIPTTKAFSQDCRWPSLDNDRQEGCIRSRE-FAFS
ILVD_SHEB8       VLAQYDVMQ-TQDEKVKHFFMAGPAGIPTTKAFSQDCRWPSLDNDRQEGCIRSRE-FAFS
ILVD_SHEPC       VLAKYDVMQ-TQDEKVKHFFMAGPAGIPTTKAFSQDCRWPSLDNDRQEGCIRSRE-FAFS
ILVD_SHESW       VLAKYDVMQ-TQDEKVKHFFMAGPAGIPTTKAFSQDCRWPSLDNDRQEGCIRSRE-FAFS
ILVD_SHESM       VLAKYDVMQ-TQDDNVKQFFMAGPAGIPTTKAFSQDCRWPSLDDDRREGCIRSRE-FAFS
ILVD_SHESR       VLAKYDVMQ-TQDDKVKQFFMAGPAGIPTTKAFSQDCRWPSLDDDRREGCIRSRE-FAFS
ILVD_SHESA       VLAKYDVMQ-TQDDKVKQFFMAGPAGIPTTKAFSQDCRWPSLDDDRREGCIRSRE-FAFS
ILVD_SHEON       VLAKYDVMQ-TQDDNVKQFFMAGPAGIPTTKAFSQDCRWPSLDDDRREGCIRSRE-FAFS
ILVD_SHEDO       VLARYDLVQ-TQDENVRRFFSAGPAGIPTTKAFSQSCRWPSVDDDRQNGCIRSRE-FAFS
ILVD_SHEFN       VLAKYDIKQ-TNDPDVIRFFSAGPAGIPTTKAFSQNCRWDSVDDDRENGCIRSRE-FAFS
ILVD_SHELP       VLVQYDLVQ-TQDEAVQQFYAAGPAGIPTTKAFSQSCRWPSLDVDRQEGCIRTRE-FAFS
ILVD_SHEAM       VLERFDVVL-TKDEKVHEFFRAGPAGIPTTRAFSQSCRWDTLDDDRREGCIRSRE-FAFS
ILVD_SHEHH       VLARFDIVQ-TDDAAVHKFFSAGPAGIPTTKAFSQDCRWDSVDNDRKEGCIRSRE-FAFS
ILVD_SHEPA       VLAKYDIAQ-SDDAAVRKFFSAGPAGIPTTKAFSQDCRWDSVDDDRQQGCIRSRE-FAFS
ILVD_SHESH       VLAKWDIAQ-SSDEAVHRFFSAGPAGIPTTKAFSQACRWDSVDNDRVGGCIRKRE-FAFS
ILVD_PSEA6       VISEWDITQ-PENAHALEFFRAGPAGIRTTKAFSQDCRYPTADTDRENGCIRSRA-NAFS
ILVD1_PSEHT      LVKKWDATD-PTNEAARKFYRAGPAGIRTTKAMSQECRWDEGDNDREHGCIRSVE-HAFR
ILVD1_BURL3      ALDQWDIVR-TQDDAVRTFYQAGPAGVPTQVAFSQNTRWPSLDLDRAEGCIRSYE-HAFS
ILVD_BURVG       ALDQWDIVR-TQDEAVRKFYLAGPAGVPTQIAFSQDTRWPSLDLDRAEGCIRSYE-HAFS
ILVD2_CUPPJ      ALNQWDIVR-TKDEAVRHFYMAGPAGIPTQVAFSQNTRWPSLDLDRAEGCIRSYE-HAFS
ILVD_ACIAC       ALAQWDITR-TQDEAVRHFYMAGPAGIPTQVAFSQNTRWPSLDLDRAEGCIRSVE-HAFS
ILVD_MARMS       ALKSWDIMR-SPTPEIIEFYKAGPAGIPTQTAFSQSTRWPSLDGDRAEGCIRSIE-NAFS
ILVD_SACD2       AIAQWDITQ-TGSAEVAEFYKAGPAGIPTQTAFSQSTRWQSLDGDRADGCIRSVE-HAYS
ILVD_PSEAE       AIAQWDITQ-TRDEAVHTFFKAGPAGIPTQTAFSQNTRWPSLDDDRAEGCIRSVE-HAYS
ILVD_PSEAB       AIAQWDITQ-TRDEAVHTFFKAGPAGIPTQTAFSQNTRWPSLDDDRAEGCIRSVE-HAYS
ILVD_PSEA7       AIARWDITQ-TRDEAVHTFFKAGPAGIPTQTAFSQNTRWPSLDDDRAEGCIRSVE-HAYS
ILVD_PSEMY       AIAQWDITQ-TRDEKVHTFFKAGPAGIPTQVAFSQSTRWDTLDDDRENGCIRSVE-HAYS
ILVD_PSEU5       AIAEWDITQ-TQDEAVHTFFKAGPAGIPTQVAFSQATRWPSLDLDRAEGCIRSVE-HAYS
ILVD_PSEP1       AIAKWDITQ-TDDEAVHTFFKAGPAGIPTQTAFSQSTRWETLDDDRENGCIRSFE-HAYS
ILVD_PSEPK       AIAKWDITQ-TDDEAVHTFFKAGPAGIPTQTAFSQSTRWETLDDDRENGCIRSFE-HAYS
ILVD_PSEPG       AIAKWDITQ-TDDEAVHTFFKAGPAGIPTQTAFSQSTRWETLDDDRENGCIRSFE-HAYS
ILVD_PSEE4       AIAKWDITQ-TDDEAVHTFFKAGPAGIPTQTAFSQSTRWETLDDDRAEGCIRSVE-HAYS
ILVD_PSEPF       AIAKWDITQ-TDDEAVHHFFKAGPAGIPTQTAFSQSTRWETLDDDRENGCIRSFE-HAYS
ILVD_PSEF5       GIAQWDITQ-TSDEAVHHFFKAGPAGIPTQTAFSQSTRWDSLDDDRENGCIRSVE-HAYS
ILVD_PSE14       GIAKWDITQ-TDDEAVHTFFKAGPAGIPTQTAFSQSTRWDSLDDDRENGCIRSVE-HAYS
ILVD_PSEU2       GIAKWDITQ-TDDEAVHTFFKAGPAGIPTQTAFSQSTRWESLDDDRENGCIRSVQ-HAYS
ILVD_PSESM       GIAKWDITQ-TDDEAVHTFFKAGPAGIPTQTAFSQSTRWESLDDDRENGCIRSVE-HAYS
ILVD_XANAC       AIAQWDVTQ-TDDENVHTFYKAGPAGIPTQIAFSQATRWDSLDTDRSDGCIRDVA-HAFS
ILVD_XANC5       AIAQWDVTQ-TDDETVHTFYKAGPAGIPTQIAFSQATRWDSLDTDRSEGCIRDIA-HAFS
ILVD_XANOR       AIAHWDVTQ-TVDENVHTFYKAGPAGIPTQIAFSQATRWDSLDTDRSEGCIRDVA-HALS
ILVD_XANOM       AIAHWDVTQ-TVDENVHTFYKAGPAGIPTQIAFSQATRWDSLDTDRSEGCIRDVA-HALS
ILVD_XANCP       AIAQWDVTQ-VDDDKVHTFYKAGPAGIPTQIAFSQATRWDTLDTDRSEGCIRDVA-HAFS
ILVD_XANC8       AIAQWDVTQ-VDDDKVHTFYKAGPAGIPTQIAFSQATRWDTLDTDRSEGCIRDVA-HAFS
ILVD_XYLFA       AIATWDIIG-TQDEAVHTFYKAGPAGISTQVAFSQSTRWPSLDTDRTEGCIRDME-HAFS
ILVD_XYLFT       AIATWDIIG-TQDEAVHTFYKAGSAGIPTQVAFSQSTRWPSLDTDRTEGCIRDME-HAFS
ILVD_HAHCH       ALDAWDVMR-NNDPELHKFFKAGPAGIPTQQAFSQSTRWSSLDLDRENGCIRSAE-HAFS
ILVD_RHORT       ALDHWDIRR-PVDDAVRAFFRAAPGGVRTVVPFSTDRLWDSLDDDRETGCIRDLD-HAYS
ILVD_HYDCU       AIDLWDITR-TDDEAVKTFYRAAPGNVRTTEAFSQNKRWKTLDDDDANGCIRSVE-HAYT
ILVD_CAUVC       ALARWDIGRTN-SQIAHEFFKAAPGGKPTQVAFSQAARWEELDLDRENGVIRSVE-HPFS
ILVD_GRABC       ALERWDIGRTS-SEEVRTFFRAAPGGVPTQVAFSQSARWDSVDEDRQKGVIRSTE-HPFS
ILVD_ZYMMO       ALDAWDISRDSCSEEAQLFYRAAPGGVPTQKAFSQSSRYEALDTDREKGVIRSKN-HAFS
ILVD_GLUOX       ALKKWDILNGD--EEAAHLFKAAPGNVRTVHAFSQSSRYHELDQDREGGVLRDKA-HAFS
ILVD_AZOSB       ALGRWDIMQAHD-KAVFDFFLAAPGGVPTQVAFSQNRRWNELDMDRAKGVIRNKA-NAFS
ILVD2_AROAE      ALSRWDVMQAHD-NAVFEFYKAAPGGVPTQVAFSQNRRWKELDMDRSHGVIRDRA-NAFT
ILVD_DECAR       AIDRWDVVRQHD-VKVHEFFKAAPGGVPTQVAFSQDRRFNELDIDRTHGCIRNKA-NAYS
ILVD1_BORBR      AINQWDINGGAG-EAAQKFFRAAPGGIPTTVAFSQDATFLTLDMDRQTGCIRDKA-HAYS
ILVD1_BORPA      AINQWDINGGAG-EAAQKFFRAAPGGIPTTVAFSQDATFLTLDMDRQTGCIRDKA-HAYS
ILVD1_BORPE      AINQWDINGGAG-EAAQKFFRAAPGGIPTTVAFSQDATFLTLDMDRQTGCIRDKA-HAYS
ILVD_BORA1       AIAQWDVAGGAG-EAAQTFYRAAPGGVPTTVAFSQDKTFLTLDLDRKAGCIRSKE-HAYS
ILVD_NEIMA       AIEKWDVTNPEN-THAIERFKAAPGGVRTTQAFSQNRMWKTLDLDREKGCIRDVA-HAYS
ILVD_NEIMF       AIEKWDITNPEN-TRAIERFKAAPGGVRTTQAFSQNRMWKTLDLDREKGCIRDVA-HAYS
ILVD_NEIMB       AIEQWDVTNPEN-TRAIERFKAAPGGVRTTQAFSQNRMWKTLDLDREKGCIRDVA-HAYS
ILVD_NEIG1       AIEKWDVTNPEN-TRAIERFKAAPGGVRTTQAFSQNRIWKTLDLDREKGCIRDVA-HAYS
ILVD_PSYA2       AIDKWDIMNPDN-LEARARYIAAPGGVRTTEAFSQSKEWSNLDVNRESGCIRSAQ-HAYS
ILVD_CHRVO       AIEQWDVMRHGEGSEPHRLFRAAPGGVATTIAFSQSMRYPTLDDDRADGCIRDQA-HAYS
ILVD_METFK       ALDKWDIMTTND-EDVKKFYRAAPGGISTTIAFSQSMLWPDLDTDRKEGCIRDKD-HAYS
ILVD_SYNP6       ALDQWDINRETATEEAKSRYLAAPGGVPTQEAFSQSKRWTALDLDRENGCIRDIE-HAYS
ILVD_SYNE7       ALDQWDINRETATEEAKSRYLAAPGGVPTQEAFSQSKRWTALDLDRENGCIRDIE-HAYS
ILVD_NITOC       ALDQWDIVR-SSYEAAQSRYLAAPGGVPTQVAFSQGNRWESLDLDRAQGCIRDIA-HAYS
ILVD_NOVAD       ALNQWDVKR-TNSPTVQEFFRAAPGGVPTQVAFSQDRRWKELDLDRETGVIRSAE-HAFS
ILVD_SPHAL       ALNKWDIAR-TNDPEVQKFFMAAPGGVPTQTAFSQARRWDSLDLDRISGVIRSAD-HAFS
ILVD1_ACIAD      ALNKWDIIR-TEDADVYEFFRSSPGGVPTQVAFSQNRYYSTLDGDRENGVIRNAE-HAFS
ILVD_DEIRA       ALNEWDVVR-NEN--HHEFYRAAPGGIPTVFAFSQSRRYRELDTDREAGVIRSAE-HAFS
ILVD_RHIEC       AIDRWDITR-TTSDTVRDFYRAAPGGIPTQVAFSQEARWDELDTDRQNGVIRSVE-HPFS
ILVD_RHIL3       AIDRWDITR-TNSETVRKFYRAAPGGIPTQVAFSQEARWDELDTDRENGVIRSVE-HPFS
ILVD_RHIME       AIDRWDITR-TSSDTVRKFFRAAPGGIPTQVAFSQEARWDELDTDRENGVIRSVE-HPFS
ILVD_SINMW       AIDRWDITR-TSSETVRNFFRAAPGGIPTQTAFSQAARWDELDTDRQNGVIRSVE-HPFS
ILVD_AGRFC       AIDRWDITR-TNSEMVRQFFKAAPGGVPTQVAFSQSSRWDDLDTDSDNGVIRSVE-KPFS
ILVD1_RHILO      ALDHWDISR-TSSQNVRDFFLAAPGGVPTQVAFSQDRRWDELDLDREKGVIRSAE-TPFS
ILVD_BRUAB       ALDHWDVTR-TNSEMVHKFYSAAPGGVPTQVAFSQERRFDKVDTDREKGVIRSKE-HAFS
ILVD_BRUA2       ALDHWDVTR-TNSEMVHKFYSAAPGGVPTQVAFSQERRFDKVDTDREKGVIRSKE-HAFS
ILVD_BRUO2       ALDHWDVTR-TNSEMVHKFYSAAPGGVPTQVAFSQERRFDKVDTDREKGVIRSKE-HAFS
ILVD_BRUC2       ALDHWDVTR-TNSEMVHKFYSAAPGGVPTQVAFSQERRFDKVDTDREKGVIRSKE-HAFS
ILVD_BRUSU       ALDHWDVTR-TNSEMVHKFYSAAPGGVPTQVAFSQERRFDKVDTDREKGVIRSKE-HAFS
ILVD_BRUME       ALDHWDVTR-TNSEMVHKFYSAAPGGVPTQVAFSQERRFDKVDTDREKGVIHSKE-HAFS
ILVD_BRUSI       ALDHWDVTR-TNSEMVHKFYSAAPGGVPTQVAFSQERRFDKVDTDREKGVIRSKE-HAFS
ILVD_OCHA4       ALDHWDVTR-TNSDMVHKFYSAAPGGVPTQVAFSQERRFDSVDTDREKGVIRSKE-HAFS
ILVD_RHOP5       AIDRWDISR-TNSDSVRQFYLAAPGGVPSQTAFSQSQRWDSLDTDRENGVIRSKA-HAFS
ILVD_NITHX       GLERWDIKR-TKSDSVRSFYLAAPGGVRTQVAFSQDKRFEELDADRSSGCIRDAE-HAFS
ILVD_NITWN       ALERWDIKR-TKSESVRTFYTAAPGGVRTEIAFSQDKRFEELDADRAKGCIRDAE-HAFS
ILVD_AZOC5       ALERWDVTR-TKAESVTTFYRAAPGGVPTQVAFSQSRRWDDLDTDRASGVIRDFE-HAYS
ILVD_RHOPA       ALARWDIRQ-SNSESVRTFFRAAPGGVPSQTAFSQDRRYDELDLDREKGVIRDAA-HAFS
ILVD_RHOP2       ALARWDIRQ-SNSEAVRTFYRAAPGGVPTQVAFSQDRRYDELDLDRQKGVIRDAE-HAFS
ILVD1_BRADU      ALERWDIKR-SKSEAVRTFYRASPGGIPTQVAFSQERRYDELDADREKGVVRDLE-HAFS
ILVD_BARHE       ALCRWDVKR-TNEPKTHEFYRAAPGGISTQTAFSQSRRYDSLDLDREKGIIRDKE-HAYS
ILVD_BART1       ALDHWDIKQ-TNEPTVCAFYRAAPGGIPTQRAFSQSCRYETLDLDRAKGVIRDKE-HAYS
ILVD_RHOS4       AIDQWDIGR-SNAPEARELFLAAPGGVPTQVAFSQSSTWDTLDTDRETGVIRSVA-TPFS
ILVD_RHOS1       AIDQWDIGR-SNAPEARELFLAAPGGVPTQVAFSQSSTWDTLDTDRETGVIRSVA-TPFS
ILVD_PARDP       AIDQWDIAR-SNDPQARELFLAAPGGVPTQVAFSQATLWPDLDLDREHGVIRSAK-APFS
ILVD_RUEPO       AIAKWDIKV-ANNPEAESLFKAAPGGVRTTQAFSQSNRYKDLDTDREGGVIRSKE-HAFS
ILVD_RUEST       AIAHWDIAV-ADNQAAKDLFKAAPGGVRTTQAFSQSNRFKDLDIDRKGGVIRSKE-HAFS
ILVD_HYPNA       ALSKWDIAV-TNNPEVQELFLAAPGGVRTTQAFSQARRYKDLDTDREKGVIRSAK-HAFS
ILVD_MAGSA       GLDRWDISR-SNDPKVVEFYKAAPGGVRTTEAFSQSKRWAEVDKDRTAGVIRSVD-NAFS
ILVD_ACICJ       AIDRWDVMR-GGE-TAKTLYSAAPGGVRTTEAFSQSRRYESLDLDREKGVIRDAE-HAFS
ILVD_MAGMM       ALKKEDIVSPQVTEEALTRCYAAPGGIPTIEPYSQSARWESLDDDRVDGCIRGGE-HAYS
ILVD_NOSS1       VLADIPEEP-----------------------------------SPNQDVIRPWN-NPMY
ILVD_TRIEI       QLTNIPSEP-----------------------------------PSNQDVIRPWN-NPMY
ILVD_ACAM1       QLADVPSEP-----------------------------------SPDQDVIRPWD-NPMY
ILVD_MICAN       ILADIPDQP-----------------------------------PSGQDVIRPFS-NPVY
ILVD_SYNY3       VLADIPDQP-----------------------------------PAGQDVIHSWD-DPVY
ILVD_THEEB       RLRHVPDTP-----------------------------------DPNQDVIRPFD-QPLY
ILVD_SYNJB       VLRDVPDEP-----------------------------------SPDQEVIRPWH-SPLY
ILVD_SYNJA       VLRDVPDEP-----------------------------------SPDQEVIRPWH-SPLY
ILVD_GLOVI       VLRDVPTEP-----------------------------------RTDQEVIRPWD-RPLY
ILVD_NITEU       VLKDIPEQP-----------------------------------RADQDVIQPWD-NPVY
ILVD_NITEC       VLKDIPEQP-----------------------------------RADQNVIRTWD-NPVY
ILVD_NITMU       ILKDVPSEP-----------------------------------REDQDVIRQWD-NPLY
ILVD_CHLAA       TLADVPDEP-----------------------------------PANQDVIRPFS-QPIY
ILVD_DEIGD       NLADVPDQP-----------------------------------DPGQDVILPFD-QPLY
ILVD_HALHL       LIGHLPPEP-----------------------------------PADQEIIMPFD-RPLY
ILVD_PROMS       YLQNIPDKP-----------------------------------PTNQNVIRDID-NPLY
ILVD_PROM9       YLQNIPDKP-----------------------------------PTNQNVIRDID-DPLY
ILVD_PROM0       YLQNIPDKP-----------------------------------PTNQNVIRDIH-DPLY
ILVD_PROM2       YLQNIPDKP-----------------------------------PSNQNVIRGID-YPLY
ILVD_PROM5       YLLNIPDNP-----------------------------------PENQNVIRNIN-NPLY
ILVD_PROMP       SLKDIPVKP-----------------------------------PENQDVIRDID-NPLY
ILVD_PROMA       MLLDVPAEP-----------------------------------PSDQDVIRPFD-SPVY
ILVD_PROM3       LLKDVPSEP-----------------------------------SAEQDVIHPLS-KPVY
ILVD_PROMM       LLKDVPSEP-----------------------------------SAEQDVIHPLS-KPVY
ILVD_SYNSC       LLADVPSEP-----------------------------------PAGQEVIRPLS-NPLY
ILVD_SYNPX       VLADVPSVP-----------------------------------PADQDVIRPLS-NPLY
ILVD_SYNS9       LLADVPSEP-----------------------------------PADQEVIRPLT-NPMY
ILVD_SYNR3       VLADVPSEP-----------------------------------PADQEVIRPLS-NPLY
ILVD_PROMT       VLRDIPSKP-----------------------------------KENQDVIRQIS-NPIY
ILVD1_AROAE      VLENVPAAP-----------------------------------RADQGVIRTLS-DPLY
ILVD3_AROAE      VLENVPAAP-----------------------------------RADQGVIRTLS-DPLY
ILVD3_BORBR      TLANVPDAP-----------------------------------PPGQDVIMPIE-RALY
ILVD2_BORPA      TLANVPDAP-----------------------------------PPGQDVIMPIE-RAFY
ILVD2_BORPE      TLANVPDAP-----------------------------------PPGQDVIMPIE-RALY
ILVD_BURMA       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURM9       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURM7       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURMS       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURPS       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURP6       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURP1       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURP0       ELKDVPSVP-----------------------------------RADQKVIHPID-QALY
ILVD_BURTA       ELKDVPSVP-----------------------------------RADQKVIYPID-QALY
ILVD2_BURL3      ELKDVPSVP-----------------------------------RADQDVIFPID-RALY
ILVD1_CUPPJ      ELEHVPDQP-----------------------------------RADQDVIMPIE-KALY
ILVD_RALSO       ELANVPDQP-----------------------------------RADQDVILPIE-RALY
ILVD_HERAR       ALAHIPSVP-----------------------------------SADQDVIHTID-KALY
ILVD_JANMA       ALAHIPSVP-----------------------------------RADQHVIHPIK-DALY
ILVD_POLNA       VLADVPDAP-----------------------------------RAGQDVIRPID-QPMY
ILVD_POLSJ       VLKDVPEAP-----------------------------------RADQDVIRPIS-NPMY
ILVD_RHOFT       VLKDVPDAP-----------------------------------RADQNVIRPMN-KPMY
ILVD_VEREI       VLKDVPDRP-----------------------------------RADQNVIRPID-QPLY
ILVD_METPP       NLADIPDAP-----------------------------------RADQDVIRPIT-KPMY
ILVD_TREPR       ELLAA-HRK-----------------------------------RHGSTVVLPTN-MALY
ILVD_CHRSD       NLADVTPYP-----------------------------------TG-QEIIKPLE-APIK
ILVD2_PSEHT      NLADVADYP-----------------------------------AG-QNIILPFD-KPIK
ILVD2_ACIAD      NLAEVEDYP-----------------------------------AD-QQIILPFE-QPVK
ILVD_METCA       NLADAPDYP-----------------------------------AG-QDMIRSLD-NPIK
ILVD_RUTMC       NLENVKPYA-----------------------------------DS-QEIIRALD-NPIK
ILVD_LACLS       NVETALDLD-----------------------------------FDSQDIIRPLE-NPIK
ILVD_LACLA       NVETALDLD-----------------------------------FDSQDIMRPLK-NPIK
ILVD_CYTH3       NLKEAQDLP-----------------------------------TD-QDLMYAWE-NPIK
ILVD_FRATN       NLENVADLP-----------------------------------ED-NTIIHKLD-NPIK
ILVD_FRATT       NLENVADLP-----------------------------------ED-NTIIHKLD-NPIK
ILVD_FRAP2       NLESVADLP-----------------------------------ED-NTIIHKLD-NPIK
ILVD_RHOBA       NLADLPGLK-----------------------------------TG-QKIVSTVE-EPIK
ILVD_LEPBJ       NLMDMPDLV-----------------------------------PN-QTIVRKKS-EALH
ILVD_LEPBL       NLMDMPDLV-----------------------------------PN-QTIVRKKS-EALH
ILVD_LEPIN       NLKDMPDLV-----------------------------------PN-QTIVRKKS-EALH
ILVD_LEPIC       NLKDMPDLV-----------------------------------PN-QTIVRKKS-EALH
ILVD_STRPN       NLADFADLT-----------------------------------PG-QKVIMPLE-NPKR
ILVD_STRR6       NLADFADLT-----------------------------------PG-QKVIMPLE-NPKR
ILVD_STRP2       NLADFADLT-----------------------------------PG-QKVIMPLE-NPKR
ILVD_STRT2       NLEAFDDLT-----------------------------------PG-QKVIMPLE-NPKR
ILVD_STRT1       NLEAFDDLT-----------------------------------PG-QKVIMPLE-NPKR
ILVD_STRSY       NLKNFADLT-----------------------------------PG-QDVIMPLE-NPKR
ILVD_STRS2       NLKNFADLT-----------------------------------PG-QDVIMPLE-NPKR
ILVD_STRSV       NLVEFADLT-----------------------------------PG-QKVIMPLE-NPKR
ILVD_STRMU       NLKAFDDLT-----------------------------------PG-QKVIMPLE-NPKR
ILVD_OCEIH       NLAEAPALK-----------------------------------EN-QQVIMPFD-NPKR
ILVD2_STAS1      NLEQQPDLT-----------------------------------DN--KSIIDFD-NPKH
ILVD_ROSCS       EAADAV-------------------------------------ETPGQDVIRPLD-NPIK
ILVD_ROSS1       EAADAV-------------------------------------ETPGQDVIRPLD-NPIK
ILVD_KORVE       EAKQAK-------------------------------------ETPGQEVVRPLT-DPIK
ILVD_THET2       EVERAYR------------------------------------EQEGQKVVFPVE-KALK
ILVD_THET8       EVERAYR------------------------------------EQEGQKVVFPVE-KALK
ILVD_HALMA       ELEQIDP----P-----------------------------TVEDLDVDYLNTVE-DPIH
ILVD_NATPD       ELAHLESEHGLP-----------------------------TDDEIDADFLYPVD-DPKE
ILVD2_BORBR      ALADTPA--------------------------------------PDGKVVRACG-QALH
ILVD3_BRADU      EYGAANA--------------------------------------PDGEVVYAAS-APIM
ILVD2_BRADU      NLKSVKWN-------------------------------------PHQDVVHPAD-KPIT
ILVD2_RHILO      NMEHVAWN-------------------------------------EHQDVVRPAN-RPIT
ILVD_PARL1       NLKDVKFN-------------------------------------PDQKVVYPLS-NPLS
ILVD_PELUB       NLKNIKFN-------------------------------------PKQKVLRAYD-NPLS
ILVD_DINSH       ELDKVTLE-------------------------------------ADGRVIYPVD-TPLS
ILVD_PYRAR       LLERWEPPA-----------------------------------VPEAGILYDVE-KPYK
ILVD_PYRIL       LLERWQPPS-----------------------------------VPEDGILYSVE-KPYK
ILVD_PYRAE       LLDRWQPPP-----------------------------------LPEAGVLYDVD-RPYK
ILVD_PYRCJ       LLERWEPPA-----------------------------------VPEAGVLYDVD-RPYK
ILVD_AERPE       LLSKWEPR-------------------------------------TDYNILYDFD-KPYK
ILVD_METS5       NLSEYKIPE-----------------------------------FKHDHIVRDLS-NPFL
ILVD_SULTO       NLEEYKLPN-----------------------------------VPHEHIVRPIS-NPFN
ILVD_PICTO       NLNEIKILN-----------------------------------IKQD-IVYDIE-RPKM
ILVD_SULAC       NLQEYRIPN-----------------------------------VPHNHIVKDVK-NPIK
ILVD_SACS2       NLEQYKYPN-----------------------------------VPHSHIVRDVK-NPIK
ILVD_MYCA1       NLAAIAPPD------------------------------------PDGKVLRALS-DPLH
ILVD_MYCPA       NLAAIAPPD------------------------------------PDGKVLRALS-DPLH
ILVD_MYCUA       NLEAIAPPD------------------------------------PDGKVLRALI-NPIH
ILVD_MYCBO       NLAAITPPD------------------------------------PDGKVLRALA-NPIH
ILVD_MYCTU       NLAAITPPD------------------------------------PDGKVLRALA-NPIH
ILVD_MYCLE       NLASIAPPD------------------------------------PDGQVIRTLH-NPIH
ILVD_MYCSJ       NLAHIEPPD------------------------------------PDGKVLRAMN-NPIH
ILVD1_NOCFA      NLAHIAPPD------------------------------------PDGKVVRALN-DPIH
ILVD_ACIC1       NLADITPPD------------------------------------PDGKVIHALT-QPIH
ILVD_NOCSJ       NLAELAPPE------------------------------------LDDEVIRKLD-RPIH
ILVD_ARTS2       NLASINPPD------------------------------------LDGKILRALD-NPIH
ILVD_RENSM       NLEAINPPD------------------------------------LDGKILRALD-NPIH
ILVD_CLAM3       NLEAMDLAE------------------------------------LDGTVIRKMD-DPIH
ILVD_CLAMS       NLEAMDLAD------------------------------------LDGTVIRKMD-DPIH
ILVD_LEIXX       NLAEIDPPA------------------------------------PDGTVLRSLD-NPIH
ILVD_TROW8       EISDINPGL------------------------------------PDGKVIHSFS-SPLH
ILVD_TROWT       EISDINPGL------------------------------------PDGKVIHSFS-SPLH
ILVD2_COREF      NLQGINPPD------------------------------------PDGQILRAID-NPIH
                                                                   :      .  

ILVD_CALS8       ETGGLVIVRGNLAPDGAVVKKSAVPPK-LMRHRGPARVFESGEEVFEAILKG-KIQKGDV
ILVD_HUNT2       PTGGIAVLRGNLAPDGAVVKRSAVAPE-MLVHKGPARVFDSEDAAIEAIYNG-KINKGDV
ILVD_CALS4       KTGGIAILFGNIAREGAVVKASAVSPE-MLRHEGPARVFDSEEEAIEAIYGG-KIQKGDV
ILVD_CLOB8       QTGGIAVLKGNLAPDSCVVKRSAVVPK-MLKHEGPAKVFDCEEDALEAINTG-KIVAGDV
ILVD_CLOK5       TTGGIAILKGNLAPDSCVVKRSAVAPE-MLKHEGPARVFDCEEDALNAINTG-KIVAGDV
ILVD_LACP7       QTGGIAVLKGNLAPDSGVVKRSAVAPE-MMVHVGPARVFDCEEDAIDAIKSG-KIVAGDV
ILVD_CLOAB       ETGGLSVLRGNLAPDGAIVKKAAVAPE-MMQHTGPARVFNSEEEVSKAILGG-KINPGDV
ILVD_CARHZ       ETGGLAILFGTLAPRGAVVKKSAVLPE-MLTHTGPARVFDSEEDATTAILTG-QIKKGDV
ILVD_MOOTA       REGGLAVLYGNLAPEGAVVKKGAVLPE-MMRHEGPARVFNSEEEAFAAIMGK-QIKPGDV
ILVD_SYNFM       NEGGIAILYGNLAPEGAVVKQSAVAPE-MLQRTCRARVFESETDAAGGILDG-KIKPGDV
ILVD_SYNAS       QEGGIAILRGNLAPDGAVVKQSGVLPE-MMINEGTARVFDSEDEAIAAILGG-KIVAGDI
ILVD_DESVH       PQGGIAILKGSLAPGGAVVKQSAVAPE-MMVREAVARVFDSEEAACEAIMGG-RIKAGDA
ILVD_DESVV       PQGGIAILKGSLAPGGAVVKQSAVAPE-MMVREAVARVFDSEEAACEAIMGG-RIKAGDA
ILVD_DESAG       PQGGIAILYGSLAPEGAVVKQSAVAPE-MMQRTARARVFESEEAAFEAIMAQ-RIEKGDA
ILVD_THEMA       KEGGLGILFGNLAPEGAVAKLSGVPEK-MMHHVGPAVVFEDGEEATKAILSG-KIKKGDV
ILVD_THEP1       KEGGLGILFGNLAPEGAVAKLSGVPEK-MMHHVGPAVVFEDGEEATKAILSG-KIKKGDV
ILVD_PYRAB       SRGGLMILYGSLAPKGAVLKVSAIPD--IETFEGEARVFDCEEDAVKAILSG-DIEKGDV
ILVD_PYRFU       PRGGIMILRGTLAPNGAVIKVSAVEG--VEVFEGPAKVFDSEEEATAAILSG-KIERGDV
ILVD_CLONN       NEGGIAILRGNLAPDGAVVKQSAVEPE-MLYHKGVARVFDGEELAFDAIMNK-KIHPGDV
ILVD_IGNH4       PFGGLAILKGSLAPNGAVVKASAVKRE-LWKFKGVARVFDREEDAVKAIRGG-EIEPGTV
ILVD_GEOMG       KEGGIAVLFGNLAPKGAVVKQSGVSAP-MMQFEGTARCFDSEELAMAALMGG-KITSGDV
ILVD_GEOSL       KEGGIAVLFGNLAPKGAVVKQSGVSDA-MMTFEGTARCFDSEEAAMAALMGG-RIVAGDV
ILVD_GEOUR       KEGGIAILFGNLAPKGAVVKQSGVSEA-MMKFIGTARCFNSEEAAMAALMDG-NIKAGDL
ILVD_PELPD       KEGGIAVLFGNIAPKGAVVKQSGVSDK-MMKFEGTARCFDSEELAMAALMEG-EIVAGNV
ILVD_PELCD       PEGGIAILTGNLTPDGAVVKQSGVSEK-MMTFEGTARCFNSEEEAMQALMGG-QVKAGDV
ILVD_METMJ       PAGGLKIVRGSLAPDGAVVKCAAVPEA-MWRHRGPARVFDGEGAAMEAILHR-EIAEGDV
ILVD_METB6       PAGGLRILFGSLAPDGAVVKSAAVPKE-IWKHTGPARVFESEEPAMAAILSR-QIHEGDA
ILVD_METHJ       QSGGLMILTGSLAPDGAVIKSGAVQDE-MWKHTGPARVFDGEELAMKAILAR-EIKEGDI
ILVD_ARCFU       KEGGIAILKGNLAENGAVIKAAAVSED-MMRFEGTAKVYDSEKEALNAILDG-KVEEGDV
ILVD_METTH       SEGGLAILRGNLAPRGSVVKQGAVAED-MMVHEGPAKVFNSEDECMEAIFGG-RIDEGDV
ILVD_METST       TEGGIAVLYGNVAPNGCVIKQGAVNED-MLVHSGPCKVFNSEEECVLAIEND-EIIDGDV
ILVD_METS3       KDGGIAILKGNIAPNGSVVKKGAVSPD-LMHLKGPAKVFNSEEEVTQAIFDH-EVEEGDI
ILVD_METJA       ETAGLRILKGSLAPNGAVVKIGAVNPK-MYKHEGPARVFDSEEEAVDAILGG-DIERGDV
ILVD_META3       ETAGLRILKGNIAPDGCVVKISAVNPK-MYKHEGPARVFNSEEETIDAILGG-DIKEGDV
ILVD_METM5       ETAGLRVLKGNLAPNGCVVKIGAVDPK-MHKHEGPAKVYNSEDEAIAAILGG-KIVEGDV
ILVD_METM7       ETAGLRVLKGNLAPNGCVVKIGAVNPK-MYKHDGPAKVYNSEDEAISAILGG-KIVEGDV
ILVD_METMP       ETAGLRVLKGNLAPNGCVVKIGAVHPK-MYKHDGPAKVYNSEDEAISAILGG-KIVEGDV
ILVD_METVS       ETAGLRVLKGNIAPNGCVVKIGAVNPK-MYKHEGPAKVFNSEDDAISAILGG-KIVSGDV
ILVD1_METAC      AEGGIAVLKGSLAPDGSVVKQAAVDPK-MRVHTGPAKVYDCEEDAMKSILAG-DVKPGDI
ILVD_METMA       AEGGIAVLKGSLAPDGSVVKQAAVDPK-MRVHTGPAKVYDCEEDAMKSILAG-EVKPGDI
ILVD2_METAC      AEGGIAVLKGSLAPDGSVVKQAAVDPK-MHVYTGPAKVYDCEEDAMKSILAG-DVKPGDI
ILVD_METBF       AEGGIAVLKGNLAPNGSVVKQAAVDPK-MRVHTGPAKVYDCEEDAMENILAG-NVKPGDI
ILVD_METBU       EEGGIAVLKGNLAPDGSVVKQSAVHEK-MLRHTGPARVFDSEEEAMETILKG-DIKSGDV
ILVD_METTP       PEGGIAILKGSLAPEGSVVKQTAVSKK-MLVHKGPAVVYDSEEESMKGILSG-EVKAGDV
ILVD_METKA       EEGGIVVLYGNLAPKGAVIKTAALSEE-MYEHEGPAVVFDSEEEATEAILGG-DIDPGDV
ILVD_DEHMB       PKGGLAVLFGNLAPNGSVVKRSAVAPE-MMVHRGPARIFDSEELATKAIMGG-KIKTGDV
ILVD_DEHMC       PKGGLAVLFGNLAPNGSVVKRSAVAPE-MMVHRGPARIFDSEELATKAIMGG-KIKPGDV
ILVD_DEHM1       PKGGLAILFGNLAPSGSVVKRSAVAPE-MMVHRGPARIFDSEELATKAIMGG-KIIPGDV
ILVD_ANADE       PVGGLAVLFGNLAAEGAVVKTAGIQ-PSMRTFTGEAICFDSQDEAIAGIMGG-KVKPGHF
ILVD_ANADF       AVGGLAVLFGNLAPEGAVVKTAGIQ-PSMRKFTGRAICFDSQEEAIAGIMGG-KVKPGHF
ILVD_ARCB4       QVGGLAILYGNLAEQGAVIKTAGIT-GS-RVFTGTAVCFDGQPEAIKGIVSG-KVKAGNV
ILVD_SULNB       EVGGLAILYGNLAEQGAVIKTAGIT-GD-RAFTGTAVCFDSQDEAIEGILSG-KVKAGNV
ILVD_NITSB       EVGGLAILFGNLAEEGAVVKTAGID-PNMREFTGKAICFDSQQEAIDGILGG-KVKPGHV
ILVD_SULDN       QVGGLSILFGNLATEGAVVKTAGIE-LNMRQFKGTAICFNSQPEAITGIMKH-KVKPGNV
ILVD_HELHP       PVGGLKILYGNLAREGAVLKVAAVA-ESMKEFEGSAVCFNSQEEAIKGIAGG-KVKAGNV
ILVD_WOLSU       AVGGLKILYGNLAEQGAVLKTAAMD-AKMRKFTGKAVCFDSQEEAIAGIVGG-KVKEGDV
ILVD_CAMFF       KVGGLAILFGNLAEQGCVIKAAGII-GS-RQFSGKAVCFNSQDEAIKGISKG-KVQKGDV
ILVD_CAMHC       KVGGLAILFGNLAEQGCVIKAAGII-GS-RKFSGKAICFNSQDEAIEGISGG-KVKKGDV
ILVD_CAMC5       KVGGLAILFGNLAEQGCVIKTAGIV-GE-RKFSGKAVCFNSQDEAIAGISSG-KVGKGDV
ILVD_CAMJE       KVGGLAILFGNLAKQGCVIKTAGII-GE-RKFKGKAVCFNSQDEAIKGIIKG-KVQKGNV
ILVD_CAMJR       KVGGLAILFGNLAEQGCVIKTAGII-GE-RKFKGKAVCFNSQDEAIKGIIKG-KVQKGNV
ILVD_CAMJD       KVGGLAILFGNLAEQGCVIKTAGII-GE-RKFKGKAVCFNSQDEAIKGIIKG-KVQKGNV
ILVD_CAMJJ       KVGGLAILFGNLAEQGCVIKTAGII-GE-RKFKGEAVCFNSQDEAIKGIIKG-KVKKGNV
ILVD_CAMJ8       KVGGLAILFGNLAEQGCVIKTAGII-GE-RKFKGKAVCFNSQDEAIKGIIKG-KVQKGNV
ILVD_AQUAE       KDGGIAILFGNLAPEGAVVKTAGVD-PKMLTFKGKAICFDSEEEAIEGILGG-KVKPGHV
ILVD_BACVZ       EKGGLAVLFGNLAPDGAIIKTGGVQ-DGITRHEGPAVVFDSQDAALEGIINR-KVKEGDV
ILVD_BACSU       EKGGLAVLFGNLAPDGAIIKTGGVQ-NGITRHEGPAVVFDSQDEALDGIINR-KVKEGDV
ILVD_BACP2       EKGGLAVLFGNLAPDGAIIKTGGVQ-DGITRHEGPAIVFESQEEALEGIINR-KVEAGHV
ILVD_BACLD       EQGGLAVLFGNLAPDGAIIKTGGVQ-DGITRHEGPAVVFDSQEEALDGIINR-KVKAGDV
ILVD_GEOKA       ETGGLTILFGNLAPDGAVIKTGAVQ-GGITRHEGPAIVFDSQEEALEGIASG-KIKPGHV
ILVD_BACAH       EEGGLRILKGNLAKDGAVIKSGATE---VKRFEGPCVIFNSQDEALAGIMLG-KVKKGDV
ILVD_BACHK       EEGGLRILKGNLAKDGAVIKSGATE---VKRFEGPCVIFNSQDEALAGIMLG-KVKKGDV
ILVD_BACAN       EEGGLRILKGNLAKDGAVIKSGATE---VKRFEGPCVIFNSQDEALAGIMLG-KVKKGDV
ILVD_BACC1       EEGGLRILKGNLAKDGAVIKSGATE---VKRFEGPCVIFNSQDEALAGIMLG-KVKKGDV
ILVD_BACCZ       EEGGLRILKGNLAKDGAVIKSGATE---VKRFEGPCVIFNSQDEALAGIMLG-KVKKGDV
ILVD_BACCR       EEGGLRILKGNLAKDGAVIKSGATE---VKRFEGPCVIFNSQDEALAGIMLG-KVKKGDV
ILVD_BACCN       QEGGLRILKGNLAKDGAVIKSGATE---VKRFEGPCVIFNSQDEALAGIMLG-KVKKGDV
ILVD_BACSK       PVGGLSILYGNLAPDGAVIKVGAVD-PSIKTFTGEAIVFNSQEEAQEQINNG-AVKEGQV
ILVD_BACHD       PVGGLSILFGNLAPNGAVIKVGAVD-PSIQIFEGEAIVYNSQEEAQQGINNG-DVREGHV
ILVD_LISMO       PVGGLSMLFGNIAPKGAAIKVGGVD-PSVQVFKGEAICFSSHDEAVEAIDNH-TVREGHV
ILVD_LISMF       PVGGLSMLFGNIAPKGAAIKVGGVD-PSVQVFKGEAICFSSHDEAVEAIDNH-TVREGHV
ILVD_LISW6       PVGGLSMLFGNIAPKGAAIKVGGVD-PSVQVFKGEAICFSSHDEAVEAIDNH-TVREGHV
ILVD_LISIN       PVGGLSMLFGNIAPKGATIKVGGVD-PSVQVFKGEAICFSSHDEAVEAIDNH-TVREGHV
ILVD_STAAC       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTRKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAE       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTRKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAA2       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAA9       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAS       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAA1       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAM       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAW       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAN       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAA8       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAT       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAA3       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAB       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAAR       AQGGLSILFGNIAPKGAVIKVGGVD-PSIKTFTGKAICFNSHDEAVEAIDNR-TVRAGHV
ILVD_STAES       KQGGLSVLFGNLAPKGAVIKVGGVD-PSIKVFTGKAICFNSHDEAVEAIDNH-TVREGHV
ILVD_STAEQ       KQGGLSVLFGNLAPKGAVIKVGGVD-PSIKVFTGKAICFNSHDEAVEAIDNH-TVREGHV
ILVD_STAHJ       KQGGLSILFGNIAPKGAVIKVGGVD-PSIKIFTGKAICFNSHDEAVEAIDNK-IVREGHV
ILVD1_STAS1      KQGGLSILYGNIAPKGAVIKVGGVD-PSIKVFKGKAICFDSHDEAVEAIDNH-DVREGHV
ILVD_LEUMM       KQGGLSILYGNLAPKGSVIKAGGVD-PSIKDFTGEAIVFNSEQEAVEAIDSG-QIHAGHV
ILVD_SYMTH       ETGGLAILFGNLAPDGAALKVGAVD-PSITTFTGRAICFDSQDEALQGIFGG-RVQPGHV
ILVD_CHLCH       ATGGLAVLYGNLAPQGAVVKTGAVS-PQMMQHSGPAKVYNAQDDAIKGIMEG-DVKAGDV
ILVD_CHLPD       ATGGLAVLYGNLAPQGAVVKTGAVS-PSMMRHTGPAKVFDCQDDAIKGIMED-IIKPGDV
ILVD_PELLD       ATGGLCVLYGNLAPQGAVIKTGAVS-APMMHHSGPAKVYDSQDDAIAGIMGG-DVHSGDV
ILVD_CHLPM       ATGGLCVLYGNLAPQGSVIKTGAVS-APMMKHTGPAKVYDCQDDAIKGIMEG-EVKSGDV
ILVD_CHLTE       TTGGLAVLYGNLAPNGAVVKTGAVS-PAMMKHTGPAKVYDCQDDAIAGIMNG-DVKSGDV
ILVD_BIFAA       TEGGLAVLRGNLAPDGCVVKTAGVP-KEIWTFRGPALVVESQEQAIEVILND-TLKPGMA
ILVD_BIFLO       HEGGLAVLRGNLAPDGCVVKTAGVP-PEIWKFRGPALVVDSQEQAIEVILND-TLKPGMA
ILVD_CORGL       ADGGLVVLRGNISPDGAVIKSAGIE-EELWNFTGPARVVESQEEAVSVILTK-TIQAGEV
ILVD_CORGB       ADGGLVVLRGNISPDGAVIKSAGIE-EELWNFTGPARVVESQEEAVSVILTK-TIQAGEV
ILVD1_COREF      ADGGLVVLRGNIAPDGAVIKSAGID-EELWTFTGPARVVESQEEAVSVILNK-TIQAGEV
ILVD_CORDI       ADGGLVILRGNLAPDGAVVKAAGVD-ESIWTFSGPARVVESQEEAVSIILDK-QVQPGDV
ILVD_CORJK       ADGGLVVLRGNLAEDGAVIKAAGVD-PSIWHFEGKALVVESQEEAVRVILDK-KVKPGHV
ILVD3_NOCFA      VEGGLVVLRGNIAPDGAILKTAGID-EDLFSFQGPAVVVESQEEAVSVILGK-KIKPGDV
ILVD_FRACC       AEGGLAVLFGNLAVEGAVVKTAGVD-EGQWTFRGPALVVESQEEAVDAILTG-RVKAGNV
ILVD_SALAI       ADGGLAILHGNLAPDGCVVKTAGVP-EECLTFRGPARVYESQDDAVAAILAK-EVTAGDV
ILVD_STRAW       KDGGLAVLKGNLAVDGCVVKTAGVD-ESIWTFEGPAVVCESQDEAVDKILRK-EITHGDV
ILVD_STRCO       KDGGLAVLRGNLAVDGCVVKTAGVD-ESIWTFEGPAVVCESQEEAVQKILTQ-QVKEGDV
ILVD2_NOCFA      EDGGLAVLRGNLAVDGAVVKSAGVP-ADLHVFTGEAVVAESQEEAVTAVLSG-RVRPGTV
ILVD_THEFY       KDGGLAVLKGNLAPDGAVVKTAGVD-EELWTFSGPAKVFESQEEAVDGILNK-AVQPGDV
ILVD_BACFR       KDGGLAVLKGNIAQDGCVVKTAGVD-ESIWKFTGPAKVFDSQEAACNGILGG-KVVSGDV
ILVD_BACFN       KDGGLAVLKGNIAQDGCVVKTAGVD-ESIWKFTGPAKVFDSQEAACNGILGG-KVVSGDV
ILVD_BACTN       KDGGLAVLKGNIAQDGCVVKTAGVD-ESIWKFTGPAKVFDSQEAACEGILGG-RVVSGDV
ILVD_PARD8       KDGGLAVLRGNIALDGCVVKTAGVD-ESIWKFSGPAKVFDSQDAACEGILGG-KVVSGDV
ILVD_BLOFL       QDGGLAVLYGNLAPKGCLVKTAGVI-SELKSFRGPAKVYESQEESVQAILTG-QVCSGDV
ILVD_BLOPB       QDGGLAVLYGNLAVDGCLVKTAGVH-INLQKFSGPAKVYESQEESVQAILTG-NIHSGDV
ILVD_BUCAI       QDGGLAILYGNLAKNGCIIKTAGID-AKNYIFSGVAKVYESQEEAASSILNG-EIISGDI
ILVD_BUCDN       QDGGLAVLYGNLAKNGCIIKTAGIK-KSNYIFSGPARVYESQEEAVNAILKG-EIISGDI
ILVD_BUCAP       KNGGLSVLYGNLAKNGCIIKTASID-KKHYIFSGPAKVYESQEEAVSAILSG-KIIAGDV
ILVD_BUCMH       NDGGLAILYGNIAKNGCVVKTAGVK-KDNLIFTGNAIVFESQEDAVRAILEG-KIQKGHV
ILVD_BUCSC       YDGGLAILYGNIAKNGCVVKTAGVK-KGNLIFEGFAIVFESQEEALKAILEN-KVKKGHV
ILVD_BUCBP       LDGGIAVLYGNLAKDGCIVKTAGVH-EKNLIFRGKAVVYESQDEAVHAILNN-KIVKGNV
ILVD_BUCCC       KDGGLAVLTGNLAKNGSIIKTAAITNQSSKIFSGPAKVYESQEDAVYAILNN-YIKSGDI
ILVD_ACTP2       QDGGLAMLTGNIALDGCIVKTAGVD-ESILKFTGDAIVFESQEEAVEGILGG-KVRAGHV
ILVD_MANSM       QDGGLAMLSGNIALDGCIVKTAGVD-ESILKFTGEAIVFESQEDAVDGILGG-KVKAGHV
ILVD_HAES1       QDGGLAMLSGNIALDGCIVKTAGVD-ESILKFSGKAIVFESQEDAVSGILGG-KVQAGHV
ILVD_HISS2       QDGGLAMLSGNIALDGCIVKTAGVD-ESILKFSGKAIVFESQEDAVSGILGG-KVQAGHV
ILVD_PASMU       QDGGLAMLSGNLAMDGCIVKTAGVD-ESILKFTGDAIVFESQEDAVAGILGG-KVQAGHV
ILVD_HAEI8       QEGGLAVLFGNLAEDGCIVKTAGVD-ESIWKFTGTAIVFESQEDAVAGILGG-KVKEGHV
ILVD_HAEIG       QEGGLAVLFGNLAEDGCIVKTAGVD-ESIWKFTGTAIVFESQEDAVAGILGG-KVKEGHV
ILVD_HAEIN       QEGGLAVLFGNLAEDGCIVKTAGVD-ESIWKFTGTAIVFESQEDAVAGILGG-KVKEGHV
ILVD_HAEIE       QEGGLAVLFGNLAEDGCIVKTAGVD-ESIWKFTGTAIVFESQEDAVAGILGG-KVKEGHV
ILVD_ACTSZ       EEGGLAVLFGNIAEDGCIVKTAGVD-ESIWKFTGKAIVFESQEDAVAGILGG-KVKEGHV
ILVD_AERHH       LEGGLAVLAGNLALNGAIVKTAGVD-EENLTFRGPARVFESQDTAVAGILDG-TVKAGEV
ILVD_AERS4       LEGGLAVLSGNLALDGAIVKTAGVD-DEHLCFRGPARVFESQDTAVAGILDG-TVKAGEV
ILVD_VIBCH       QDGGLAVLKGNLAIDGCIVKTAGVD-ESILKFRGPAVVYESQEDAVNGILGG-QVKAGDV
ILVD_VIBC3       QDGGLAVLKGNLAIDGCIVKTAGVD-ESILKFRGPAVVYESQEDAVNGILGG-QVKAGDV
ILVD_VIBVU       QDGGLAVLKGNIALDGCIVKTAGVD-ESILKFTGPAVVFESQEDAVEGILGG-KVKAGDV
ILVD_VIBVY       QDGGLAVLKGNIALDGCIVKTAGVD-ESILKFTGPAVVFESQEDAVEGILGG-KVKAGDV
ILVD_VIBPA       QDGGLAVLKGNIALDGCIVKTAGVD-ESILKFTGPAVVFESQEDAVDGILGG-KVKAGDV
ILVD_ALIF1       QEGGLAVLSGNIAVDGCIVKTAGVD-EENLKFQGPAIVFESQDSAVEGILGG-KVKAGEV
ILVD_PHOPR       QDGGLAVLSGNIAIKGCIVKTAGVD-ENSLVFSGPAVVFESQDTAVEGILGG-KVKSGDV
ILVD_ECOLC       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECOHS       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECO24       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_SHIF8       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_SHISS       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_SHIFL       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECOLI       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_SHIBS       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECO57       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_SHIDS       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFIGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECOUT       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECOK1       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECOL5       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_ECOL6       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_SALPB       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDEAVEAILGG-KVVEGDV
ILVD_SALTY       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVEGDV
ILVD_SALCH       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDEAVEAILGG-KVVEGDV
ILVD_SALPA       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVEGDV
ILVD_SALTI       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPVKVYESQDDAVEAILGG-KVVEGDV
ILVD_KLEP7       KDGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVEGDV
ILVD_ENT38       QEGGLAVLYGNFAENGCIVKTAGVD-DSILKFTGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_YERPE       QDGGLAVLYGNIAADGCIVKTAGVD-KDSLTFRGPAKVFESQDEAVEAILGG-KVVAGDV
ILVD_YERPA       QDGGLAVLYGNIAADGCIVKTAGVD-KDSLTFRGPAKVFESQDEAVEAILGG-KVVAGDV
ILVD_YERPN       QDGGLAVLYGNIAADGCIVKTAGVD-KDSLTFRGPAKVFESQDEAVEAILGG-KVVAGDV
ILVD_YERPP       QDGGLAVLYGNIAADGCIVKTAGVD-KDSLTFRGPAKVFESQDEAVEAILGG-KVVAGDV
ILVD_YERP3       QDGGLAVLYGNIAADGCIVKTAGVD-KDSLTFRGPAKVFESQDEAVEAILGG-KVVAGDV
ILVD_YERPS       QDGGLAVLYGNIAADGCIVKTAGVD-KDSLTFRGPAKVFESQDEAVEAILGG-KVVAGDV
ILVD_YERE8       QDGGLAVLYGNLSENGSIVKTAGVD-KDSLTFRGPAKVYESQDDAVAAILGG-KVVAGDV
ILVD_PECAS       QDGGLAVLYGNIAVDGCIVKTAGVD-KESLIFRGPAKVYESQDDAVEAILGG-KVVAGDV
ILVD_SODGM       QDGGLAVLYGNIAEDGCIVKTAGVD-KGSLVFRGPAKVYESQEAASEAILGG-KVVAGDV
ILVD_PHOLL       RDGGLAVLFGNLAIDGCIVKTAGVD-EGSLTFRGPAKVYESQEDAVDAILGG-KVVAGDV
ILVD_COLP3       LEGGLAVLSGNIAVDGCVVKTAGVS-DDNLVFTGPAHIFESQDDAVAGVLDG-KVVAGEV
ILVD_PSYIN       TEGGLAVLFGNMAVDGAVVKTAGVD-NDNLTFTGPAKIYESQDTAVAAILGG-KVVEGDV
ILVD_SHEB5       QEGGLAVLSGNVAENGCIVKTAGVD-ESNLTFVGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHEB9       QEGGLAVLSGNVAENGCIVKTAGVD-ESNLTFVGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHEB8       QEGGLAVLSGNVAENGCIVKTAGVD-ESNLTFIGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHEPC       QEGGLAVLSGNVAENGCIVKTAGVD-ESNLTFVGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHESW       QEGGLAVLSGNVAENGCIVKTAGVD-ESNLTFVGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHESM       QEGGLAVLSGNLADNGCIVKTAGVD-ESNLTFTGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHESR       QEGGLAVLSGNLADNGCIVKTAGVD-ESNLTFTGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHESA       QEGGLAVLSGNLADNGCIVKTAGVD-ESNLTFIGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHEON       QEGGLAVLSGNLAENGCIVKTAGVD-ESNLIFVGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHEDO       QEGGLAVLSGNIAPKGCIVKTAGVD-EDNLTFVGRARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHEFN       QEGGLAVLSGNVAVDGCIVKTAGVD-ESNLTFVGSARVYESQDDAVAGILGG-EVVEGDV
ILVD_SHELP       QEGGLAVLSGNIAADGCIVKTAGVD-EANHTFVGHARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHEAM       QEGGLAVLSGNLAENGCIVKTAGVD-ESNLKFSGVARVYESQEDAVAGILGG-EVVAGDV
ILVD_SHEHH       QEGGLAVLSGNVALDGCIVKTAGVE-VENHTFIGSARVFESQDDAVAGILGG-EVVAGDV
ILVD_SHEPA       QEGGLAVLSGNVAVDGCIVKTAGVE-VENHTFIGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_SHESH       QEGGLAVLSGNIAVDGCIVKTAGVD-EDNHTFIGSARVYESQDDAVAGILGG-EVVAGDV
ILVD_PSEA6       EEGGLAVLFGNIAQDGCIVKTAGVD-ESIHVFTGRARIYESQDDAVKAILAD-EVIAGDI
ILVD1_PSEHT      QDGGLAVLSGNLAVDGCVVKSAGVV-DDMLHFEGTAVVYESQDDSVEGILND-EVKAGDV
ILVD1_BURL3      KEGGLAVLTGNIALDGCVVKTAGVD-ESILVFEGTAHVTESQDEAVENILND-KVKAGDV
ILVD_BURVG       KEGGLAVLTGNIALDGCVVKTAGVD-ESILVFEGSAHVTESQDEAVENILND-KVKAGDV
ILVD2_CUPPJ      KEGGLAVLRGNIALDGCVVKTAGVD-ESILVFEGSAHVTESQDEAVENILND-KVKAGDV
ILVD_ACIAC       KEGGLAVLRGNIALDGCVVKTAGVD-ESIHVFEGTAHVTESQDEAVENILAD-KVKAGDI
ILVD_MARMS       LEGGLAVLYGNIAVDGCVVKSAGVD-ESILVFEGRAHVTESQDEAVKNILDD-KVEAGDI
ILVD_SACD2       KEGGLAVLTGNIAEQGCVVKTAGVD-ESILVFEGTAYVTESQDQAVADILAD-KVTAGSV
ILVD_PSEAE       KEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGSAKIFESQDAAVKGILGD-EVKAGDI
ILVD_PSEAB       KEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGSAKIFESQDAAVKGILGD-EVKAGDI
ILVD_PSEA7       KEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGRAKIFESQDAAVKGILGD-EVKAGDI
ILVD_PSEMY       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGTAKIFESQDSAVKGILAD-EVKAGDI
ILVD_PSEU5       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGTAKIFESQDSAVKGILND-EVKAGDI
ILVD_PSEP1       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGTAKIFESQDSAVRGILAD-EVKAGDI
ILVD_PSEPK       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGTAKIFESQDSAVRGILAD-EVKAGDI
ILVD_PSEPG       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGNAKIFESQDSAVRGILAD-EVKAGDI
ILVD_PSEE4       QEGGLAVLYGNIAQDGCVVKTAGVD-DSILVFEGNAKIFESQDSAVRGILAD-EVKAGDI
ILVD_PSEPF       KEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGNAKIFESQDSAVRGILAD-EVKEGDI
ILVD_PSEF5       KEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGNAKIFESQDSAVRGILAD-EVKEGDI
ILVD_PSE14       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGNAKIFESQDSAVRGILAD-EVKAGDI
ILVD_PSEU2       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGSAKIFESQDSAVRGILAD-EVKAGDI
ILVD_PSESM       QEGGLAVLYGNIALDGCVVKTAGVD-ESIHVFEGNAKIFESQDSAVRGILAD-EVKAGDI
ILVD_XANAC       QEGGLAVLYGNIARDGCVVKTAGVD-ESIHVFEGTARVFESQDAAVKGILAD-EVVAGDV
ILVD_XANC5       QEGGLAVLYGNIARDGCVVKTAGVD-ESIHVFEGTARVFESQDAAVKGILAD-EVVAGDV
ILVD_XANOR       QEGGLAVLYGNIARDGCVVKTAGVD-ESIHVFEGTARVFESQDAAVKSILAD-EVKAGDV
ILVD_XANOM       QEGGLAVLYGNIARDGCVVKTAGVD-ESIHVFEGTARVFESQDAAVKSILAD-EVKAGDV
ILVD_XANCP       QEGGLAVLYGNIARDGCVVKTAGVD-ESIHVFEGNTRVYESQDSAVKGILAD-EVKAGDV
ILVD_XANC8       QEGGLAVLYGNIARDGCVVKTAGVD-ESIHVFEGNTRVYESQDSAVKGILAD-EVKAGDV
ILVD_XYLFA       KEGGLAVLYGNIAQDGCVVKTAGVD-ASIHVFEGSALVYESQEAAVKGILSD-EVQPGMI
ILVD_XYLFT       KEGGLAVLYGNIAQDGCVVKTAGVD-ASIHVFEGSALVYESQEAAVKGILSD-EVQPGMI
ILVD_HAHCH       KEGGLAVLYGNIAEDGCIVKTAGVD-ESILLFKGKARIFESQDDAVKGILND-QVKEGDV
ILVD_RHORT       RDGGLAVLYGNLAPNGCIVKTAGVD-ASILTFTGTVRLCESQDEAVARILGG-EIQAGDV
ILVD_HYDCU       KEGGLAVLYGNIALDGCIVKTAGVD-EEIFKFSGPARIYESQDAAVAAILGD-EVKSGDV
ILVD_CAUVC       KDGGLAVLFGNLAPEGCIVKTAGVD-ESILTFRGTARVFESQDAAVSGILGG-QVKAGEV
ILVD_GRABC       HDGGLAVLFGNLAPEGCIVKTAGVD-ESILTFRGTARVYESQDAAVSGILGG-QVVAGDV
ILVD_ZYMMO       TDGGLAVLFGNLAPEGSIVKTAGVD-ESILKFTGKAKVYESQEAAVAGILGN-DVEAGEV
ILVD_GLUOX       QDGGLAVLYGNLAEDGAIVKTAGVE-ASILTFTGTARVFESQDDAVAAILGN-RIVAGDV
ILVD_AZOSB       QDGGLAVLYGNIAEKGCIVKTAGVD-ESIWQFTGKARVYESQEDAVEGILGE-QVQAGDV
ILVD2_AROAE      QEGGLAVLYGNIAEKGCIVKTAGVD-ESIWTFTGRVRVFESQEAAVEGILGD-RIVAGDI
ILVD_DECAR       QEGGLAVLYGNIALDGCIVKTAGVD-ESIWKFTGKARVFESQDAAVEAILGE-KIVAGDV
ILVD1_BORBR      QDGGLAVLYGNLAEKGCIVKTAGVD-ESQWVFTGRARVFESQEDAVEGILGD-RVQAGDV
ILVD1_BORPA      QDGGLAVLYGNLAEKGCIVKTAGVD-ESQWVFTGRARVFESQEDAVEGILGD-RVQAGDV
ILVD1_BORPE      QDGGLAVLYGNLAEKGCIVKTAGVD-ESQWVFTGRARVFESQEDAVEGILGD-RVQAGDV
ILVD_BORA1       QDGGLAVLYGNLAEKGCIVKTAGVD-ESQWVFTGRARVFESQEDAVEGILGD-KVEAGDV
ILVD_NEIMA       QDGGLAVLFGNIAERGCVVKTAGVD-ESILKFTGRARVFESQEDAVEGILGN-QIVAGDI
ILVD_NEIMF       QDGGLAVLFGNIAERGCVVKTAGVD-ESILKFTGRARVFESQEDAVEGILGN-QIVAGDI
ILVD_NEIMB       QDGGLAVLFGNIAERGCVVKTAGVD-ESILKFTGRARVFESQEDAVEGILGN-QIVAGDI
ILVD_NEIG1       QDGGLAVLFGNIAERGCVVKTAGVD-ESILKFTGRARVFESQEAAVEGILGN-QIVAGNI
ILVD_PSYA2       EDGGLAVLYGNIAERGCVVKTAGVD-DSILVFTGRARIFESQDDAVAAVLDD-QIVAGDV
ILVD_CHRVO       QDGGLAVLYGNIAERGCIVKTAGVD-ESILKFTGRARIFESQDAAVEGILAD-QIVAGDI
ILVD_METFK       QDGGLAVLYGNIALDGCIVKTAGVD-DSILKFTGRARIFESQDDAVAAILAD-KIEAGDI
ILVD_SYNP6       QDGGLAVLYGNLAEQGCIVKTAGVD-ENILVFSGPAVVCESQDEAVNWILNG-RVKEGDV
ILVD_SYNE7       QDGGLAVLYGNLAEQGCIVKTAGVD-ENILVFSGPAVVCESQDEAVNWILNG-RVKEGDV
ILVD_NITOC       KDGGLAVLYGNLAKDGCIVKTAGVD-PSILIFSGPARLFESQEAAIAAILGD-KIQPGDV
ILVD_NOVAD       KDGGLAVLFGNIAREGCIVKTAGVD-DSILKFTGPAKVYESQDAAVTAILTG-QVTSGDV
ILVD_SPHAL       KDGGLAVLSGNVAPDGCIVKTAGVD-ESILKFSGPAKVFESQDAAVAGILTG-QVEAGDV
ILVD1_ACIAD      KDGGLAVLYGNIALEGCIVKTAGVD-ESILKFNGTARVFESQDAAVEAILGN-EIKAGDV
ILVD_DEIRA       QDGGLAVLYGNLAEDGCIVKTAGVD-ESILKFSGPARVFESQDASVDAILSG-EVKEGEV
ILVD_RHIEC       KDGGLAVLKGNLAVDGCIVKTAGVD-ESILKFSGPARVFESQDASVKAILAN-EIKAGDV
ILVD_RHIL3       KDGGLAVLKGNLAIDGCIVKTAGVD-ESILKFSGPARVFESQDASVKAILAN-EVKAGDV
ILVD_RHIME       KDGGLAVLKGNIALDGCIVKTAGVD-ESILKFSGPARVFESQDAAVKGILAN-EIKAGDV
ILVD_SINMW       KDGGLAVLKGNIALDGCIVKTAGVD-ESILKFSGPARVFESQDSAVKGILAN-EVKAGDV
ILVD_AGRFC       KDGGLAVLYGNIALDGCIVKTAGVD-ESILKFNGSAVVYESQDAAVKGILGN-EVKAGDV
ILVD1_RHILO      KDGGLAVLKGNLALDGCIVKTAGVD-ESILKFTGPARVFESQDASVKAILSN-EIKAGDV
ILVD_BRUAB       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDSAVLGILNG-KIKPGDI
ILVD_BRUA2       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDSAVLGILNG-KIKPGDI
ILVD_BRUO2       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDSAVLGILNG-KIKPGDI
ILVD_BRUC2       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDSAVLGILNG-KIKPGDI
ILVD_BRUSU       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDSAVLGILNG-KIKPGDI
ILVD_BRUME       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDSAVLGILNG-KIKPGDI
ILVD_BRUSI       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDSAVLGILNG-KIKPGDI
ILVD_OCHA4       QDGGLAVLYGNLAEDGCIVKTAGVD-DSILKFSGPARIFESQDTAVLGILNG-KIKAGDI
ILVD_RHOP5       QDGGLAVLFGNIALDGCIVKTAGVD-DSILKFSGPAVVYESQDDAVNGILTG-KVKEGDV
ILVD_NITHX       KDGGLAVLYGNIARDGCIVKTAGVD-DSILTFSGPARIFESQDAAVDAILTN-RIQPGDV
ILVD_NITWN       KDGGLAVLYGNIARDGCIVKTAGVD-DSILTFSGPARVFESQDAAVDAILGN-RIKPGDV
ILVD_AZOC5       KDGGLAVLFGNIAEDGCIVKTAGVD-ASILKFTGPARIFESQDAAVEAILANGKIKAGDI
ILVD_RHOPA       KDGGLAVLYGNIALDGCIVKTAGVD-ASILTFSGPVKVFESQDDAVSAILTN-KIVAGDV
ILVD_RHOP2       KDGGLAVLYGNIALDGCIVKTAGVD-ASILTFSGPAKVFESQDDAVSAILGN-KIVAGDV
ILVD1_BRADU      KDGGLAVLYGNLAQDGCIVKTAGVD-ASILKFSGPARVFESQDAAVEGILGG-KVVAGEV
ILVD_BARHE       QDGGLAVLYGNLAKDGCIVKTAGVD-QSILTFKGPARIFESQDSAVSAILND-TIQSGDI
ILVD_BART1       QDGGLAVLYGNLAKDGCIVKTAGVD-QSILTFKGPARIFESQDSAVSAILND-KIKTGEI
ILVD_RHOS4       KDGGLAVLKGNLAPDGCIVKTAGVD-ESILVFAGPAKVFESQDAAVYGILNG-GVQAGDV
ILVD_RHOS1       KDGGLAVLKGNLAPDGCIVKTAGVD-ESILVFAGPAKVFESQDAAVYGILNG-GVQAGDV
ILVD_PARDP       KDGGLAVLKGNVALDGCIVKTAGVD-ESILVFSGRAKVYESQDAAVSGILTG-KVEAGDV
ILVD_RUEPO       QDGGLAVLFGNIAEDGCIVKTAGVD-ASILQFTGTAHVCESQDDAVNNILTG-KVKEGDV
ILVD_RUEST       QDGGLAVLFGNIALDGCIVKTAGVD-ASILKFTGKAYVCESQDQAVNDILTG-KVQAGDV
ILVD_HYPNA       KDGGLAVLFGNIAEMGCVVKTAGVD-DSILKFSGPAVICESQEEACERILKK-RVKAGDV
ILVD_MAGSA       KDGGLAVLFGNLALDGCIVKTAGVD-DKNLTFSGPAVICESQDEAVAKILGG-QVKSGDV
ILVD_ACICJ       KDGGLAVLYGNIALDGAIVKTAGVD-ASILVFEGPARIFESQEDAVAGILGD-RVKAGDV
ILVD_MAGMM       KDGGLAILFGNIAQDGCIVKTAGVD-ESVWCFTGPARIFHSQDEACDAILAD-QIKAGDV
ILVD_NOSS1       AQGHLAILKGNLATEGAVAKITGVKN---PVITGPAKVFESEEDCLDAILAG-KIKAGDV
ILVD_TRIEI       AQGHLAILKGNLATEGAVAKITGVKN---PEITGLARVFDSEEACLEAILAG-KIQAGNI
ILVD_ACAM1       KQGHLAILRGNLATEGAVAKITGIKN---PQITGPARVFESEEACLEAILAG-KIQPNDV
ILVD_MICAN       KEGHLAILKGNLATEGAVAKISGVKT---PVITGPARVFESEETCLEAILAG-KIQAGDV
ILVD_SYNY3       QEGHLAVLKGNLATEGSVAKISGVKK---PVITGPAKVFESEEDCLEAILAG-KIQAGDV
ILVD_THEEB       ATGHLAILKGNLASEGAVAKISGVKN---PQITGPARVFDSEEDCLDAILAG-KINPGDV
ILVD_SYNJB       PQGHLAILKGNLAPEGAVAKITGVKN---PQITGPARVFDSEESCLQAILSG-QIRAGDV
ILVD_SYNJA       PQGHIAILKGNLAPEGAVAKISGVKT---PKIAGPARVFNSEESCLQAILAG-QIRPGDV
ILVD_GLOVI       SSGHLAILRGNLASEGAVAKITGVKK---PQITGPARVFDSEESCMEAILAG-AIQPGDV
ILVD_NITEU       EQGHLAILKGNLSSEGAVAKISGIKN---PSITGPARVFDSEETCMAAILER-KIQPGDV
ILVD_NITEC       EQGHLAILKGNLSPEGAVAKISGVKN---PNITGPARVFESEETCMTAILDR-KIKPGDV
ILVD_NITMU       VQGHLAILKGNLAPEGCVAKITGVKS---PKITGPARVFDSEEACMAAILAR-EIQPGDV
ILVD_CHLAA       PQGHLAILRGNLAEEGCVAKITGIKQ---RRITGPARVFDAEEECLEAILSG-KIKAGDV
ILVD_DEIGD       SQGHLAILRGNLAPEGSVAKISGLRQ---IKITGPARVFDSEEECMAAIMGD-QIKAGDV
ILVD_HALHL       PEGHLAILRGNLAEEGAVAKVSGIQQ---RRISGPARVFDSEEECLEAILAD-GVQAGDV
ILVD_PROMS       KKGHLAILKGNLASEGSVAKISGVKN---PVLTGPAKIFESEEDCLKSILNN-DIKAGDV
ILVD_PROM9       KKGHLAILKGNLASEGSVAKISGVKN---PVLTGPAKIFESEEDCLKSILNN-DIKAGDV
ILVD_PROM0       KKGHLAILKGNLASEGSVAKISGVKN---PVLTGPAKIFESEEDCLKSILNN-DIKAGDV
ILVD_PROM2       KKGHLAILKGNLAKEGSVAKISGVKN---PVLTGPAKIFESEEDCLKAILNN-EIIAGDV
ILVD_PROM5       KKGHLAILKGNLASEGCVAKISGVKN---PVLKGPARIFESEEDCLKSILNN-DIKAGNV
ILVD_PROMP       KKGHLAILKGNLASEGCVAKISGIKN---PVLKGPARIFESEEDCLKSILNN-DIKAGNV
ILVD_PROMA       KKGHLAILKGNLATEGSVAKISGIKE---PILTGPAKVFESEEDCLKAILTE-QIHSGDV
ILVD_PROM3       AKGHLAILKGNLASEGCVAKISGIKT---PVLTGPARVFESEEACLAAILNN-KVKAGDV
ILVD_PROMM       AKGHLAILKGNLASEGCVAKISGIKT---PVLTGPARVFESEEACLAAILNN-KVKAGDV
ILVD_SYNSC       AKGHLAILKGNLASEGSVAKISGVKT---PVLTGPARVFESEEDCLAAILDK-KIQAGDV
ILVD_SYNPX       GKGHLAILKGNLASEGSVAKISGVKT---PVLTGPARVFESEEDCLAAILDQ-RIKAGDV
ILVD_SYNS9       SKGHLAILKGNLAIEGSVAKISGVKT---PVLTGPARVFESEEDCLASILEK-KINAGDV
ILVD_SYNR3       AKGHLAVLKGNLASEGAVAKISGVKT---PVLTGPARVFESEEQCLQAILAN-QVHAGDV
ILVD_PROMT       KKGHLAILKGNLASEGSVAKISGVKT---PVLTGPARVFESEEECLTAILDN-KVKAGDV
ILVD1_AROAE      AEGHLAILRGNLSPEGCVAKISGLKN---PAITGPARVFDSEDDAMAAIMAR-RIVEGDV
ILVD3_AROAE      AEGHLAILRGNLSPEGCVAKISGLKN---PAITGPARVFDSEDDAMGAIMAR-RIVEGDV
ILVD3_BORBR      PQGHLAILKGNLSPEGCVAKITGLKN---PVITGPARVFDSEDDAMSAIMDR-RIRDGDV
ILVD2_BORPA      PQGHLAILKGNLSPEGCVAKITGLKN---PVITGPARVFDSEDDAMSAIMDR-RIRDGDV
ILVD2_BORPE      PQGHLAILKGNLSPEGCVAKITGLKN---PVITGPARVFDSEDDAMAAIMDR-RIRDGDV
ILVD_BURMA       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURM9       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURM7       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURMS       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURPS       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURP6       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURP1       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURP0       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-RIRAGDV
ILVD_BURTA       KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSALAAILDD-KIRAGDV
ILVD2_BURL3      KEGHLAILKGNLAEDGAVAKITGLKN---PVITGPARVFDDEQSAMDAILGD-RIRAGDI
ILVD1_CUPPJ      AEGHLAILKGNLAEEGAVAKITGLKN---PVITGPARVFEDEQSAMEAILAD-KINAGDV
ILVD_RALSO       QQGHLAILKGNLAEEGAVAKITGLKN---PVISGPARVFDDEQSAMTAILAD-QIKAGDV
ILVD_HERAR       AQGHLAILKGNLSPEGCVAKITGLKN---PVITGPARVFDDEYSAMDAIMAN-QIKAGDV
ILVD_JANMA       EQGHLAILKGNLSPEGCVAKITGLKN---PVITGPARVFDDEYSAMDAIMAN-KIVAGDV
ILVD_POLNA       AQGHLAILKGNLSPEGCVAKITGLKN---PVMTGPARVFEDEQSGLKAILDG-KIVAGDV
ILVD_POLSJ       AQGHLAILKGNLSPEGCVAKITGLKN---PVMTGPARVFDDEQSALAAILAG-KIKAGDV
ILVD_RHOFT       AQGHLAILKGNLAPEGCVAKITGLKN---PVMTGPARVFEDEQSALAAILAN-KIVAGDV
ILVD_VEREI       AQGHLAILKGNLSPEGAVAKITGLKN---PVITGPARVFDDEQSALQAILDG-KIQAGDV
ILVD_METPP       EQGHLAILKGNLSPEGAVAKITGLKN---PSITGPARVFDDEQSALAAIMAK-QIQAGDV
ILVD_TREPR       RTGRLVVLSGNMSRNGAVAKTSGLSI---LLHSGTARVFRSEEACVQAILNG-CVRIGDV
ILVD_CHRSD       SSSHLRILYGNLAPEGAVAKITGKEG---TRFTGRARVFNSEEEAQARINDL-TVAAGDV
ILVD2_PSEHT      KDSHLVILAGNLAPEGAVSKITGKEG---LRFTGNAKVYDSEEQGFAAIIDG-QVVAGDV
ILVD2_ACIAD      KDSHLVILKGNLSPTGAVAKITGKEG---LYFEGPARVFEGEEGAMRGILDG-EVQEGEV
ILVD_METCA       KDSHLVILKGNLAPEGAVAKITGKEG---LSFTGTARVFDCEEAALTAILDG-TIVKGDV
ILVD_RUTMC       KDSHLRILRGNLATDGAVAKITGKEG---LSFKGNAKCFSREEDALEAILNN-QIITGDV
ILVD_LACLS       ATGHLQILYGNLAEGGSVAKISGKEG---EFFKGTARVFDGEQHFIDGIESG-RLHAGDV
ILVD_LACLA       ATGHLQILYGNLAQGGSVAKISGKEG---EFFKGTARVFDGEQHFIDGIESG-RLHAGDV
ILVD_CYTH3       QTGHLQILYGNLAPQGSVAKITGKEG---TYFEGPARVYDSEEAVNKGLEAN-EVKSGEV
ILVD_FRATN       KTGHLQILKGNVAPEGSVAKITGKEG---EVFEGVANVFDSEEEMVAAVEEG-KVKKGDV
ILVD_FRATT       KTGHLQILKGNVAPEGSVAKITGKEG---EIFEGVANVFDSEEEMVAAVETG-KVKKGDV
ILVD_FRAP2       KTGHLQILKGNVAPEGSVAKITGKEG---EVFEGVANVFDSEEEMVAAVEEG-KVKKGDV
ILVD_RHOBA       KSGHIRILKGSLATEGAVAKITGKEG---LQFSGPARVYDNEELMLAALEQK-QIQKGDV
ILVD_LEPBJ       PSGPLVILKGNLAPEGAVAKISGLKK---ISITGPAKVFESEDDCFNAIMTD-QIKPGDV
ILVD_LEPBL       PSGPLVILKGNLAPEGAVAKISGLKK---ISITGPAKVFESEDDCFNAIMTD-QIKPGDV
ILVD_LEPIN       PSGPLVILKGNLAPDGAVAKISGLKK---ISITGPAKVFESEDDCFNAIMTD-KIKPGDV
ILVD_LEPIC       PSGPLVILKGNLAPDGAVAKISGLKK---ISITGPAKVFESEDDCFNAIMTD-KIKPGDV
ILVD_STRPN       ADGPLIILNGNLAPDGAVAKVSGVKV---RRHVGPAKVFDSEEDAIQAVLTD-EIVDGDV
ILVD_STRR6       ADGPLIILNGNLAPDGAVAKVSGVKV---RRHVGPAKVFDSEEDAIQAVLTD-EIVDGDV
ILVD_STRP2       ADGPLIILNGNLAPDGAVAKVSGVKV---RRHVGPAKVFDSEEDAIQAVLTD-EIVDGDV
ILVD_STRT2       ADGPLIILKGNLAPEGAVAKVSGVKV---RNITGPAKVFDSEEDAIEAVLSD-EIVDGDV
ILVD_STRT1       ADGPLIILKGNLAPEGAVAKVSGVKV---RNITGPAKVFDSEEDAIEAVLSD-EIVDGDV
ILVD_STRSY       ADGPLIILKGNLAPEGAVAKVSGVKV---RNHTGPAKVFDSEEEAIEAVLTD-EIVDGDV
ILVD_STRS2       ADGPLIILKGNLAPEGAVAKVSGVKV---RNHTGPAKVFDSEEEAIEAVLTD-EIVDGDV
ILVD_STRSV       ADGPLIILHGNLAPDGAVAKVSGVKV---RRHVGPAKVFDSEEAAIDAVLAD-EVVDGDV
ILVD_STRMU       EDGPLIILHGNLAPDGAVAKVSGVKV---RRHVGPAKVFNSEEEAIEAVLND-DIVDGDV
ILVD_OCEIH       EDGPLIVLKGNLSPTGAVAKVSGVKV---KRHTGPARVFNTEKEATQAILDN-KIKEGDV
ILVD2_STAS1      ATGPLVILKGNLAPEGAVAKISGLSV---TYIKGPARVFDSESKATKAILND-EIKPGDV
ILVD_ROSCS       PTGGLLVLRGNLAPEGSVVKLFGYER---TYHRGPARVFDSEEAAMAAIVGG-EIRPDDI
ILVD_ROSS1       PTGGLLVLRGNLAPEGSVVKLFGYER---TYHRGPARVFDGEEAAMAAIVGG-EIRPDDI
ILVD_KORVE       ATGGLMILKGNLASEGCVVKLVGHKK---LFFEGPARVFESEEEAFAGVEDR-TIQAGEV
ILVD_THET2       PHGGLVVLKGNLAPQGAVLKLAGTER---TSFEGPARVFDSEEAAMEKVLKG-EIRPGDV
ILVD_THET8       PHGGLVVLKGNLAPKGAVLKLAGTER---TYFEGPARVFDSEEAAMEKVLKG-EIRPGDV
ILVD_HALMA       ERGAIRILSGNLAPDGAVIKITGEDH---LHHEGPVRVFEQEEGAMEYVQEG-HVESGDV
ILVD_NATPD       AEGAIKILTGNLAPDGAVLKVTGDDE---FYHEGPARVFENEEDAMKYVQEG-HIESGDV
ILVD2_BORBR      PTGGVAVLKGNLSPDGALLKIAGLKS---LKFSGPARVFENEEACMRAVSTH-AYQPGEV
ILVD3_BRADU      PDGGVAVLKGNLCPDGAVIKVAGLKS---QFFEGVARVFEDEEACVAAVRDR-SYKAGEV
ILVD2_BRADU      VTGGVVGLKGNLAPEGAIVKVAGMSN---LRFTGPARCFDREEDAFEAVQNR-TYREGEV
ILVD2_RHILO      QTGGVVGLKGNLAPEGAIVKVAGMTE---LKFSGPARCFDSEEECFEAVTQR-NYREGEV
ILVD_PARL1       PTGGVVGLQGSLAPDGAIVKVAGMEKD-HLRFSGPARCFDSEEECFEAVDKR-QYKEGEV
ILVD_PELUB       PDGGVVGLKGNLAPDGGIVKIAGLKK---LQFTGKARCFDNEEAAMACVQKK-KYKAGDV
ILVD_DINSH       TTGGVVGLEGNLAPEGAIVKIAGMSDD-QLVFTGPARVFECEEDAFEAVQNR-AYAEGDV
ILVD_PYRAR       PYSGIRILRGNLAPSGAVMKIGAADK---LRFEGRAKVYDSEAEAFKAVAAG-EIKPGDV
ILVD_PYRIL       PYSGIRILRGNLAPDGAVMKIGAADK---LKFEGKAKVYNGEAEAFKAVAAG-EIKPGDV
ILVD_PYRAE       PYSGIRILRGNLAPNGAVMKVGAAER---LKFEGRAKVYDSEAEAFKAVASG-EIKAGDV
ILVD_PYRCJ       PHGGIRILWGNLAPRGAVMKIGAAEV---LKFEGKALVFDGEAEAFKAVAAG-EVKPGHV
ILVD_AERPE       PHAGLRILRGSLAPRGAVMKIGASGI---LKFKGAAKVFDSEEEAFKAIERG-YVEEGDV
ILVD_METS5       PSGGIRILKGSLAPEGSVVKLSASKI---KYHRGPARVFNSEEEAFETVLKK-KINEGDV
ILVD_SULTO       PTGGIRILKGSLAPEGAVIKVSATKV---RYHKGPARVFNSEEEAFKAVLEE-KIQENDV
ILVD_PICTO       RTGGIKILRGNIAREGSVFKASASSV---MKHTGPAKVFDGEEAAFRALMDN-KIERGDV
ILVD_SULAC       PRGGIVILKGSLAPEGAVIKVAATNV---TKFEGKAKVYNSEEQAFKGIQSN-EVKDGEV
ILVD_SACS2       PRGGIVILKGSLAPEGAVIKVAATNV---VKFEGKAKVYNSEDDAFKGVQSG-EVSEGEV
ILVD_MYCA1       PTGGITILRGSLAPEGAVVKSAGFDS---DVFEGTARVFDGERAALDALEDG-TITKGDA
ILVD_MYCPA       PTGGITILRGSLAPEGAVVKSAGFDS---DVFEGTARVFDGERAALDALEDG-TITKGDA
ILVD_MYCUA       ATGGITILRGSLAPEGAVVKTAGLDT---DVFEGTARVFDGERAALDALEDG-TITHGDV
ILVD_MYCBO       PSGGITILHGSLAPEGAVVKTAGFDS---DVFEGTARVFDGERAALDALEDG-TITVGDA
ILVD_MYCTU       PSGGITILHGSLAPEGAVVKTAGFDS---DVFEGTARVFDGERAALDALEDG-TITVGDA
ILVD_MYCLE       PTGGITILRGSLAPDGAVVKTAGLDS---DVFEGTARVFDGERAALDALKDG-TIAKGDV
ILVD_MYCSJ       PTGGITILHGSLAPEGAVVKSAGFDS---DVFEGTARVFERERAALDALEDG-TITHGDV
ILVD1_NOCFA      PTGGITILSGSLAPGGAVVKSAGFDE---DVFTGTARVFDRERAAMDALEDG-TITAGDV
ILVD_ACIC1       RTGGLAILRGSLAPDGAVVKTAGLES---TFFEGTARVFDGEEAAMRAVPE---LRPGDV
ILVD_NOCSJ       KTGGLTILKGSLAPEGAVVKTAGFDD---SVFTGTARVFDGERAAMDALEAG-QIQPRDV
ILVD_ARTS2       KTGGITILHGSMAPEGAVVKSAGFDA---DVFEGTARVFEREQGALDALDNG-KINKGDV
ILVD_RENSM       KTGGLSVLKGSLAPGGAVVKTAGFDA---EVFEGPARVFEREQGALEALKAG-EIKAGDV
ILVD_CLAM3       ATGGISVLHGSLAPEGAVVKTAGFDL---DVFEGPARVFERERAAMDALTEG-LISKGDV
ILVD_CLAMS       ATGGISVLHGSLAPEGAVVKTAGFDL---DVFEGPARVFERERAAMDALTEG-RISKGDV
ILVD_LEIXX       PTGGLTILKGTLAPEGAVVKTAGFDA---EVFEGPARVFERERAAMDALTAG-RINAGDV
ILVD_TROW8       PTGGIKVLKGTLAPDGAVAKTAGFDT---VVFQGPAMVFDRERAAMDALSAG-NIKKGSV
ILVD_TROWT       PTGGIKVLKGTLAPDGAVAKTAGFDT---VVFQGPAMVFDRERAAMDALSAG-NIKKGSV
ILVD2_COREF      KTGGLTILHGSLAPGGAVVKTAGFDT---ERFEGTARVFNQEAPAMDAVLNG-ELKAGDV
                   . :  : *..   .   *  .                         :           

ILVD_CALS8       IVIRYEGPKGGPGMREMLSPTSALAGVGLIEDVALITDGRFSGATRGACFGHVSPEAAER
ILVD_HUNT2       VIIRYEGPKGGPGMREMLSPTSAIAGMGLDKDVALITDGRFSGATRGASIGHVSPEAMAG
ILVD_CALS4       VVIRYEGPKGGPGMREMLSPTSALAGMGLDKDVALITDGRFSGATRGASIGHVSPEAMEG
ILVD_CLOB8       VVIRYEGPKGGPGMREMLNPTSAIAGRGLGSSVALITDGRFSGASRGASIGHVSPEAAVG
ILVD_CLOK5       VIIRYEGPKGGPGMREMLNPTSAIMGRGLGGSVALITDGRFSGATRGAAIGHVSPEAAVG
ILVD_LACP7       VVIRYEGPKGGPGMREMLNPTSAIAGMGLGSSVALITDGRFSGASRGASIGHVSPEAAVG
ILVD_CLOAB       VVIRYEGPKGGPGMKEMLSPTASLAGMGLDKSVALITDGRFSGATRGASIGHVSPEAAEG
ILVD_CARHZ       VVIRYEGPKGGPGMREMLTPTSALAGMGLDKDVALITDGRFSGATRGAAIGHVSPEGYEG
ILVD_MOOTA       VVIRYEGPRGGPGMQEMLSPTAALAGMGLDSSVALITDGRFSGASRGASIGHVSPEAAAG
ILVD_SYNFM       VVIRYEGPKGGPGMQEMLTPTAAIIGMGLGKDVALITDGRFSGGTQGAAIGHVSPEAAVG
ILVD_SYNAS       VVIRYEGPKGGPGMREMLSPTSAIAGMGLDTSVALLTDGRFSGGTRGAAIGHISPEAAEG
ILVD_DESVH       IVIRYEGPKGGPGMREMLTPTSAIAGMGLGADVALITDGRFSGGTRGAAIGHVSPEAAEG
ILVD_DESVV       IVIRYEGPKGGPGMREMLTPTSAIAGMGLGADVALITDGRFSGGTRGAAIGHVSPEAAEG
ILVD_DESAG       IIIRYEGPKGGPGMREMLSPTAAIAGIGLGADVALITDGRFSGGTRGAAIGHVSPEAADG
ILVD_THEMA       VVIRYEGPKGGPGMREMLSPTSAIVGMGLAEDVALITDGRFSGGSHGAVIGHVSPEAAEG
ILVD_THEP1       VVIRYEGPKGGPGMREMLSPTSAIVGMGLAEDVALITDGRFSGGSHGAVIGHVSPEAAEG
ILVD_PYRAB       VVIRYEGPKGGPGMREMLAPTSAIAGMGLDRDVALVTDGRFSGATRGLSIGHVSPEAAEG
ILVD_PYRFU       VVIRYEGPKGGPGMREMLTPTSAIAGMGLDKDVALVTDGRFSGATRGLSVGHVSPEAAEG
ILVD_CLONN       VVIRYEGPKGCPGMREMLSPTAAIIGLGLEKSTALITDGRFSGGTRGPCIGHISPEASEG
ILVD_IGNH4       IVIRYEGPRGGPGMREMLTATAAVMALGLGDKVALVTDGRFSGATRGPAIGHVSPEAAAG
ILVD_GEOMG       VVIRYEGPKGGPGMREMLAPTATLMGLGLGDSVALVTDGRFSGGTRGPCIGHISPEAAEG
ILVD_GEOSL       VVIRYEGPKGGPGMREMLAPTATLMGLGLGDSVALITDGRFSGGTRGPCIGHISPEAAEG
ILVD_GEOUR       VVIRYEGPKGGPGMREMLAPTAALMGLGLGDSVALITDGRFSGGTRGPCIGHISPEAAEG
ILVD_PELPD       VVIRYEGPKGGPGMREMLAPTAALMGLGLGDSVALITDGRFSGGTRGPCIGHISPEAAQG
ILVD_PELCD       VVIRYEGPKGGPGMREMLAPTATLMGLGLGDSVALITDGRFSGGTRGPCVGHVSPEAAVG
ILVD_METMJ       LVIRYEGPRGGPGMPEMLSPTSALMGLGYAR-VALVTDGRFSGGTRGPCIGHIAPEAAVG
ILVD_METB6       VIIRNEGPRGGPGMPEMLSATSALMGVGYKN-VVLITDGRFSGGTRGPCIGHVAPEAAVG
ILVD_METHJ       IVIRYEGPKGGPGMPEMLSPTSALVGLGYSR-VALITDGRFSGGTRGPCIGHVAPEAAAG
ILVD_ARCFU       VVIRYMGPKGAPGMPEMLLPTAAISGLGLQK-VALITDGRFSGATRGPCIGHVSPEAAVG
ILVD_METTH       IVIRYEGPKGGPGMREMLNPTSAIAGMGLER-VALITDGRFSGGTRGPCVGHVSPEAMED
ILVD_METST       VVIRYEGPKGGPGMREMLNPTAAIMGRELFH-VALITDGRFSGGSRGPCIGHISPEAAEG
ILVD_METS3       LVIRYEGPKGGPGMREMLNPTSALAGMQIKN-VGLITDGRFSGGTRGPCIGHVSPEAMSD
ILVD_METJA       VVIRYEGPAGGPGMREMLAPTSAICGMGLDDSVALITDGRFSGGSRGPCIGHVSPEAMAG
ILVD_META3       VVIRYEGPAGGPGMREMLSPTSAICGMGLDDSVALITDGRFSGGSRGPCIGHISPEAMAG
ILVD_METM5       VVIRHEGPSGGPGMREMLSPTSAICGMGLDDSVALITDGRFSGGSRGPCIGHVSPEAAAG
ILVD_METM7       IVIRYEGPSGGPGMREMLSPTSAICGMGLDDSVALITDGRFSGGSRGPCIGHVSPEAAAG
ILVD_METMP       IVIRYEGPSGGPGMREMLSPTSAICGMGLDDSVALITDGRFSGGSRGPCIGHVSPEAAAG
ILVD_METVS       IVIRYEGPSGGPGMREMLSPTSAICGMGLDDSVALITDGRFSGGSRGPCIGHISPEAMAG
ILVD1_METAC      VVIRYEGPKGGPGMREMLAATAAIGGMGLLESVALITDGRFSGGTRGPCIGHVSPEASEG
ILVD_METMA       VVIRYEGPKGGPGMREMLAATAAIAGMGLLESVALVTDGRFSGGTRGPCIGHVSPEASEG
ILVD2_METAC      VVIRYEGPKGGPGMREMLAATAALGGRGLLESVALVTDGRFSGGTRGPCIGHVSPEASDG
ILVD_METBF       VVIRYEGPKGGPGMREMLAATAAIGGMGLLESVALVTDGRFSGGTRGPCIGHISPEASEG
ILVD_METBU       VVIRYEGPKGGPGMREMLSPTSAIAGMGLIDSVALITDGRFSGGTRGPCIGHISPEAYEG
ILVD_METTP       VVIRYEGPKGGPGMRETLAPTSAIAGAGLSESVALITDGRFSGGTRGPCIGHVSPEAAVG
ILVD_METKA       VVIRYEGPAGGPGMREMLTPTAALCGMGLDDSVALVTDGRFSGGTRGPCVGHVSPEAYRG
ILVD_DEHMB       LVIRYEGPKGGPGMREMLTPTSLLAGMGLDKEVALITDGRFSGATRGAAMGHVSPEAAAC
ILVD_DEHMC       LVIRYEGPKGGPGMREMLTPTSLLAGMGLDKEVALITDGRFSGATRGAAMGHVSPEAAAC
ILVD_DEHM1       LVIRYEGPKGGPGMREMLTPTSLLAGMGLDKEVALITDGRFSGATRGAAMGHVSPEAAAR
ILVD_ANADE       VVIRYEGPKGGPGMQEMLSPTSLIMGMGLGESVALVTDGRFSGATRGACVGHVSPEAAEG
ILVD_ANADF       VVIRYEGPRGGPGMQEMLAPTSLIMGMGLGEQVALATDGRFSGATRGACVGHVSPEAAEG
ILVD_ARCB4       VVIRYEGPKGGPGMQEMLAPTSLIMGMGLGSSVALITDGRFSGATRGASIGHVSPEAAEG
ILVD_SULNB       VVIRYEGPKGGPGMQEMLSPTSLIMGMGLGDKVALITDGRFSGATRGASIGHVSPEAAEG
ILVD_NITSB       VVIRYEGPKGGPGMQEMLAPTSLIAGMNLGDKVALITDGRFSGATRGASIGHVSPEAAEG
ILVD_SULDN       VVIRYEGPKGGPGMQEMLAPTALIQGMGLGDSVALITDGRFSGATKGASIGHVSPEAAEG
ILVD_HELHP       VVIRYEGPKGGPGMQEMLTPTSLIMGMGLGESVALITDGRFSGATRGGCIGHISPEAAEG
ILVD_WOLSU       VVIRYEGPKGGPGMQEMLSPTSLIMGMNLGDKVALITDGRFSGATRGACIGHVSPEAAEG
ILVD_CAMFF       VVLRYEGPKGGPGMQEMLSPTSLIVGRGLGADVALITDGRFSGATRGLSIGHVSPEAAEG
ILVD_CAMHC       VVIRYEGPKGGPGMQEMLSPTSLIVGRGLGADVALITDGRFSGATRGLCIGHVSPEAAEG
ILVD_CAMC5       VVIRYEGPRGGPGMQEMLSPTSLIMGRGLGADVALITDGRFSGATRGLSIGHISPEAAEG
ILVD_CAMJE       CVIRYEGPKGGPGMQEMLSPTSLLMGMGLGADVALITDGRFSGATRGLSVGHISPEAAEG
ILVD_CAMJR       CVIRYEGPKGGPGMQEMLSPTSLLMGMGLGADVALITDGRFSGATRGLSVGHISPEAAEG
ILVD_CAMJD       CVIRYEGPKGGPGMQEMLSPTSLLMGMGLGADVALITDGRFSGATRGLSIGHISPEAAEG
ILVD_CAMJJ       CVIRYEGPKGGPGMQEMLSPTSLLMGMGLGADVALITDGRFSGATRGLSVGHISPEAAEG
ILVD_CAMJ8       CVIRYEGPKGGPGMQEMLSPTSLLMGMGLGADVALITDGRFSGATRGLSVGHISPEAAEG
ILVD_AQUAE       VVIRYEGPKGGPGMREMLSPTSAIMGMGLGDKVALITDGRFSGGTRGACVGHISPEAAAG
ILVD_BACVZ       VIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPKVALITDGRFSGASRGLSIGHVSPEAAEG
ILVD_BACSU       VIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPKVALITDGRFSGASRGLSIGHVSPEAAEG
ILVD_BACP2       VIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPKVALITDGRFSGASRGLSIGHVSPEAAEG
ILVD_BACLD       VIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPKVALITDGRFSGASRGLSIGHVSPEAAEG
ILVD_GEOKA       VVIRYEGPKGGPGMPEMLAPTSQIVGMGLGTKVALVTDGRFSGASRGLSVGHVSPEAAEG
ILVD_BACAH       VVIRYEGPRGGPGMPEMLAPTSAIAGMGLGADVALLTDGRFSGASRGISVGHISPEAAAG
ILVD_BACHK       VIIRYEGPRGGPGMPEMLAPTSAIAGMGLGADVALLTDGRFSGASRGISVGHISPEAAAG
ILVD_BACAN       VVIRYEGPRGGPGMPEMLAPTSAIAGMGLGADVALLTDGRFSGASRGISVGHISPEAAAG
ILVD_BACC1       VVIRYEGPRGGPGMPEMLAPTSAIAGMGLGADVALLTDGRFSGASRGISVGHISPEAAAG
ILVD_BACCZ       VVIRYEGPRGGPGMPEMLAPTSAIAGMGLGADVALLTDGRFSGASRGISVGHISPEAAAG
ILVD_BACCR       VVIRYEGPRGGPGMPEMLAPTSAIAGMGLGAEVALLTDGRFSGASRGISVGHISPEAAAG
ILVD_BACCN       VVIRYEGPRGGPGMPEMLAPTSAIAGMGLGADVALLTDGRFSGASRGISVGHISPEAAAG
ILVD_BACSK       VVIRYEGPKGGPGMPEMLAPTSAIQGRGLGTKVALITDGRFSGASRGISIGHISPEAAEG
ILVD_BACHD       VVIRYEGPKGGPGMPEMLAPTSAIIGRGLGTKVALITDGRFSGASRGISIGHISPEAAEG
ILVD_LISMO       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAAAG
ILVD_LISMF       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAAAG
ILVD_LISW6       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAAAG
ILVD_LISIN       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAAAG
ILVD_STAAC       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAE       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAA2       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAA9       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAS       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAA1       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAM       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAW       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAN       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAA8       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAT       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAA3       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAB       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAAR       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAES       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAEQ       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD_STAHJ       VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAASG
ILVD1_STAS1      VVIRYEGPKGGPGMPEMLAPTSSIVGRGLGKDVALITDGRFSGATRGIAVGHISPEAAAG
ILVD_LEUMM       LIIRYEGPKGGPGMPEMLGPTSAITGMGLGKEVALVTDGRFSGASRGISVGHVSPEAADD
ILVD_SYMTH       VVIRYEGPKGGPGMPEMLAPTSAIVGMGLGKEVALITDGRFSGGTRGICLGHISPEAAEG
ILVD_CHLCH       VVIRYEGPKGGPGMPEMLSPTSAIMGRGLGDSVALITDGRFSGGSRGACIGHVSPEAAER
ILVD_CHLPD       VVIRYEGPKGGPGMPEMLSPTSAIMGRGLGDSVALITDGRFSGGSRGACIGHVSPEAAEN
ILVD_PELLD       VVIRYEGPKGGPGMPEMLSPTSAIMGRGLGDSVALITDGRFSGGSRGACIGHVSPEAAVK
ILVD_CHLPM       VVIRYEGPKGGPGMPEMLSPTSVIMGRGLGDSVALITDGRFSGGSRGACIGHISPEAAEK
ILVD_CHLTE       VVIRYEGPRGGPGMPEMLSPTSAIIGRGLGDSVALITDGRFSGGSRGACVGHVSPEAADR
ILVD_BIFAA       LVIRYEGPKGGPGMQEMLYPTSFVKGKGIGKQVAMLTDGRYSGGSSGLAIGHIAPEAANK
ILVD_BIFLO       LVIRYEGPKGGPGMQEMLYPTSFVKGKGIGKQVAMLTDGRYSGGSSGLAIGHMAPEAANK
ILVD_CORGL       LVVRYEGPSGGPGMQEMLHPTAFLKGSGLGKKCALITDGRFSGGSSGLSIGHVSPEAAHG
ILVD_CORGB       LVVRYEGPSGGPGMQEMLHPTAFLKGSGLGKKCALITDGRFSGGSSGLSIGHVSPEAAHG
ILVD1_COREF      LVVRYEGPSGGPGMQEMLHPTAFLKGSGLGKKCALLTDGRFSGGSSGLSIGHVSPEAAHG
ILVD_CORDI       VVIRYEGPAGGPGMQEMLHPTSFLKGAGLGKACALITDGRFSGGTSGLSIGHISPEAAHG
ILVD_CORJK       VVVRYEGPAGGPGMQEMLHPTAFLKGAGLGKECALITDGRFSGGTSGLSVGHISPEAAHG
ILVD3_NOCFA      LVVRYEGPAGGPGMQEMLHPTAFLKGAGLGKQCALITDGRFSGGTSGLSIGHISPEAASG
ILVD_FRACC       IIVRYEGPRGGPGMQEMLYPTAFLKGRGLGPKCALITDGRFSGGSSGLSIGHVSPEAAHG
ILVD_SALAI       VVIRYEGPRGGPGMQEMLYPTSFLKGRGLGRACALLTDGRFSGGTSGLSIGHVSPEAAAG
ILVD_STRAW       VVIRYEGPKGGPGMQEMLYPTSFLKGRGLGKTCALITDGRFSGGTSGLSIGHASPEAASG
ILVD_STRCO       VVIRYEGPKGGPGMQEMLYPTSYLKGRGLGKACALVTDGRFSGGTSGLSIGHASPEAAAG
ILVD2_NOCFA      LVIRYEGPRGGPGMQEMLYPTAYLKGRGLAGSVAVVTDGRFSGGSSGLSIGHVSPEAAAG
ILVD_THEFY       VVIRYEGPKGGPGMQEMLYPTSFLKGRGLGKVCALITDGRFSGGTSGLSIGHASPEAAAG
ILVD_BACFR       VVITHEGPKGGPGMQEMLYPTSYIKSRHLGKECALITDGRFSGGTSGLSIGHISPEAAAG
ILVD_BACFN       VVITHEGPKGGPGMQEMLYPTSYIKSRHLGKECALITDGRFSGGTSGLSIGHISPEAAAG
ILVD_BACTN       VVITHEGPKGGPGMQEMLYPTSYIKSRHLGKECALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_PARD8       VVITYEGPKGGPGMQEMLYPTSYIKSRHLGKECALITDGRFSGGTSGLSIGHISPEAASG
ILVD_BLOFL       VVIRYEGPKGGPGMQEMLYPTSFLRSMGLDLHCALITDGRFSGGTSGLSVGHISPEAASA
ILVD_BLOPB       IVIRYEGPKGGPGMQEMLYPTSFLKSMGLDLCCALITDGRFSGGTSGLSIGHISPEAANK
ILVD_BUCAI       IVIRYEGPKGGPGMQEMLYPTTYLKSMNLDKTCALITDGRFSGGTSGISIGHISPEAANK
ILVD_BUCDN       VVIRYEGPKGGPGMQEMLYPTTYLKSMKLDKTCALITDGRFSGGTSGLSIGHVSPEAANK
ILVD_BUCAP       IVIRYEGPKGGPGMQEMLYPTTYLKSINLDKQCALITDGRFSGGTSGLSIGHISPEAANK
ILVD_BUCMH       IVIRYEGPKGGPGMQEMLYPTTYLKSMGLDQHCALITDGRFSGGTSGLSIGHISPEAASK
ILVD_BUCSC       VVIRYEGPKGGPGMQEMLYPTTYLKSMNLDEHCALITDGRFSGGTSGLSIGHISPEAANK
ILVD_BUCBP       IIIRYEGPKGGPGMQEMLYPTSYLKSMKLDQDCALITDGRFSGGTSGLSIGHISPEAANQ
ILVD_BUCCC       IVIRYEGPKGGPGMQEMLYPTTYLKSMGLDKKCALITDGRFSGGTSGISIGHISPEAANK
ILVD_ACTP2       VIIRYEGPKGGPGMQEMLYPTTYLKSIGLGKECALLTDGRFSGGTSGLSIGHCSPEAASG
ILVD_MANSM       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKACALLTDGRFSGGTSGLSIGHCSPEAASG
ILVD_HAES1       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD_HISS2       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD_PASMU       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD_HAEI8       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFSGGTSGLSIGHASPEAASG
ILVD_HAEIG       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFSGGTSGLSIGHASPEAASG
ILVD_HAEIN       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFSGGTSGLSIGHVSPEAASG
ILVD_HAEIE       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFSGGTSGLSIGHASPEAASG
ILVD_ACTSZ       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFSGGTSGLSIGHASPEAASG
ILVD_AERHH       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_AERS4       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKQCALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_VIBCH       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKQCALLTDGRFSGGTSGLSIGHASPEAANG
ILVD_VIBC3       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKQCALLTDGRFSGGTSGLSIGHASPEAANG
ILVD_VIBVU       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALLTDGRFSGGTSGLSIGHASPEAANG
ILVD_VIBVY       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALLTDGRFSGGTSGLSIGHASPEAANG
ILVD_VIBPA       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKECALLTDGRFSGGTSGLSIGHASPEAANG
ILVD_ALIF1       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALLTDGRFSGGTSGLSIGHASPEAASG
ILVD_PHOPR       VVIRYEGPKGGPGMQEMLYPTTYLKSIGLGKECALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_ECOLC       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECOHS       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECO24       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHIF8       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHISS       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHIFL       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECOLI       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHIBS       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECO57       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHIDS       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECOUT       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECOK1       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECOL5       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ECOL6       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SALPB       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SALTY       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SALCH       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SALPA       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SALTI       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_KLEP7       VVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_ENT38       VVIRYEGPKGGPGMQEMLYPTTFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_YERPE       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLSIGHVSPEAASG
ILVD_YERPA       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLSIGHVSPEAASG
ILVD_YERPN       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLSIGHVSPEAASG
ILVD_YERPP       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLSIGHVSPEAASG
ILVD_YERP3       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLSIGHVSPEAASG
ILVD_YERPS       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLSIGHVSPEAASG
ILVD_YERE8       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLSIGHASPEAASG
ILVD_PECAS       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALITDGRFSGGTSGLSIGHASPEAASG
ILVD_SODGM       VVIRYEGPKGGPGMQEMLYPTTFLKSVGLGKSCALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_PHOLL       VVIRYEGPKGGPGMQEMLYPTTYLKSVGLGKSCALITDGRFSGGTSGLSIGHVSPEAANG
ILVD_COLP3       VVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALLTDGRFSGGTSGLSIGHVSPEAADG
ILVD_PSYIN       VVIRYEGPQGGPGMQEMLYPTSYLKSMGLGKKCALVTDGRFSGGTSGLSIGHASPEAAAG
ILVD_SHEB5       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHEB9       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHEB8       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHEPC       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHESW       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHESM       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHESR       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHESA       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHEON       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHEDO       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGAQCALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHEFN       VVIRYEGPKGGPGMQEMLYPTTYLKSRGLGAKCALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHELP       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGTSCALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHEAM       VVIRFEGPKGGPGMQEMLYPTSYLKSRGLGTQCALITDGRFSGGTSGLSIGHVSPEAASG
ILVD_SHEHH       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGTKCALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHEPA       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGTQCALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SHESH       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_PSEA6       VVIRYEGPKGGPGMQEMLYPTTYLKAKGLGKKCALITDGRFSGGTSGLSIGHCSPEAASG
ILVD1_PSEHT      VVIRYEGPKGGPGMQEMLYPTSYLKSKGLAEKCALITDGRFSGGTSGLSIGHVSPEAASG
ILVD1_BURL3      VIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD_BURVG       VIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD2_CUPPJ      VIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD_ACIAC       VIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD_MARMS       VIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKACALLTDGRFSGGTSGLSIGHVSPEAAAG
ILVD_SACD2       VIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKSCALLTDGRFSGGTSGLSIGHVSPEAAAG
ILVD_PSEAE       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEAB       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEA7       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEMY       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKVCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEU5       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKECALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEP1       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEPK       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEPG       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEE4       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEPF       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEF5       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSE14       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKDCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSEU2       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKDCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_PSESM       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKDCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XANAC       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XANC5       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XANOR       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XANOM       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XANCP       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKHCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XANC8       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKHCALLTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XYLFA       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALFTDGRFSGGTSGLSIGHASPEAAAG
ILVD_XYLFT       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALFTDGRFSGGTSGLSIGHASPEAAAG
ILVD_HAHCH       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAG
ILVD_RHORT       VLVRYEGPKGGPGMQEMLYPTSYLKSRGLGKVCALVTDGRFSGGSSGLSIGHVSPEAAAG
ILVD_HYDCU       VLIRYEGPKGGPGMQEMLYPTSYLKSKGLGKECALLTDGRFSGGTSGLSIGHCSPEAAEG
ILVD_CAUVC       VVIRYEGPKGGPGMQEMLYPTTYLKSKGLGAACALVTDGRFSGGTSGLSIGHVSPEAGEG
ILVD_GRABC       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKLCALVTDGRFSGGTSGLSIGHVSPEAAEG
ILVD_ZYMMO       VIVRYEGPKGGPGMQEMLYPTSYLKSKGLGKLCALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_GLUOX       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKVCALITDGRFSGGSSGLSIGHMSPEAAEG
ILVD_AZOSB       VVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKECALLTDGRFSGGTSGLSIGHASPEAAMG
ILVD2_AROAE      VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKECALLTDGRFSGGTSGLSIGHVSPEAACG
ILVD_DECAR       VVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKECALLTDGRFSGGTSGLSIGHASPEAADG
ILVD1_BORBR      VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKTCALFTDGRFSGGSSGLVIGHASPEAAEG
ILVD1_BORPA      VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKTCALFTDGRFSGGSSGLVIGHASPEAAEG
ILVD1_BORPE      VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKTCALFTDGRFSGGSSGLVIGHASPEAAEG
ILVD_BORA1       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKTCALFTDGRFSGGSSGLVIGHASPEAAEG
ILVD_NEIMA       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEG
ILVD_NEIMF       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEG
ILVD_NEIMB       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEG
ILVD_NEIG1       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEG
ILVD_PSYA2       VIIRFEGPKGGPGMQEMLYPTTYLKSKGLGKECALLTDGRFSGGTSGLSIGHASPEAAEG
ILVD_CHRVO       VIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEG
ILVD_METFK       VIIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEG
ILVD_SYNP6       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD_SYNE7       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD_NITOC       VLIRYEGPKGGPGMQEMLYPTSYLKSKGLGEVCALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD_NOVAD       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGAACALLTDGRFSGGTSGLSIGHVSPEAAEG
ILVD_SPHAL       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGAACALVTDGRFSGGTSGLSIGHVSPEAAEG
ILVD1_ACIAD      VVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKDCALITDGRFSGGSSGLSIGHISPEAAEG
ILVD_DEIRA       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALVTDGRFSGGSSGLSIGHVSPEAAEG
ILVD_RHIEC       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAANG
ILVD_RHIL3       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHASPEAANG
ILVD_RHIME       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAANG
ILVD_SINMW       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAANG
ILVD_AGRFC       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHASPEAAQG
ILVD1_RHILO      VVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALVTDGRFSGGTSGLSIGHASPEAAEG
ILVD_BRUAB       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_BRUA2       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_BRUO2       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_BRUC2       VLIRYEGPRGGPGMQEMLYPTSYLKSKGFGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_BRUSU       VLIRYEGPRGGPGMQEMLYPTSYLKSKGFGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_BRUME       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_BRUSI       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_OCHA4       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_RHOP5       VVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHCSPEAAEG
ILVD_NITHX       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKQCALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_NITWN       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKQCALITDGRFSGGSSGLSIGHVSPEAAEG
ILVD_AZOC5       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALVTDGRFSGGSSGLSIGHVSPEAAEG
ILVD_RHOPA       VVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD_RHOP2       IVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD1_BRADU      VVIIYEGPRGGPGMQEMLYPTSYLKSMGLGKACALVTDGRFSGGSSGLSIGHLSPEAAEG
ILVD_BARHE       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKVCALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD_BART1       VLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKVCALVTDGRFSGGSSGLSIGHVSPEAAEG
ILVD_RHOS4       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHASPEAASG
ILVD_RHOS1       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHASPEAASG
ILVD_PARDP       VVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFSGGTSGLSIGHVSPEAAAG
ILVD_RUEPO       VVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHVSPEAAEG
ILVD_RUEST       VVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKDCALLTDGRFSGGTSGLSIGHVSPEAAEG
ILVD_HYPNA       VIIRYEGPRGGPGMQEMLYPTSYLKAMQLGKECALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD_MAGSA       VIVRYEGPRGGPGMQEMLYPTSYLKSMGLGKECALITDGRFSGGTSGLSIGHVSPEAAEG
ILVD_ACICJ       VLIRYEGPKGGPGMQEMLYPTSYLKSKGLGKSCALITDGRFSGGTAGLSIGHISPEAAQG
ILVD_MAGMM       VLIRYEGPKGGPGMQEMLYPTSFLKSKGLGKACALITDGRFSGGTSGLSIGHCSPEAAQG
ILVD_NOSS1       IVIRYEGPKGGPGMREMLAPTSAIIGAGLGDSVGLITDGRFSGGTYGMVVGHVAPEAAVG
ILVD_TRIEI       IVVRYEGPKGGPGMREMLAPTSAIIGAGLGDKVGLITDGRFSGGTYGMVVGHVAPEAAVG
ILVD_ACAM1       IVVRYEGPKGGPGMREMLAPTSAIIGAGLGDSVGLITDGRFSGGTYGMVVGHVAPEAAVG
ILVD_MICAN       VVVRYEGPVGGPGMREMLAPTSAIIGAGLGDSVGLITDGRFSGGTYGMVVGHVAPEAAVG
ILVD_SYNY3       VVVRYEGPKGGPGMREMLAPTSAIIGAGLGDSVGLITDGRFSGGTYGLVVGHVAPEAYVG
ILVD_THEEB       IVIRYEGPVGGPGMREMLAPTSAIIGAGLGDSVGLITDGRFSGGTYGMVVGHVAPEAAVG
ILVD_SYNJB       VVIRYEGPKGGPGMREMLSPTSAIIGAGLGDSVGLITDGRFSGGTYGMVVGHVAPEAYVG
ILVD_SYNJA       VVIRYEGPKGGPGMREMLSPTSAIIGAGLGDSVGLITDGRFSGGTYGMVVGHVAPEAYVG
ILVD_GLOVI       IVIRYEGPKGGPGMREMLSPTSAIIGAGLGDAVGLITDGRFSGGTYGMVVGHVAPEAFVG
ILVD_NITEU       VVIRYEGPQGGPGMREMLSPTSALIGEGLGDSVGLITDGRFSGGTYGMVVGHVAPEAFAG
ILVD_NITEC       VVIRYEGPRGGPGMREMLSPTSALIGEGLGDSVGLITDGRFSGGTYGMVVGHVAPEAYAG
ILVD_NITMU       VVIRYEGPKGGPGMREMLSPTSALIGEGLGDSVGLITDGRFSGGTYGMVVGHVAPEAFVG
ILVD_CHLAA       VVIRYEGPKGGPGMREMLAPTSAIIGAGLGDSVGLITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_DEIGD       IVIRYEGPKGGPGMREMLSPTSAIIGKGLGDSVGLITDGRFSGGTYGLVVGHVAPEAYVG
ILVD_HALHL       VIVRYEGPKGGPGMREMLAPTSAIIGKGLGDAVGLITDGRFSGGTYGMVVGHVAPEAYDG
ILVD_PROMS       VVIRNEGPVGGPGMREMLAPTSAIVGQGLGEKVALITDGRFSGGTYGLVVGHIAPEAAVG
ILVD_PROM9       VVIRNEGPVGGPGMREMLAPTSAIVGQGLGEKVALITDGRFSGGTYGLVVGHIAPEAAVG
ILVD_PROM0       VVIRNEGPVGGPGMREMLAPTSAIVGQGLGEKVALITDGRFSGGTYGLVVGHIAPEAAVG
ILVD_PROM2       VVVRNEGPVGGPGMREMLSPTSAIVGQGLGEKVALITDGRFSGGSYGLVVGHIAPEAAVG
ILVD_PROM5       VVIRNEGPVGGPGMREMLAPTSAIVGQGLGEKVALITDGRFSGGTYGLVVGHIAPEAAVG
ILVD_PROMP       VVIRNEGPVGGPGMREMLAPTSAIVGQGLGEKVALITDGRFSGGTYGLVVGHIAPEAAVG
ILVD_PROMA       VVIRNEGPVGGPGMREMLAPTSAIVGQGLGEKVALITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_PROM3       VVIRNEGPVGGPGMREMLAPTSAIVGADLGDKVALITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_PROMM       VVIRNEGPVGGPGMREMLAPTSAIVGEDLGDKVALITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_SYNSC       VVVRNEGPVGGPGMREMLAPTSAIVGQGLGDKVALITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_SYNPX       VVVRNEGPVGGPGMREMLAPTSAIVGQGLGDRVALITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_SYNS9       VVIRYEGPVGGPGMREMLAPTSAIVGQGLGDKVALITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_SYNR3       VVVRNEGPVGGPGMREMLAPTAAIVGEGLGDKVALITDGRFSGGTYGLVVGHVAPEAAVG
ILVD_PROMT       VVVRYEGPVGGPGMREMLSPTSAIVGQGLGEKVALITDGRFSGGSYGLVVGHVAPEAAVG
ILVD1_AROAE      VVIRYEGPKGGPGMREMLAPTSALVGQGLGESVGLITDGRFSGGTWGMVVGHVSPEAFVG
ILVD3_AROAE      VVIRYEGPKGGPGMREMLAPTSALVGQGLGESVGLITDGRFSGGTWGMVVGHVSPEAFVG
ILVD3_BORBR      VVIRYEGPKGGPGMREMLAPTSALVGQGLGETVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD2_BORPA      VVIRYEGPKGGPGMREMLAPTSALVGQGLGETVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD2_BORPE      VVIRYEGPKGGPGMREMLAPTSALVGQGLGETVGLITDGRFSGGTWGMVVGHVAPEEFVG
ILVD_BURMA       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURM9       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURM7       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURMS       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURPS       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURP6       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURP1       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURP0       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD_BURTA       VVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFVG
ILVD2_BURL3      LVLRYLGPKGGPGMPEMLAPTSAIIGKGLGESVGFITDGRFSGGTWGMVVGHVAPEAFVG
ILVD1_CUPPJ      LVLRYLGPKGGPGMPEMLAPTSAIIGKGLGESVGFITDGRFSGGTWGMVVGHVAPEAYVG
ILVD_RALSO       LVLRYLGPKGGPGMPEMLAPTSAIIGKGLGESVGFVTDGRFSGGTWGMVVGHVAPEAFVG
ILVD_HERAR       LVMRYLGPKGGPGMPEMLAPTSALVGQGLGESVGLITDGRFSGGTWGMVVGHVSPEAFVG
ILVD_JANMA       LVMRYLGPKGGPGMPEMLAPTSALVGQGLGESVGLITDGRFSGGTWGMVVGHVSPEAFVG
ILVD_POLNA       MVLRYLGPKGGPGMPEMLAPTGALIGAGLGESVGLITDGRFSGGTWGMVVGHVAPEAAAG
ILVD_POLSJ       MVLRYLGPKGGPGMPEMLAPTGALIGAGLGESVGLITDGRFSGGTWGMVVGHVAPEAAAG
ILVD_RHOFT       MVLRYLGPKGGPGMPEMLAPTGALVGQGLGESVGLITDGRFSGGTWGMVVGHVAPEAAAG
ILVD_VEREI       MVLRYLGPKGGPGMPEMLAPTGALIGAGLGESVGLITDGRFSGGTWGMVVGHVAPEAAAG
ILVD_METPP       MVLRYLGPMGGPGMPEMLAPTGALIGQGLGESVGLITDGRFSGGTWGMVVGHVAPEAAAG
ILVD_TREPR       VVLIYLGPKGGPGMPEMLSPTAALVGMGLGQSACLITDGRFSGGTWGLVVGHVSPEAAVG
ILVD_CHRSD       VVIRYEGPKGGPGMREMLTPTSAIMGRGLGDKVALITDGRFSGGSHGFVVGHITPEAFVG
ILVD2_PSEHT      VVIRYEGPKGGPGMREMLSPTSAIMGKGLGNDVALITDGRFSGGSRGFVVGHVTPEAYEG
ILVD2_ACIAD      VVIRGEGPKGGPGMREMLKPTSAIIGKGLGQSVALITDGRFSGGSHGFVIGHVTPEAYEG
ILVD_METCA       IVIRYEGPKGGPGMREMLSPTSAVMGKGLGKEVALITDGRFSGGTHGFVVGHITPEAYTG
ILVD_RUTMC       IVIRYEGPVGGPGMREMLAPTSAVMGKGLGDKVALITDGRFSGGTHGFVVGHITPEAFEG
ILVD_LACLS       AVIRNIGPVGGPGMPEMLKPTSALIGAGLGKSCALITDGRFSGGTHGFVVGHIVPEAVEG
ILVD_LACLA       AVIRNIGPVGGPGMPEMLKPTSALIGAGLGKSCALITDGRFSGGTHGFVVGHIVPEAVEG
ILVD_CYTH3       IVIRYVGPKGGPGMPEMLKPTALLMGLGLGNECALITDGRFSGGTHGFVVGHITPEATEG
ILVD_FRATN       IVIRYEGPKGGPGMPEMLKPTSLIMGAGLGQDVALITDGRFSGGSHGFIVGHIAPEAYEG
ILVD_FRATT       IVIRYEGPKGGPGMPEMLKPTSLIMGAGLGQDVALITDGRFSGGSHGFIVGHITPEAYEG
ILVD_FRAP2       IVIRYEGPKGGPGMPEMLKPTSLIMGAGLGQDVALITDGRFSGGSHGFIVGHIAPEAYEG
ILVD_RHOBA       VVIRYEGPKGGPGMPEMLTPTSAIMGAGLGSDVAMLTDGRFSGGSHGFIVGHITPEAQVG
ILVD_LEPBJ       IIIRYEGPKGGPGMREMLAVTSALVGKGLGEDVGLMTDGRFSGGTHGLVVGHISPEAFDG
ILVD_LEPBL       IIIRYEGPKGGPGMREMLAVTSALVGKGLGEDVGLMTDGRFSGGTHGLVVGHISPEAFDG
ILVD_LEPIN       IIIRYEGPKGGPGMREMLAVTSALVGKGLGEDVGLMTDGRFSGGTHGLVVGHISPEAFDG
ILVD_LEPIC       IIIRYEGPKGGPGMREMLAVTSALVGKGLGEDVGLMTDGRFSGGTHGLVVGHISPEAFDG
ILVD_STRPN       VVVRFVGPKGGPGMPEMLSLSSMIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQDG
ILVD_STRR6       VVVRFVGPKGGPGMPEMLSLSSMIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQDG
ILVD_STRP2       VVVRFVGPKGGPGMPEMLSLSSMIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQDG
ILVD_STRT2       VVVRFVGPKGGPGMPEMLSLSSMIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQVG
ILVD_STRT1       VVVRFVGPKGGPGMPEMLSLSSMIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQVG
ILVD_STRSY       VVVRYVGPKGGPGMPEMLSLSSMIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQDG
ILVD_STRS2       VVVRYVGPKGGPGMPEMLSLSSMIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQDG
ILVD_STRSV       VVVRYVGPKGGPGMPEMLSLSSIIVGKGQGDKVALLTDGRFSGGTYGLVVGHIAPEAQDG
ILVD_STRMU       VVVRFVGPKGGPGMPEMLSLSSMIVGKGQGEKVALLTDGRFSGGTYGLVVGHIAPEAQDG
ILVD_OCEIH       LVIRYVGPKGGPGMPEMLSVSSILVGKGMGESVALLTDGRFSGGTHGLVVGHISPEAQDG
ILVD2_STAS1      VVIRYAGPKGAPGMPEMLSASSILVGKGLGESVALLTDGRFSGGSHGLVIGHAAPESQVG
ILVD_ROSCS       VVIRYEGPRGGPGMREMLGVTSAIVGAGLGQSVSLVTDGRFSGATRGVMIGHVAPEAARG
ILVD_ROSS1       VIIRYEGPRGGPGMREMLGVTSAIVGAGLGQSVSLITDGRFSGATRGVMIGHVAPEAARG
ILVD_KORVE       VVVRYEGPKGGPGMREMLGVTAAIAGTELAETVALITDGRFSGATRGLSVGHVAPEAANG
ILVD_THET2       VVIRYVGPKGAPGMPEMLSVTSAIVGEGLGPEVALLTDGRFSGGTRGLMIGHIAPEAFVG
ILVD_THET8       VVIRYVGPKGAPGMPEMLSVTSAIVGEGLGPEVALLTDGRFSGGTRGLMIGHIAPEAFVG
ILVD_HALMA       ICIRNEGPQGGPGMREMLGVTSAVAGQGHAEDVALFTDGRFSGATRGFSIGHVAPEAFVG
ILVD_NATPD       IVIRNEGPEGGPGMREMLGVTAAVVGAGHEDDVALLTDGRFSGGTRGPMIGHIAPEAFVG
ILVD2_BORBR      LVIRNEGPRGGPGMREMLSVTAALYGQGMGEKVALLTDGRFSGATRGLCIGYAGPEAAAG
ILVD3_BRADU      LVIRNEGPVGGPGMREMLGVTALIYGQGMGEKVALITDGRFSGATRGMCIGYVSPEAFVG
ILVD2_BRADU      IVIRYEGPKGGPGMREMLQTTAALTGQGMGGKIALITDGRFSGATRGFCIGHVGPEAAIG
ILVD2_RHILO      LVIRYEGPRGGPGMREMLSTTAALYGQGMGGKVALITDGRFSGATRGFCIGHVGPEAAVG
ILVD_PARL1       LVIRYEGPKGGPGMREMLSTTAALYGQGMGDKVALITDGRFSGGTRGFCIGHVGPEAAVG
ILVD_PELUB       IIIRYEGPVGGPGMREMLSTTGAIYGQGMGEKVALITDGRFSGATRGFCVGHVGPEAALG
ILVD_DINSH       FVIRNEGPAGGPGMREMLATTAALSGQGMGKKVALITDGRFSGATRGFCVGHVGPEAAHG
ILVD_PYRAR       VIIRYEGPKGAPGMPEMLKVTAAIVGAGLGDAVALVTDGRFSGATRGIMVGHVAPEAAVG
ILVD_PYRIL       VVIRYEGPKGAPGMPEMLKVTAAIVGAGLGEAVALVTDGRFSGATRGIMVGHVAPEAAVG
ILVD_PYRAE       VVIRYEGPKGAPGMPEMLKITAAIVGAGLGEVVALITDGRFSGATRGIMVGHVSPEAAVG
ILVD_PYRCJ       VVIRYEGPKGAPGMPEMLKVTAAIVGAGLGESVALVTDGRFSGATRGIMVGHVAPEAAAG
ILVD_AERPE       VVVRYVGPKGAPGMPEMLKITAAIVGAGLGEKVALITDGRFSGATRGVMVGHAAPEAAVG
ILVD_METS5       VVIRYEGPKGGPGMREMLAVTSAIVGQGLGEKVALVTDGRFSGATRGLMVGHVAPEAAVG
ILVD_SULTO       VVIRYEGPKGGPGMREMLAVTSAIVGQGLGEKVALITDGRFSGATRGIMVGHVAPEAAVG
ILVD_PICTO       IVIRYEGPKGGPGMREMLAVTAAVVGKGFDRDVALITDGRFSGATRGIMIGHVAPEAFVG
ILVD_SULAC       VVIRYEGPKGGPGMPEMLRVTAAIVGAGLS-NVAMVTDGRFSGATRGPMVGHVAPEAMVG
ILVD_SACS2       VIIRYEGPKGAPGMPEMLRVTAAIMGAGLN-NVALVTDGRFSGATRGPMVGHVAPEAMVG
ILVD_MYCA1       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDA
ILVD_MYCPA       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDA
ILVD_MYCUA       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGFCVGHIAPEAVDA
ILVD_MYCBO       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDG
ILVD_MYCTU       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDG
ILVD_MYCLE       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGFCVGHIAPEAVEA
ILVD_MYCSJ       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIAPEAVDG
ILVD1_NOCFA      VVIRYEGPKGGPGMREMLAITAAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHVAPEAVDG
ILVD_ACIC1       VVIRYEGPKGGPGMREMLAVTGAIKGAGLGKDVLLVTDGRFSGGTTGFCVAHVAPEAVDG
ILVD_NOCSJ       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLITDGRFSGGTTGLCVGHIAPEAVDG
ILVD_ARTS2       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCIGHVAPEAVDG
ILVD_RENSM       VVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCIGHVAPEAVDA
ILVD_CLAM3       IVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCIGHMAPEAVDA
ILVD_CLAMS       IVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCIGHMAPEAVDA
ILVD_LEIXX       VVICYEGPKGGPGMREMLAITATIKGAGLGKDVLLLTDGRFSGGTTGLCIGHIAPEAVDA
ILVD_TROW8       IVIRYEGPKGGPGMREMLAITAAIKGSGLGKDVLLLTDGRFSGGTTGLCIGHIAPEAVDL
ILVD_TROWT       IVIRYEGPKGGPGMREMLAITAAIKGSGLGKDVLLLTDGRFSGGTTGLCIGHIAPEAVDL
ILVD2_COREF      VIIRYEGPKGGPGMREMLAITGAIKGAGIGKEVLLITDGRFSGGSTGLCIGHVAPEAVDG
                   :   ** * *** * *  :  : .        . ****:**.: *  ..:  **    

ILVD_CALS8       GPIAAVQDGDIISIDIENKTLTL-EVP----EEEIKRRLESL-GPFEP---------KVK
ILVD_HUNT2       GPIAIVRDGDIISIDIPNGKLDV-EIP----DSEIQKRLKEW-KAPAP---------KIT
ILVD_CALS4       GEIAIIEDGDIIEIDIPARKINV-KLS----DEEIKKRMANW-KRPEP---------KIK
ILVD_CLOB8       GNIALVEDGDMIQIDINANTINF-LVS----DEELARRKANW-KPRKP---------KIT
ILVD_CLOK5       GNIALVEEGDIIKIDIEANSIDF-EIS----EEELERRRSNW-KPRQP---------KIT
ILVD_LACP7       GNIALIEEGDIIKIDIPNNSLNF-VVS----DEELERRRVNW-SPREP---------KIT
ILVD_CLOAB       GPIGLVEEGDTIEIDIEKKTINL-LVP----EEKLKNRKP----EKVE---------KPV
ILVD_CARHZ       GPIALVREGDLIKIDIPGQRLDL-LVS----EEELNQRKARL-QIPEP---------KIK
ILVD_MOOTA       GLIALVEEGDIIAIDIEAGKLEL-KVP----EEEIARRRQNW-QAPPP---------KIT
ILVD_SYNFM       GPIALIEEGDEILVDILNKRLEL-MVD----DATLKARRDKW-KAPAP---------RMT
ILVD_SYNAS       GPIALIREGDWIAINIPEKTLTL-KVD----PEELEKRKQEW-KPKAS---------QNL
ILVD_DESVH       GPIGLVQEGDRIRIDIPARALDL-LVD----EDELARRRAAF-VPVEK---------EIT
ILVD_DESVV       GPIGLVQEGDRIRIDIPARALDL-LVD----EDELARRRAVF-VPVEK---------EIT
ILVD_DESAG       GPIGLVREGDMIEIDIPARKLDL-LVD----EAEMERRRAAF-TPVVK---------EVT
ILVD_THEMA       GPIGIVKDGDLIEIDFEKRTLNL-LIS----DEEFERRMKEF-TPLVK---------EVD
ILVD_THEP1       GPIGIVKDGDLIEIDFEKRTLNL-LIS----DEEFERRMKEF-TPLVK---------EVD
ILVD_PYRAB       GPIALVEDGDLIRIDVKAKRIDL-LVD----EEELKERKAKW-KPKVK---------EV-
ILVD_PYRFU       GPIALVKDGDIIRIDLKNKRIDL-LVD----EEELRKRREEW-KPKVK---------EL-
ILVD_CLONN       GPIALIEEGDLIEIDISNRRISL-LVS----PEELSKRKENWIQPPCK---------APD
ILVD_IGNH4       GPIALVQDGDEIVIDIEKRRLDL-LVD----EKELEERRARW-KPKVK---------PLR
ILVD_GEOMG       GPIALVEEGDRIRLDIPNRKLEL-LVD----ESILAERRSRW-VAPEP---------KIK
ILVD_GEOSL       GPIALVEEGDRILLDIPNRRLEL-LVD----EAVLQERRARW-TAPEP---------KIK
ILVD_GEOUR       GPIALVEDGDRIELDIPDRRLEL-LVD----EQTLSERRARW-QAPEP---------KIK
ILVD_PELPD       GPIGLIQDGDRISLDIPARRLEL-LVD----EAVLQARAATW-VAPPP---------KIA
ILVD_PELCD       GPIALVEDGDTIVLDIPSRRLEV-KVS----DQELAKRRERW-QAPEP---------KIK
ILVD_METMJ       GPIALVEDGDEIVIDLYAKSLDL-AVE----RATLEERRKTW-KPPA----------RRL
ILVD_METB6       GPIALVQDGDRIAVDLFMRTIDL-LVD----PEVLTSRKAAW-KPVM----------RPV
ILVD_METHJ       GPIAFVKDGDQISIDLFTKTVNL-NIS----ADEIENRKKGW-KPLK----------RPL
ILVD_ARCFU       GNIALVEDGDKISIDIPARKLEV-KLS----DEELAERRAKW-KPKE----------KEL
ILVD_METTH       GPLAAVNDGDIIRIDIPSRKLEV-DLS----PREIEERLQSA-VKPR----------RSV
ILVD_METST       GPIGAIENGDIVSINVKERTIKL-ELT----DDEIKERLSKV-KPVE----------RNL
ILVD_METS3       GPIGAIEDGDIIEIDIENRFINV-ELS----DEEISNRLANR-KNPK----------RDV
ILVD_METJA       GPIAIVEDGDIIKIDMINKKLDL-ALD----EEEIKERLAKW-KKPEP---------KVK
ILVD_META3       GPIAIIEEGDIIAIDMMAKEINL-KIS----EEEIKERLANW-KKPEI---------KVK
ILVD_METM5       GLIAAIENGDIIKIDMIEKEINV-DLD----ESVIKERLSKL-EEFEP---------KIK
ILVD_METM7       GVIAAIENGDIIKIDMIGKEINV-DLD----ESVIKERLSKL-DEFEP---------KIK
ILVD_METMP       GVIAAIENGDIIKIDMIEKEINV-DLD----ESVIKERLSKL-GEFEP---------KIK
ILVD_METVS       GLIAVINDGDTIKIDMIGKKINV-ELN----NSEIENRLKSL-KIPEP---------KVK
ILVD1_METAC      GPIGLVKDGDLIEINIPERILNL-KVT----EEELEKRKAAF-VPPK----------KEV
ILVD_METMA       GPIGLVKDGDLIEINIPERILNL-KVS----EEELEKRRSVF-NPPE----------KKV
ILVD2_METAC      GPIALVKDGDLIEINIPERALNL-KIS----EEELKQRKASF-VPPK----------TEI
ILVD_METBF       GPIALVKDGDMIEINIPERVLNL-KVS----EEELEQRKAAF-VPPK----------KEV
ILVD_METBU       GPIGLIQEGDIIEIDMPERRLEL-KVS----EEDLEKRRVLF-KPVE----------KEA
ILVD_METTP       GPIALVENGDMISIDIPNRRLDL-LVD----EGVLERRRASW-RPPEP---------RVR
ILVD_METKA       GPIAVVEEGDTIRLDVRERRLEV-DVE----DEELEARLEEW-EPPE----------DEV
ILVD_DEHMB       GPIAALQDGDMINIDIHNYKLSV-ELS----DEEIQKRLANV-PVFEP---------KIK
ILVD_DEHMC       GPIAALQDGDMINIDIHNYKLSV-ELS----DEEIQKRLANV-PVFEP---------KIK
ILVD_DEHM1       GPIAALQDGDMINIDIHNYKLSV-ELS----DEEIQKRLANV-PAFKP---------KIT
ILVD_ANADE       GVIGLVQDGDRITIDVAARALTV-DVS----DAELARRREGFRPKR----------RDPG
ILVD_ANADF       GPLALVQDGDAVTIDVEARALTV-DVP----DAELARRREGFRPKR----------KEIR
ILVD_ARCB4       GMIGLLKDGDEIHIDVDQYILSV-NLS----DEEIAKRKADFKPLK----------KPLN
ILVD_SULNB       GLIGLLEDGDEIHLDVDNYILEA-KLT----FEEIAERKDKFKPVV----------KPLK
ILVD_NITSB       GVIGLLQDGDEIYINVDTYTLEV-KLS----DEELEERRKNFKPKV----------KDIK
ILVD_SULDN       GLIAFIEDGDEIELDTDKHLLRL-NVS----DDVIAARKANYKPYK----------NEVK
ILVD_HELHP       GLIALIEDGDKIAISVSKGTLEL-LVD----SKIIESRRTQWKPIK----------KEIK
ILVD_WOLSU       GMIGLLQEGDLIRIDVEEGVLEV-LLE----EAEIQKRRASFSPKT----------KTVA
ILVD_CAMFF       GMIGLLKDGDIIDIDVDKFSINV-RLS----DTEIEARRKEWKYAG----------KPVN
ILVD_CAMHC       GMIGLLKDGDIIDIDVDNFSINV-RLS----EDEIAERKKEFKYGG----------KKVQ
ILVD_CAMC5       GMIGLLRDGDIIDIDVDTYSINV-RLS----EAETLKRKAEFKPVQ----------KELK
ILVD_CAMJE       GLIGLLKDGDEIEIDVDAYTIHA-NVS----EEEIAKRKKEFALPQ----------KEVS
ILVD_CAMJR       GLIGLLKDGDEIEIDVDAYTIHA-NVS----EEEIAKRKKEFALPQ----------KEVS
ILVD_CAMJD       GLIGLLKDGDEIEIDVDAYTIHA-NLS----EKEITQRKKEFVLPQ----------KEVP
ILVD_CAMJJ       GLIGLLKDGDEIEIDVDAYTIHA-NLS----EEEITQRKKEFVLPQ----------KEVP
ILVD_CAMJ8       GLIGLLKDGDEIEIDVDAYTIHA-NLS----EEEITQRKKEFVLPQ----------KEVP
ILVD_AQUAE       GPIGIVKDGDEILIDIPNRRIEL-LIS----EEEFNERMKNFKPKQ----------KEIK
ILVD_BACVZ       GPLAFVENGDHVIVDIEKRILDV-QVP----EEEWEKRKAEWKGFE----------PKVK
ILVD_BACSU       GPLAFVENGDHIIVDIEKRILDV-QVP----EEEWEKRKANWKGFE----------PKVK
ILVD_BACP2       GPLAFVENGDHVVVDIEQRILSV-DVP----EEEWEKRKANWKGFE----------PKVK
ILVD_BACLD       GPLAFVENGDHIVVDIEKRILNI-EIS----DEEWEKRKANWPGFE----------PKVK
ILVD_GEOKA       GPIAFIQDGDIIEIDTVKRTINV-KLS----DEELERRKANWKGFE----------PKVK
ILVD_BACAH       GTIALLEQGDIVCIDVEERLLEV-RVS----DEELDKRKKEWKRPE----------PKVK
ILVD_BACHK       GTIALLEQGDIVCIDVEERLLEV-RVS----DEELDKRKKEWKRPE----------PKVK
ILVD_BACAN       GTIALLEQGDIVCIDVEERLLEV-RVS----DEELGKRKKEWKRPE----------PKVK
ILVD_BACC1       GTIALLEQGDIVCIDVEERLLEV-RVS----DEELDKRKKEWKRPE----------PKVK
ILVD_BACCZ       GTIALLEQGDIVCIDVEERLLEV-RVS----DEELDKRKKEWKRPE----------PKVK
ILVD_BACCR       GMIALLEQGDIVCIDVEERLLEV-RVS----DEELEKRKKEWKRPE----------PKVK
ILVD_BACCN       GEIALLQQGDIVCIDVEERLLEV-KVS----DEELAKRRKEWKRPE----------PKVK
ILVD_BACSK       GPIAFVENGDMIKIDLIERTIEW-EIS----EEELAKRREGWTEPE----------PKVK
ILVD_BACHD       GPIAFIENGDKIRIDLPNRTIEW-LVS----DEEIAKRQEGWTEPE----------PKVK
ILVD_LISMO       GPIALVHDGDIITIDLPNRTLNV-DVP----DEVLEERRKELPKFK----------AKVK
ILVD_LISMF       GPIALVHDGDIITIDLPNRTLNV-DVS----DEVLEERRKELPKFK----------AKVK
ILVD_LISW6       GPIALVHDGDIITIDLPNRTLNV-DVS----DEVLEERRKELPKFK----------AKVK
ILVD_LISIN       GPIALVHDGDIITIDLPNRTLNV-DVP----DEVLEERRKELPKFK----------AKVK
ILVD_STAAC       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAE       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAA2       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAA9       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAS       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAA1       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAM       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAW       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAN       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAA8       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAT       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAA3       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAB       GPIALIEDGDEITIDLTNRTLNV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAAR       GPIALIEDGDEITIDLTNRTLKV-NQP----EDVLARRRESLTPFK----------AKVK
ILVD_STAES       GPIGLIRDGDKITIDLINRTLNV-NQS----EEELYRRKNQLEPFR----------AKVK
ILVD_STAEQ       GPIGLIRDGDKITIDLINRTLNV-NQS----EEELYRRKNQLEPFR----------AKVK
ILVD_STAHJ       GPIGLIKDGDEVTIDLINRTLNV-NQT----KEELNHRKEALQPFK----------AKVK
ILVD1_STAS1      GPIGLINDGDEITIDLTNRTLDV-NVS----TEELDARKQNVKPFK----------AKVK
ILVD_LEUMM       GPIALVENGDKITIDLVNRTMHL-HVD----DTELAERHEHLKPFV----------PKMR
ILVD_SYMTH       GPIALVRDGDVITIDIPGRRLTL-EVP----ADELERRRAAWVKPA----------PKVR
ILVD_CHLCH       GPIAALQNGDIITIDIPARTMSV-ALS----ESTIKERLAQLPPFE----------PKIK
ILVD_CHLPD       GPIAALKNGDMITIDIPARTISV-DLS----TEAINERIALLPVFE----------PKIK
ILVD_PELLD       GPIAALRNGDTVTIDIPGRSITM-EVS----DEEIADRIAGLPAFV----------PKIR
ILVD_CHLPM       GPIAALQNGDTITIDIPGRTISV-DLT----DEDIASRIAALPDFQ----------PKIK
ILVD_CHLTE       GPIAAVQTGDMITIDIPARSMTV-ALD----DETIRQRIEALPKFE----------PKIK
ILVD_BIFAA       GPIALIKNGDIINIDIPNRTVNV-ELS----DEELAQRRAELEAGD----GYVAHRDRKV
ILVD_BIFLO       GPVALIKNGDIIDIDIEARSVNV-ELT----DEQLDERRRELEAGD----GYVAHRNRHV
ILVD_CORGL       GVIGLIENGDIVSIDVHNRKLEV-QVS----DEELQRRRDAMNASEKP-WQPV-NRNRVV
ILVD_CORGB       GVIGLIENGDIVSIDVHNRKLEV-QVS----NEELQRRRDAMNASEKP-WQPV-NRNRVV
ILVD1_COREF      GVIGLIEDGDIITIDIHNRVLDL-GVS----DEELERRRAAEEASDKP-WQPK-NRQRVV
ILVD_CORDI       GLIGLVENGDTITIDIRNRSLNL-DVD----DAVIEQRRAAMLEREKP-WTPT-NRNRPV
ILVD_CORJK       GLIGLVRDGDPITIDVHERLLQL-NIS----DEEIERRRAEMEASDKP-WTPT-TRQRKV
ILVD3_NOCFA      GVIGLVENGDQIRIDVATRTLEV-LVD----DAVLAERRAKMEASERP-WQPV-DRDRTV
ILVD_FRACC       GTIALVRDGDIIEIDIPARRLEL-VVS----DEELASRRAALEAAGG--YRPT-GRERPV
ILVD_SALAI       GLIALVEPGDEIVIDIPNRTIEL-AVP----ADVLDARRVAQEKRDRP-YTPA-DRQRPV
ILVD_STRAW       GTIALVQDGDRIRIDIPNRTIDL-LVD----EAELSRR---DQALNGV-YAPV-NRERKV
ILVD_STRCO       GTIALVEDGDRIRIDIPNRSIEL-LVD----DAELTRR---EQALNGV-YAPK-NRDRKV
ILVD2_NOCFA      GTIAAVTDGDPITIDIPSRTLRL-EVD----DAEIARRL--AHRRRTG-YRPR-SRHRPL
ILVD_THEFY       GDIALVEDGDIITIDIPNRSITL-EVP----EDELNARRERLLKELGG-FRPR-NRQRPV
ILVD_BACFR       GNIGKIKDGDIIEINIPERTINV-RLT----DEELAAR----------PMTPV-TRERYV
ILVD_BACFN       GNIGKIKDGDIIEINIPERTINV-RLT----DEELAAR----------PMTPV-TRERYV
ILVD_BACTN       GNIGKIVDGDIIEIDIPARTINV-RLT----DEELAAR----------PMTPV-TRDRYV
ILVD_PARD8       GAIGLVRDGDIIEINIPERSINV-RLS----DEELAERRKAEEARGKKAFTPP-TRQREV
ILVD_BLOFL       GLIGLVCDGDMININISKRSIVL-EVS----DYVLKNRYEIEISRGTKAWTPS-CRNRDV
ILVD_BLOPB       GLIGLVHDGDIINIDISMRSITL-EVS----EHILKIRHAAEIARGNKAWTPT-NRNRNI
ILVD_BUCAI       GIIALVKNGDIININIPERTIHL-NIT----EKELSHRILQEESKGPLSYKPH-SRKRYI
ILVD_BUCDN       GVIALVKNGDIINIDITQRVINL-NIT----EQELQQRIFQEESKKSLSYKPL-NRKRHI
ILVD_BUCAP       GIIALVENGDDIQINIVNKTIHL-NIT----EKELNLRIIKENAKGLKAYKPL-NRKRNI
ILVD_BUCMH       GNIALIKNSDCININIPDRIIHL-DIT----NDELLLRIENENKKGSLSYTPL-YRQRYV
ILVD_BUCSC       GNIALIRNNDVININIPNRTINL-DIT----NDEFLNRMHNEIQRGKSSYTPQ-FRKRFV
ILVD_BUCBP       GIIALVRTGDFIDINIPNRKIHL-DIT----DNELLLRIKNEKDRGIDAYTPS-HRKRIV
ILVD_BUCCC       GLIALVYDNDIININIIDRSLKL-KIS----SDEIRKRKEKEENRGIFAYTPK-KRLRKI
ILVD_ACTP2       GTIGLVRDGDKIAIDIPNRSIQL-LVS----DEELAVRRAEQDTKG---WKPA-NRQREV
ILVD_MANSM       GTIGLVRNGDIIAIDIPNRSIQL-QVS----DEELATRRAEQDVKG---WKPA-NRAREV
ILVD_HAES1       GLIGVVKDGDIIEIDIPNRRIEL-MVS----EEELAERRAEQDKLG---WKPA-NRQREV
ILVD_HISS2       GLIGVVKDGDIIEIDIPNRRIEL-MVS----EEELAERRAEQDKLG---WKPA-NRQREV
ILVD_PASMU       GLIGLVKDGDKIEIDIPNRSIQL-CVA----EEELAQRRAEQDKLG---WQPV-NRQREV
ILVD_HAEI8       GAIGLVRDGDIINIDIPNRAINL-EIS----NDELAARRAEQDQKG---WQPA-NREREV
ILVD_HAEIG       GAIGLVRDGDIINIDIPNRAINL-EIS----NDELATRRAEQDQKG---WQPA-NREREV
ILVD_HAEIN       GAIGLVRNGDIINIDIPNRAINL-EIS----NEELATRRAEQDQKG---WQPA-NREREV
ILVD_HAEIE       GAIGLVRDGDIINIDIPNRAINL-EIS----NEELAARRSGQDQKG---WQPA-HREREV
ILVD_ACTSZ       GAIGLVNNDDIIEIDIPNRAINL-VLP----DEELAVRRAAMEAKGARAWQPE-NRRREV
ILVD_AERHH       GTIGLVEDGDIINIDIPARSMVL-EVA----DSVLAARRVAVEARG---WKPL-DRQRQV
ILVD_AERS4       GTIGLVADGDIININIPARSMVL-EVA----DSVLAARRVAVEARG---WKPL-DRQRQV
ILVD_VIBCH       GTIGLVRSGDSIAIDIPNRSITL-EVS----ESELAARRAEQDKLG---WKPV-DRQRTV
ILVD_VIBC3       GTIGLVRSGDSIAIDIPNRSITL-EVS----ESELAARRAEQDKLG---WKPV-DRQRTV
ILVD_VIBVU       GAIGLVKQGDLIAIDIPNRTISL-QVS----DQEMAERRAEQDALG---WKPV-SRQREV
ILVD_VIBVY       GAIGLVKQGDLIAIDIPNRTISL-QVS----EQEMAERRAEQDALG---WKPV-SRQREV
ILVD_VIBPA       GAIGLVQDGDLIAIDIPNRSISL-EIS----EQELAERRVKQDELG---WKPA-NRQREV
ILVD_ALIF1       GTIGLVNDGDIITIDIPSRSITL-DVP----ESELQARRAKQDELG---WKPV-NRQREV
ILVD_PHOPR       GTIGLVNDGDIINIDIPNRSIEL-HVD----DTELAQRRATADQQG---WKPV-NRQREV
ILVD_ECOLC       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_ECOHS       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_ECO24       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_SHIF8       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_SHISS       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_SHIFL       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_ECOLI       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQDARGDKAWTPK-NRERQV
ILVD_SHIBS       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_ECO57       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQI
ILVD_SHIDS       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_ECOUT       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_ECOK1       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-NRERQV
ILVD_ECOL5       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGNKAWTPK-NRERQV
ILVD_ECOL6       GSIGLIEDGDLIAIDIPNRGIQL-QVS----DAELAARREAQEARGDKAWTPK-KRERQV
ILVD_SALPB       GTIALIEDGDTIAIDIPNRSIQL-QLS----EAEIAARREAQEARGDKAWTPK-NRQRQV
ILVD_SALTY       GTIALIEDGDTIAIDIPNRSIQL-QLS----EAEIAARREAQEARGDKAWTPK-NRQRQV
ILVD_SALCH       GTIALIEDGDTIAIDIPNRSIQL-QLS----EAEIAARREAQEARGDKAWTPK-NRQRQV
ILVD_SALPA       GTIALIEDGDTIAIDIPNRSIQL-QLS----EAEIAARREAQEARGDKAWTPK-NRQRQV
ILVD_SALTI       GTIALIEDGDTIAIDIPNRSIQL-QLS----EAEIAARREAQEARGDKAWTPK-NRQRQV
ILVD_KLEP7       GNIALIEDGDMIAIDIPNRSIQL-QLS----DAEIAARREAQEARGDQAWTPK-NRQRQV
ILVD_ENT38       GNIAIIEDGDLIEIDIPNRGIQL-QLS----DQEIAARREAQDARGDKAWTPK-DRQREV
ILVD_YERPE       GLIGLVQDGDFINIDIPNRGIVL-DVS----EAELAARRETEEAHGDAAWSPK-GRERQV
ILVD_YERPA       GLIGLVQDGDFINIDIPNRGIVL-DVS----EAELAARRETEEAHGDAAWSPK-GRERQV
ILVD_YERPN       GLIGLVQDGDFINIDIPNRGIVL-DVS----EAELAARRETEEAHGDAAWSPK-GRERQV
ILVD_YERPP       GLIGLVQDGDFINIDIPNRGIVL-DVS----EAELAARRETEEAHGDAAWSPK-GRERQV
ILVD_YERP3       GLIGLVQDGDFINIDIPNRGIVL-DVS----EAELAARRETEEAHGDAAWSPK-GRERQV
ILVD_YERPS       GLIGLVQDGDFINIDIPNRGIVL-DVS----EAELAARRETEEAHGDAAWSPK-GRERQV
ILVD_YERE8       GLIALVQDGDIIDIDIPNRAMKL-DVS----DAELAARREAELARGDAAWTPK-ARERQV
ILVD_PECAS       GIIGLVQDGDMIAIDIPSRSIVL-DVA----ENELASRRETELARGDAAWTPH-NRERQV
ILVD_SODGM       GLIGLVRDGDIIDINIAGRGIVL-DVA----DSELAARRETELARGAAAWTPV-ARERQV
ILVD_PHOLL       GLIGLVQDGDIIDIDIPLRKIRL-DVD----ERILATRKEVEFARGDKSWTPK-ARERQV
ILVD_COLP3       GTIALVEQGDIIHIDIPTREITL-QVS----EEVLEERRAAMISKGKQAWKPA-DRVRPI
ILVD_PSYIN       GVIGLIEDGDIIDINIPTRTMDL-KVS----DEILAERRIAMDIHG---WKPV-SRERHV
ILVD_SHEB5       GTIALIENGDRIEIDIPKRSIKL-AVS----DVELNARREKMHSLGPMAWKPI-GRQRYV
ILVD_SHEB9       GTIALIENGDRIEIDIPKRSIKL-AVS----DVELNARREKMHSLGPMAWKPI-GRQRYV
ILVD_SHEB8       GTIALIENGDRIEIDIPKRSIKL-AVS----DVELNARREKMHSLGPMAWKPI-GRQRYV
ILVD_SHEPC       GTIALIENGDRIEIDIPKRSIKL-AIS----DAELNARREAMLARGPMAWKPI-GRERYV
ILVD_SHESW       GTIALIENGDRIEIDIPKRSIKL-ALT----DAELAARREAMLARGPMAWKPI-GRERFV
ILVD_SHESM       GTIALIENGDRIEIDIPKRSIKL-AVS----DAELAARRETMLARGPMAWKPL-SRQRYV
ILVD_SHESR       GTIALIENGDRIEIDIPKRSIKL-AVS----DAELAARRETMLARGPMAWKPL-SRQRYV
ILVD_SHESA       GTIALIENGDRIEIDIPKRSIKL-AVS----DAELAARRETMLARGPMAWKPL-SRQRYV
ILVD_SHEON       GTIALIENGDRIEIDIPARSIKL-AVS----DAELAGRRETMLARGPMAWKPV-GRERFV
ILVD_SHEDO       GAIALIEQGDEIVIDIPARTIVL-NVS----DSELEARRQAMDAKGVLGWKPL-NRQRYV
ILVD_SHEFN       GTIALIENGDQIAIDIPKRSIQL-NVS----EAELTQRRTAMDAKGPLGWKPV-SRERYV
ILVD_SHELP       GTIALVETGDRIEIDIPARSITL-AVS----DEVLETRRQAMQARGKQAWKPV-NRERSV
ILVD_SHEAM       GTIGLIENGDRIDIDIPGRSIKL-LVS----DAELESRRAAMNAKGPLAWKPL-SRVRPV
ILVD_SHEHH       GTIGLVQTGDRIEIDIPARSIKL-AIS----DIELAARRTAMEALGKDAWKPL-GRVRQV
ILVD_SHEPA       GTIGLVQTGDRIEIDIPARSIKL-AIS----DVELAARRTAMEALGNDAWKPL-GRVRHV
ILVD_SHESH       GTIGLVETGDRIEIDIPARSIKL-AIS----DIELAARRSAMEARGKQAWKPV-GRVREV
ILVD_PSEA6       GGIGLVEEGDSMTIDIPQRKIGV-DIS----DEVLQARRE-KMEQSANPWKPV-SRERKV
ILVD1_PSEHT      GAIAYVENGDKIIIDIATREITL-ALS----DAELEARKQKQLARGKQAYKPL-DRQRYV
ILVD1_BURL3      GAIGLVRDGDKIRIDIPNRTINV-LVS----DEELARRREEQNAKG---WKPAQPRPRKV
ILVD_BURVG       GAIGLVRDGDRIRIDIPNRTIDV-LVS----DEELARRREEQNAKG---WKPAQPRPRKV
ILVD2_CUPPJ      GAIGLVRDGDKIRIDIPNRTIDV-LVS----DEELARRREEQNAKG---WKPAKARPRKV
ILVD_ACIAC       GAIGLVQNGDRIRIDIPNRTIDV-LVS----DEELARRRAEQDAKG---WKPAKPRPRKV
ILVD_MARMS       GAIGLVENGDRILIDIPNRSINV-LLS----DEELAKRRAAMEAKGAAAWKPVEMRPRKV
ILVD_SACD2       GAIGLVKTGDKILIDIPNRSINV-LLE----DGELEKRRAEQDAKG---WKPELPRPRKV
ILVD_PSEAE       GAIGLVQDGDKVLIDIPNRSINL-LVS----DEELAARRAEQDKKG---WKPAAPRARRV
ILVD_PSEAB       GAIGLVQDGDKVLIDIPNRSINL-LVS----DEELAARRAEQDKKG---WKPAAPRARRV
ILVD_PSEA7       GAIGLVQDGDKVLIDIPNRSINL-LVS----DEELAARRAEQDRKG---WKPAAPRARRV
ILVD_PSEMY       GAIGLVKDGDKVLIDIPNRSINL-LVS----DEELAVRRAEQDKKG---WKPVQPRARKV
ILVD_PSEU5       GAIGLVQDGDKVLIDIPNRSIQL-QVS----DEELAHRRIEQDKKG---WKPAQPRARKV
ILVD_PSEP1       GAIGLVRDGDKVLIDIPNRSINL-LVS----DEELAERRVEQDKKG---WKPAEVRPRKV
ILVD_PSEPK       GAIGLVRDGDKVLIDIPNRSINL-LVS----DEELAQRRVEQDKKG---WKPAEVRPRKV
ILVD_PSEPG       GAIGLVRDGDKVLIDIPNRSINL-LVS----DEELAERRVEQDKKG---WKPAEVRPRKV
ILVD_PSEE4       GAIGLVRDGDKVLIDIPNRSINL-LVS----DEELAARRVEQDKKG---WKPAEVRPRKV
ILVD_PSEPF       GAIGLVQDGDKVLIDIPNRSINL-LIS----DEELAARRVEQDKKG---WKPVEQRPRKV
ILVD_PSEF5       GTIGLVQDGDKVLIDIPNRSINL-LVS----DEELAARRVEQDKKG---WKPVEARPRKV
ILVD_PSE14       GAIGLVRDGDKVLIDIPNRSINL-LID----DAEMAERRTEQDKKG---WKPVESRPRKV
ILVD_PSEU2       GAIGLVRDGDKVLIDIPNRSINL-LID----DAEMAERRTEQDKKG---WKPVESRPRKV
ILVD_PSESM       GAIGLVRDGDKVLIDIPNRSINL-MID----DAEMAERRAEQDKKG---WKPVESRPRKV
ILVD_XANAC       GAIGLVREGDRILIDIPNRSINL-LIS----DEELALRRAEQDAKG---WKPVEVRPRKV
ILVD_XANC5       GAIGLVRDGDRILIDIPKRSINL-LIS----DEELALRRAEQDAKG---WKPVEVRPRKV
ILVD_XANOR       GAIGLVRDGDKILIDIPNRGINL-LIS----DEALASRRAEQDAKG---WKPVEVRPRKV
ILVD_XANOM       GAIGLVRDGDKILIDIPNRGINL-LIS----DEALASRRAEQDAKG---WKPVEVRPRKV
ILVD_XANCP       GAIGLVRNGDKILIDIPKRSIDL-LVS----DEELAARRTEQDAKG---WKPVEVRPRKV
ILVD_XANC8       GAIGLVRNGDKILIDIPKRSIDL-LVS----DEELAARRTEQDAKG---WKPVEVRPRKV
ILVD_XYLFA       GAIGLIRDGDRIRIDIPQRAINV-LIS----EEELASRRLEQHAIG---WKPAQSRTRKV
ILVD_XYLFT       GAIGLIRDGDRIRIDIPQRAINV-LIS----EEELASRRLEQHAIG---WKPAQSRTRKV
ILVD_HAHCH       GAIGLIEEGDEIIIDIPNRGINV-SLT----PEQLKARRQAMEAKGADAWKPAQPRPRKV
ILVD_RHORT       GPIGLVEEGDIIVIDIPARSIVV-DLS----DEELAARRSAMEARGRAGWKPAKPRKRAV
ILVD_HYDCU       GNIGLVEEGDLIKIDIPNRTISV-DLT----DEELAERRQAMVAKGKAAWKPAEPRTRKV
ILVD_CAUVC       GLIALVETGDPILIDIPTRGITL-EVS----DAVLAARREAQLARGKDAWTPL-NRKRDL
ILVD_GRABC       GLIALVETGDPVLIDIPNRIISI-ALP----DEVLAARRTAMEAKGEAAWKPA-ERQRKV
ILVD_ZYMMO       GLIALVETGDTIVIDIPERIIHL-DVD----DAVIADRHARMEAKGAAAWKPQ-NRNRPI
ILVD_GLUOX       GLIGLVEDGDRIEIDIPNRTLHL-AVS----DSDIADRRERMNARGASAWKP--NRERVV
ILVD_AZOSB       GAIALVEDGDTIEIDIPNRRIAL-AVS----DEELARRRAAMEAKGAAAWKPA-NRERVV
ILVD2_AROAE      GAIGLVEEGDSIEIDIPNRRIHL-AVP----DEVLTARRAAMNAKGHKAWKPE-GRQRVV
ILVD_DECAR       GAIGLVEEGDTIEIDIPNRRIHL-AVT----DGELAQRRAAMEAKGEAAWQPV-SRERVI
ILVD1_BORBR      GTIGLVEEGDTIEIDIPNRRIHL-AVG----DTVLAERRAAMQARGEQAWQPV-DRERVV
ILVD1_BORPA      GTIGLVEEGDTIEIDIPNRRIHL-AVG----DTVLAERRAAMQARGEQAWQPV-DRERVV
ILVD1_BORPE      GTIGLVEEGDTIEIDIPNRRIHL-AVG----DTVLAERRAAMQARGEQAWQPV-DRERVV
ILVD_BORA1       GAIGLVEDGDVIEIDIPKRRMHL-AVD----DAELARRRAAMDARGDKAWQPL-DRERVV
ILVD_NEIMA       GAIGLVHEGDTVEIDIPNRSIRL-VIS----DEELAARRAEMEARGSKAWKPE-NRDRYV
ILVD_NEIMF       GAIGLVHEGDTVEIDIPNRSIHL-AIS----DEELAARRAEMEARGSKAWKPE-NRDRYV
ILVD_NEIMB       GAIGLVHEGDTVEIDIPNRSIHL-AIS----DEELAARRAEMEARGSKAWKPK-NRDRYV
ILVD_NEIG1       GAIGLVHEGDTIEIDIPKRSIRL-VIS----DEELAARRAEMEARGSKAWKPE-NRDRYV
ILVD_PSYA2       GAIGLVQEGDTIHIDIPNRTINM-QVS----DEELAARREEMDSRGRDAWKPV-SRDRHV
ILVD_CHRVO       GAIGLAQEGDTVEIDIPNRRIHL-AVS----DEELAKRRAAMEAKGRDAWKPL-GRERVV
ILVD_METFK       GAIGLVEENDIIEIDIPNRTIHL-AVK----DEVLAHRRAAMEARGKDAWKPV-NRQRHI
ILVD_SYNP6       GLIALVEQGDRIEIDIPNRRIHL-AVS----EEELAHRRAAMEARGDQAWTPK-DRDRPI
ILVD_SYNE7       GLIALVEQGDRIEIDIPNRRIHL-AVS----EEELAHRRAAMEARGDQAWTPK-DRDRPI
ILVD_NITOC       GTIGLVEEGDRIEIDIPHRRIHL-AVD----EEELAQRQRAMEAKAQQAWRPV-NRNRTV
ILVD_NOVAD       GEIGLVENGDVIEIDIPNRTIHL-AVA----DDVLAQRRAEQEAKG---WKPVKERPRKV
ILVD_SPHAL       GTIGLVENGDLINIDIPSRTITL-AVA----DSVLAERRAAMEAKGDAAWQPAKPRPRKV
ILVD1_ACIAD      GAIGLVEDGDLIEIDIPNRSMNL-KVD----DETLAARRKAQDEKG---WKPVEERKRKV
ILVD_DEIRA       GTIGLVETGDLIEIDIPNRTIHL-AVP----DAELAARRQKREEEG---WHPAEPRPRKI
ILVD_RHIEC       GTIGLVREGDIIDIDIPNRTISL-RVG----EAELAARRAEQDARG---WRPTEVRKRNV
ILVD_RHIL3       GTIGLVREGDMIDIDIPNRTISL-RVS----ETELAARRAEQDAKG---WYPTEVRKRNV
ILVD_RHIME       GTIGLVREGDMIDIDIPNRTISL-RVD----EAELAARRTEQDAKG---WKPVEQRKRRV
ILVD_SINMW       GTIGLVREGDMIDIDIPNRTIVL-RVD----EAELAARRKEQDAKG---WKPVEQRKRRV
ILVD_AGRFC       GAIGLVRQGDLIEIDIPNRTINL-KVS----DAELAARRAEQEEKG---WKPEAPRKRNV
ILVD1_RHILO      GTIGLVQEGDTIEIDIPNRTIRL-AVS----DAELDSRRAAMEAKGALAWKPEEKRKRKV
ILVD_BRUAB       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATLAERRAEQDAAG---WKPAEERKRKI
ILVD_BRUA2       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATLAERRAEQDAAG---WKPAEERKRKI
ILVD_BRUO2       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATLAERRAEQDAAG---WKPAEERKRKI
ILVD_BRUC2       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATLAERRAEQDAAG---WKPAEERKRKI
ILVD_BRUSU       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATLAERRAEQDAAG---WKPAEERKRKI
ILVD_BRUME       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATLAERRAEQDAAG---WKPAEERKRKI
ILVD_BRUSI       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATVAERRAEQDAAG---WKPAEERKRKI
ILVD_OCHA4       GTIGLVREGDIIDIDIPNRKIHL-AVD----DATLAERRAEQEETG---WKPAETRKRKI
ILVD_RHOP5       GTIGLVETGDMIDIDIPNRGINL-RVS----DAVLAERRKAMEAKGKDAWKPVAPRKRKI
ILVD_NITHX       GAIGLVEEGDRIVFDIPNRKVHL-DVS----DAELERRRAAMEAKGDKAWKPA-PRKRRV
ILVD_NITWN       GAIGLVEEGDLIAFDIPNRKVHL-DVS----DAELERRRAAMEAKGDKAWKPAAPRTRRI
ILVD_AZOC5       GAIGLVEEGDTIEIDIPNRRIHL-AIS----DEEMARRRAAMEAKGDAAWKPK-DRQRVV
ILVD_RHOPA       GLIGLVRDGDRISIDIPNRTISL-DVS----EAELAKRGEEERARGEAAWTPK-DRKRNV
ILVD_RHOP2       GLIGLVRNGDRISIDIPNRGITL-DVA----ADELSRRAEEEEAKGDKAWQPK-DRKRKV
ILVD1_BRADU      GNIGLVRTGDLIAIDIPNRSITL-EVS----DEELAKRRASEEAKGDAAWQAT-GRKRNV
ILVD_BARHE       GAIALVEEGDIIEIDIPNRTIHM-LVE----DDELMHRRVKMEAKGKAAWQPTEKRKRKV
ILVD_BART1       GEIALVEEGDIIEIDIPNRSIHM-LVD----DVEMKQRRAKMAAKGNGAWQPIEKRQRKV
ILVD_RHOS4       GPIGLVREGDRIEIDIPNRTITL-AVP----EAELAARRAEQDAKG---WKPAGPRKRKV
ILVD_RHOS1       GPIGLVREGDRIEIDIPNRTITL-AVP----EAELAARRAEQDAKG---WKPAGPRKRKV
ILVD_PARDP       GTIGLVRDGDRIEIDIPNRSIRL-AVP----EDELAARRAEQDAKG---WKPAQPRQRQV
ILVD_RUEPO       GTIGLVEDGDRIEIDIPNRRIHL-AVS----DEVLAARRAAQEAKG---WHPAKPRKRKV
ILVD_RUEST       GTIGLVEHGDTIEIDIPNRSIHL-AVD----EATLAARRAAQDEKG---WKPVAKRKRKV
ILVD_HYPNA       GAIGLLHEGDIIEIDIPNRTINA-KVS----AEEFAKRRAEMDAKGAAAWKPVEERPRKV
ILVD_MAGSA       GAIGLIQAGDIIDIHIPNRSIAI-RVS----DAELEKRRQAMQALGPKAWKPV-DRDRQV
ILVD_ACICJ       GAIGLVEEGDIIAIDIPNRKLDV-KLD----EATLEARRAAMEAKGKAAWKPA-ARERVV
ILVD_MAGMM       GAIGLVEEGDLIEIDIPNRLLQV-KLS----DAQLAERRQAMLARGNEAFKPV-GRQRVV
ILVD_NOSS1       GAIALVQEGDSITIDAHARSLQL-NIS----DEELTRRRANWQ-PRPP---------RYT
ILVD_TRIEI       GTIALVKEGDMITIDAHKRLLQL-NIS----DEELEKRRQVWK-PRKP---------QYT
ILVD_ACAM1       GTIALVQEGDQITIDAHARKLEL-HVS----DQELKERKEKWE-QPKP---------LYN
ILVD_MICAN       GTIALVEEGDQITIDARQRLLSL-NVS----EEELTRRRNHWQ-PRPP---------RYK
ILVD_SYNY3       GAIALVQEGDQITIDAGKRLLQL-NIS----EEELAQRRAQWT-PPQP---------RYP
ILVD_THEEB       GTIALVQEGDSITIDAHRRLLQL-NVS----EEELAARRAKWQ-PPAP---------RYT
ILVD_SYNJB       GTIALVEEGDLITIDAPARQLHL-HVS----EEELARRRARWS-PPEP---------RYK
ILVD_SYNJA       GPIALVEEGDLITIDAPARLLHL-HVS----EEELARRRARWA-PPEP---------RYK
ILVD_GLOVI       GTIALVEAGDLITIDAPARKIEL-LVT----TDELERRRAAWR-PPAP---------RYI
ILVD_NITEU       GTIALVQEGDSITIDAHRRLLQL-NVP----EAELERRRAAWH-PPAP---------RYT
ILVD_NITEC       GVIALVEEGDSITIDAHRRLLQL-NVS----ETELERRRAAWQ-PPAP---------RYT
ILVD_NITMU       GTIALVREGDSITIDAEQRLLQL-NIP----GDELARRRAEWQ-PPHP---------RYT
ILVD_CHLAA       GTIALVEEGDSITIDADARLLQL-NVS----DEELARRRAAWQ-PRPP---------RYT
ILVD_DEIGD       GPIALVQEGDIIELNAETCELTL-HVD----DAELERRRAAWV-APEP---------RYR
ILVD_HALHL       GTIALIAEGDTVTIDADQNLLQV-EVD----DAELERRRSQWQ-VPRP---------RYR
ILVD_PROMS       GNIALIKQGDLITVDAVKQLIEV-DLS----DEELEKRKKDWV-KPIQ---------KYK
ILVD_PROM9       GNIALIKQGDLITVDAVKQLIEV-DLS----DEELEKRKKDWV-KPIQ---------KYK
ILVD_PROM0       GNIALIKEGDLITVDAVKQLIEV-NLS----DEELKKRKKDWV-KPIQ---------KYK
ILVD_PROM2       GNIALIKEGDLITVDAVKQLIEV-DLS----DEELEKRKNNWV-KPKP---------KYK
ILVD_PROM5       GNIALIREGDLITVDAVNQLIEV-ELS----DGELEKRRINWI-KPIP---------KYK
ILVD_PROMP       GNIALIKEGDLITVDATNQLIEV-ELS----DEELEMRRINWE-KPSK---------KYK
ILVD_PROMA       GNIALIQDGDSITVDAIQKLIQV-NIE----EAELKRRRSLWV-KPKP---------KYN
ILVD_PROM3       GMIGLVHEGDSITIDADQLLIQL-NIE----NDELERRSSAWK-KPQP---------RYQ
ILVD_PROMM       GMIGLVQEGDSITIDANQLLIQL-NVE----KDELERRSSAWE-KTQP---------RYQ
ILVD_SYNSC       GTIGLVQEGDSITVDADQLLLQL-NVD----QAELDRRRAGWS-KPEP---------RYR
ILVD_SYNPX       GTIGLVQGGDSITVDADQLLLQL-NVD----EAELTRRRAAWS-KPEP---------RYR
ILVD_SYNS9       GTIGLVQEGDSITVDANQLLLQL-NVD----ETELAKRRAAWS-KPKP---------RYT
ILVD_SYNR3       GMIGLVQEGDSITVDAQQQLLQL-NVD----AAELERRKQAWV-KPEP---------RYR
ILVD_PROMT       GTIGLVEEGDSITVDANKLLIQL-NVE----ERELARRKQKWE-KPKP---------RYK
ILVD1_AROAE      GPIALVREGDSVTIDAHRQLVQL-NVG----DEELARRAADWT-PPSP---------RYT
ILVD3_AROAE      GPIALVRDGDSVTIDAHRQLVQL-NVG----DEELARRAADWT-PPSP---------RYT
ILVD3_BORBR      GPIALIREGDSVTIDAHQLLLQL-NIS----DEEMAARRKAWA-QPKP---------RYV
ILVD2_BORPA      GPIALIREGDSVTIDAHQLLLQL-NIS----DEEMAARRKAWA-QPKP---------RYV
ILVD2_BORPE      GPIALIREGDSVTIDAHQLLLLLLNIS----DEEMAARRKAWA-QPKP---------RYV
ILVD_BURMA       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD_BURM9       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD_BURM7       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD_BURMS       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD_BURPS       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD_BURP6       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD_BURP1       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRVAWK-QPAP---------RYT
ILVD_BURP0       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD_BURTA       GTIALVQEGDSITIDAHKLLLQL-NVD----DAELARRRAAWK-QPAP---------RYT
ILVD2_BURL3      GTIALVQEGDSITIDAHRLLLQL-NVD----DAELARRRAAWQ-QPAP---------RYT
ILVD1_CUPPJ      GNIALVREGDSITIDAHKLVLQV-NVS----DEELARRRAEWK-QPVA---------RYT
ILVD_RALSO       GTIALVQEGDSITIDAHQRLLQL-NVP----EDELARRRAAWK-QPAP---------RYT
ILVD_HERAR       GTIGLVEEGDSVTIDARQLLIQL-NVS----EEEIARRRANWK-QPAP---------RYT
ILVD_JANMA       GLIGLVEEGDSVTIDAHKLLIQL-NVP----EEEIARRRANWK-QPAP---------RYT
ILVD_POLNA       GNIAFIEEGDSITIDANQLLLQL-NIS----DAELESRKVGWT-APAP---------RYT
ILVD_POLSJ       GNIAFINEGDSITIDSKQLLLQL-NIS----DAELEKRKVGWK-APAP---------RYN
ILVD_RHOFT       GLIALIEEGDSITIDAHQLLLQL-NVS----DDIIAKRRSVWT-APQP---------RYT
ILVD_VEREI       GTIAFVHEGDSITIDARQLLLQL-NVA----EAEIARRRARWT-APAA---------RYT
ILVD_METPP       GTIALVQEGDSITIDAHTLVLNL-NVS----EAEIAKRRAAWK-APAP---------RYT
ILVD_TREPR       GSIALVRNGDFITVDLRNNSLHL-HID----AWSLAARRAAWR-LPCT---------LCV
ILVD_CHRSD       GPIGLVEDGDEITIDAENDIMTL-HID----DAEMARRRAAWK-RPAP---------RYT
ILVD2_PSEHT      GAIALVENGDSITIDAQSREMTL-NIT----DEEMASRKQRWQ-QPAP---------KYT
ILVD2_ACIAD      GPIGLVENGDKISINAETREITL-HIS----NEEMSLRRAKWQ-KPEP---------KYK
ILVD_METCA       GPLAIVRDGDTITIDAETRELSL-HVT----DDEIGRRLAQWT-QPAP---------RYT
ILVD_RUTMC       GVLAVVKDGDEILIDAQNNVLEL-LVE----QAIIDKRLYNWT-QPKP---------NYT
ILVD_LACLS       GLIGLVEDDDIIEIDAVNNSISL-KVA----DDEIARRRANYQ-KPAP---------KAT
ILVD_LACLA       GLIGLVEDDDIIEIDAVNNSISL-KVS----DEEIAKRRANYQ-KPTP---------KAT
ILVD_CYTH3       GMIGLVKNGDIIRIDAVNRVLEV-KIS----EEEVTKRRAAWV-KPAP---------RAT
ILVD_FRATN       GMIALLENGDKITIDAINNVINV-DLS----DQEIAQRKSKWR-APKQ---------KAS
ILVD_FRATT       GMIALLENGDKITIDAINNVINV-DLS----DQEIAQRKSKWR-ASKQ---------KAS
ILVD_FRAP2       GMLALLENGDKITIDAINNVINV-DLS----DQEIAQRKAKWQ-APKQ---------KAT
ILVD_RHOBA       GPIALIEDGDTITIDAETNSLDL-EVD----AAELEARRSKWT-APPL---------KAT
ILVD_LEPBJ       GPIAIVQNGDAVTIDSGKNLLQV-EIS----QEEIQKRLKNWK-PIEP---------RYK
ILVD_LEPBL       GPIAIVQNGDAVTIDSGKNLLQV-EIS----QEEIQKRLKNWK-PIEP---------RYK
ILVD_LEPIN       GPIAIVQNGDKVTIDSSKNLLQV-EIS----QEEIDKRLKSWK-PIEP---------RYK
ILVD_LEPIC       GPIAIIQNGDKVTIDSSKNLLQV-EIS----QEEIDKRLKSWK-PIEP---------RYK
ILVD_STRPN       GPIAYLRTGDIVTVDQDTKEISM-AVS----EEELEKRKAETT-LPPL---------Y-S
ILVD_STRR6       GPIAYLRTGDIVTVDQDTKEISM-AVS----EEELEKRKAETT-LPPL---------Y-S
ILVD_STRP2       GPIAYLRTGDIVTVDQDTKEISM-AVS----EEELEKRKAETT-LPPL---------Y-S
ILVD_STRT2       GPIAYLRTGDMVTVDQDTKEITM-HVP----DEELAKRKAETE-LPPL---------Y-S
ILVD_STRT1       GPIAYLRTGDMVTVDQDTKEITM-HVP----DEELAKRKAETE-LPPL---------Y-S
ILVD_STRSY       GPIAYLRTGDLVTVDQDTKEITM-HVS----DQEIEERKKTTV-IPPL---------Y-S
ILVD_STRS2       GPIAYLRTGDLVTVDQDTKEITM-HVS----DQEIEERKKTTV-IPPL---------Y-S
ILVD_STRSV       GPIAYLRTGDMVTVDQDTKEISM-AVS----DEELAKRKAETT-IPPL---------Y-S
ILVD_STRMU       GPIAYLQTGDIVTIDQDTKELHF-DIS----DEELKHRQETIE-LPPL---------Y-S
ILVD_OCEIH       GPIAFLQEGDMVTIDSNKREISM-DVS----EDEIKLRQGKWE-APEL---------H-K
ILVD2_STAS1      GPMALLEENDTITIDAEKLEISF-DVS----DEELERRNKQWQ-APPL---------KAN
ILVD_ROSCS       GPLAIVQEGDEIEINLDERRVDL-VLS----EEEIADRLLAWQPPAPR----------FE
ILVD_ROSS1       GPLAIVQEGDEIEINLDERRVDL-LLS----EEEIADRLLAWQPPAPR----------YE
ILVD_KORVE       GAIAVVRNGDIITLDVERRELRV-HLT----DAELEARLRNWRAPEPR----------YK
ILVD_THET2       GPIALLEEGDRIRIDVEGRRLEV-LLP----EEELERRRARWRPRPPA----------FT
ILVD_THET8       GPIALLEEGDRIRIDVEGRRLEV-LLP----EEELERRRARWRPRPPA----------FT
ILVD_HALMA       GPIAALEDGDTITIDIDDHELSV-DLT----EDEMQQRLEGHD-PEPT----------YD
ILVD_NATPD       GPIGALEDGDHITVDIPDRTIEV-DLS----DSELERRLDERDDPEPA----------YT
ILVD2_BORBR      GPIALLRDGDMIHIDAEADTLDV-ALS----DEELARRRAAYQ-APPQ---------ARL
ILVD3_BRADU      GPLALVRDGDKIRIDATNRRMDM-LVD----EPELAARRRDWK-PRPP---------RHR
ILVD2_BRADU      GPIGLLEDGDIIEIDAVAGTLNV-KLS----DQELAQRKTKWS-ARAT---------NHT
ILVD2_RHILO      GPIGLIRDGDVISIDAVNGTIEV-ALS----DSELAARAKTWK-ARTT---------DYQ
ILVD_PARL1       GPIALIEDGDIITIDAENGTIDL-EVD----EAVLEKRRANWK-PRET---------MYA
ILVD_PELUB       GPLALLRNGDVIDIDAKKGTINV-RLT----KSQLATRHKKWK-AKKS---------SFG
ILVD_DINSH       GPIAMLKDGDMITIDALKGELSV-ALS----EDELAARKDAWSGPRET---------IYA
ILVD_PYRAR       GPIALVQNGDRVIIDGEAGLIKL-EVS----EEELEKRRKAWA-PPPP---------KYK
ILVD_PYRIL       GPIALVENGDRIAIDGETGRITL-QIP----QEELERRRKNWT-PPPP---------KYS
ILVD_PYRAE       GPIALVQNGDRIVIDGEAGLLKL-ELG----EEELERRRKNWS-PPPP---------KYK
ILVD_PYRCJ       GPIALVENGDRIVIDGEAGLLKL-DVS----DEELERRRRQWT-PPPP---------KYK
ILVD_AERPE       GPIALVENGDEIVIDGEKGTLDV-LLG----GDELARRRDKWS-PPP----------LPK
ILVD_METS5       GPIALIRDGDTIVIDGEKGRLDV-ELS----DQELKSRAKDWT-PPEP---------RYK
ILVD_SULTO       GPIALLRDGDTIIIDANNGRLDV-DLP----QEELKKRADEWT-PPPP---------KYK
ILVD_PICTO       GEIALLKDGDVITIDGENGLLKA-SVS----DEEFNRRRESWR-PPEP---------KYS
ILVD_SULAC       GPIAIVEDGDVIVIDVENERLDI-KLS----DAEIKRRLNNWS-PPEP---------RYK
ILVD_SACS2       GPIAIVEDGDTIVIDVESERLDL-KLS----EEEIKNRLKRWS-PPSP---------RYK
ILVD_MYCA1       GPIAFLRDGDRIRLDVANRVLDV-LVD----PAEFDSRRTAFT-PPPP---------RYK
ILVD_MYCPA       GPIAFLRDGDRIRLDVANRVLDV-LVD----PAEFDSRRTGFT-PPPP---------RYK
ILVD_MYCUA       GPIAFVRDGDRIRLDVAGRTLDV-LTD----PPEFAARQQNFT-PPAP---------RYK
ILVD_MYCBO       GPIALLRNGDRIRLDVAGRVLDV-LAD----PAEFASRQQDFS-PPPP---------RYT
ILVD_MYCTU       GPIALLRNGDRIRLDVAGRVLDV-LAD----PAEFASRQQDFS-PPPP---------RYT
ILVD_MYCLE       GPIAFLRDGDRVLLDVVGCSLDV-LVD----PVEFSSRKKDFI-PPAP---------RYT
ILVD_MYCSJ       GPIAFVRDGDRIRLDVAKGTLDL-LVD----EAEFESRKAGFE-PLPP---------VYT
ILVD1_NOCFA      GPIAFVRDGDRIRLDVAAGTLDL-LVE----PAELERRKQDWR-PLPP---------RYT
ILVD_ACIC1       GPIAFVRDGDRIRLDAQARTLDL-LVD----ADELAKRRADWQ-PPPP---------RYT
ILVD_NOCSJ       GPIAFVRDGDQITLDVANRLLEV-EVVGPDAEAEWERRKVGWE-PNPP---------KYT
ILVD_ARTS2       GPIAFVKDGDRIRVDIAARSFDL-LVD----EAELESRKVGWE-PLPA---------KFT
ILVD_RENSM       GPIAFVQDGDLIRVDIPNKSFDL-LVD----EAELEARKIGWE-PLPA---------RFT
ILVD_CLAM3       GPVAFVRDGDRIRVDIAARTLDL-LVD----EAELAARREGWA-PLPP---------RYT
ILVD_CLAMS       GPVAFVRDGDRIRVDIAARTLDL-LVD----EAELAARREGWA-PLPP---------RYT
ILVD_LEIXX       GPIAFVRDGDLIRVDIAARSLDL-LVD----ESELTARRDGWA-PLPP---------RYT
ILVD_TROW8       GPIAFVQDGDIIRVDIEKSSIDV-LVD------EKQLRARHLT-PPPP---------RYT
ILVD_TROWT       GPIAFVQDGDIIRVDIEKSGIDV-LVD------EKQLRARHLT-PPPP---------RYT
ILVD2_COREF      GPIALVEDGDPILVDISQRRIDL-LVD----ESILEERRKTLQ-HPEN---------PRL
                 * :.    .* : .      .                *                      

ILVD_CALS8       KGYLYRYSKLVRSASTGAILE--------------------
ILVD_HUNT2       KGYLGRYAKLVSSANKGAILENK------------------
ILVD_CALS4       KGYMARYTREVTSGSKGAVFREGGV----------------
ILVD_CLOB8       TGYLARYAALVTSGNRGAILDIPKF----------------
ILVD_CLOK5       TGYLARYASMVTSGNRGAILEIPKF----------------
ILVD_LACP7       TGYLARYTAMVTSGNRGAILEVPRVK---------------
ILVD_CLOAB       KGYLNTYRQGVSSACTGAVFHSTKE----------------
ILVD_CARHZ       EGYLARYQKLVSSANLGAVFLK-------------------
ILVD_MOOTA       GGYLGRYARMVTSGARGAVLE--------------------
ILVD_SYNFM       QGYLARYAHMVTSGSTGAVLRTEQDK---------------
ILVD_SYNAS       TGYLARYARLVTSASTGAIFKD-------------------
ILVD_DESVH       SPLLRRYARMVSSAATGARQR--------------------
ILVD_DESVV       SPLLRRYARMVSSAATGARQR--------------------
ILVD_DESAG       SPLLKRYSRLVTSAANGAVYKR-------------------
ILVD_THEMA       SDYLRRYAFFVQSASKGAIFRKP------------------
ILVD_THEP1       SDYLRRYAFFVQSASKGAIFRKP------------------
ILVD_PYRAB       KGYLKRYSSLVTSANTGAVFRE-------------------
ILVD_PYRFU       TGYLKRYSTLVTSANTGAILRH-------------------
ILVD_CLONN       GTYLKRYSKLVTSASTGAVLE--------------------
ILVD_IGNH4       RGILRRYAKMALSADKGGALEY-------------------
ILVD_GEOMG       TGWLARYAKVVTSAYTGAVTTAE------------------
ILVD_GEOSL       TGWLARYAKVVTSAYTGAVTSAD------------------
ILVD_GEOUR       TGWLARYAKVVTSAYTGAVMSAD------------------
ILVD_PELPD       KGWLARYAKVVTSAHTGAVTTAE------------------
ILVD_PELCD       KGWLSRYASVVTSANTGAVCKAR------------------
ILVD_METMJ       TGMLARYVQTVEQANLGAVQR--------------------
ILVD_METB6       TGVLARYAKTVGQANLGAVLR--------------------
ILVD_METHJ       TGVLARYAAAVGPADLGAVLQ--------------------
ILVD_ARCFU       KGYLAKYAKLVRGAEEGAALL--------------------
ILVD_METTH       KGWLARYRKLAGSADTGAVLR--------------------
ILVD_METST       KGWLKQYQKLATSADKGAILK--------------------
ILVD_METS3       DGWLSIYSKVVQSADTGAILR--------------------
ILVD_METJA       KGYLARYAKLVSSADEGAVLRYD------------------
ILVD_META3       KGYISRYAKLVSSANEGAVLK--------------------
ILVD_METM5       KGYLSRYSRLVSSADEGAVLK--------------------
ILVD_METM7       KGYLSRYSRLVSSADEGAVLK--------------------
ILVD_METMP       KGYLSRYSKLVSSADEGAVLK--------------------
ILVD_METVS       TGYLSRYSRLVSSADEGAVLK--------------------
ILVD1_METAC      TGYLARYQRSVHSANTGGIVD--------------------
ILVD_METMA       TGYLARYQRAVHSANTGGIVD--------------------
ILVD2_METAC      TGYLARYQRAVHSANTGGIVD--------------------
ILVD_METBF       TGYLARYQRSVHSANTGGIVD--------------------
ILVD_METBU       TGYLSRYRKIVSSASKGAIRE--------------------
ILVD_METTP       GGVLDRYRKSVTSASKGGVLR--------------------
ILVD_METKA       TGYLRRYRELVRGADEGAVLR--------------------
ILVD_DEHMB       SGYLKFYTENVTSASTGAVFKD-------------------
ILVD_DEHMC       SGYLKFYTENVTSASTGAVFKD-------------------
ILVD_DEHM1       SGYLKYYTENVTSASTGAVFKD-------------------
ILVD_ANADE       SSWLRRYAHLVTNAANGAVLRSTDL----------------
ILVD_ANADF       SSWLKRYALLVSNASAGAVMKTEL-----------------
ILVD_ARCB4       SSWLGQYRALVTNASSGAVLKTDL-----------------
ILVD_SULNB       SKWLRQYRALVTNASNGAVLEAE------------------
ILVD_NITSB       GRWLRQYRSLVTNAANGAVLKDEC-----------------
ILVD_SULDN       SKWLKRYQLLVSNASNGAVLKTEL-----------------
ILVD_HELHP       SKWLKRYSLLVSNAANGAVLKTEI-----------------
ILVD_WOLSU       SKWLKRYQLLVSNAASGAILKTEL-----------------
ILVD_CAMFF       SRWLRQYQKLVTNASNGAILEA-------------------
ILVD_CAMHC       SRWLRQYQKLVTNASNGAILEA-------------------
ILVD_CAMC5       GKWLRQYQRLVTNASNGAILEA-------------------
ILVD_CAMJE       SRWLRMYQKLVSNASKGAVLDME------------------
ILVD_CAMJR       SRWLRMYQKLVSNASKGAVLDME------------------
ILVD_CAMJD       SRWLRMYQKLVSNASKGAVLDME------------------
ILVD_CAMJJ       SRWLRMYQKLVSNASKGAVLDME------------------
ILVD_CAMJ8       SRWLRMYQKLVSNASKGAVLDME------------------
ILVD_AQUAE       SSWLRRYAKLVTSASKGAILEA-------------------
ILVD_BACVZ       TGYLARYSKLVTSANTGGIMKI-------------------
ILVD_BACSU       TGYLARYSKLVTSANTGGIMKI-------------------
ILVD_BACP2       TGYLARYSKLVTSANTGGIMKI-------------------
ILVD_BACLD       TGYLARYSKLVTSANTGGIMKI-------------------
ILVD_GEOKA       TGYLARYSKHVTSASTGGIMRI-------------------
ILVD_BACAH       TGWLGRYAQMVTSANTGAVLKIPNFD---------------
ILVD_BACHK       TGWLGRYAQMVTSANTGAVLKIPNFD---------------
ILVD_BACAN       TGWLGRYAQMVTSANTGAVLKIPNFD---------------
ILVD_BACC1       TGWLGRYAQMVTSANTGAVLKVPNFD---------------
ILVD_BACCZ       TGWLGRYAQMVTSANTGAVLKVPNFD---------------
ILVD_BACCR       TGWLGRYAQMVTSANTGAVLKIPHFD---------------
ILVD_BACCN       TGWLGRYAQMVTSANTGAVLKMQNFD---------------
ILVD_BACSK       KGYLARYSKLVTSANTGGVMKI-------------------
ILVD_BACHD       KGYLARYSKLVTSANTGGVMKI-------------------
ILVD_LISMO       TGYLARYTALVTSAHTGGILQIPEDLID-------------
ILVD_LISMF       TGYLARYTALVTSAHTGGILQIPEDLID-------------
ILVD_LISW6       TGYLARYTALVTSAHTGGILQIPEDLID-------------
ILVD_LISIN       TGYLARYTALVTSAHTGGILQIPEDLID-------------
ILVD_STAAC       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAE       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAA2       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAA9       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAS       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAA1       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAM       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAW       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAN       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAA8       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAT       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAA3       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAB       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAAR       TGYLARYTALVTSANTGGVMQVPENLI--------------
ILVD_STAES       TGYLARYTSLVTSANTGGIMQVPENLI--------------
ILVD_STAEQ       TGYLARYTSLVTSANTGGIMQVPENLI--------------
ILVD_STAHJ       SGYLARYTALVTSANTGGIMQVPENLI--------------
ILVD1_STAS1      TGYLARYTALVTSANTGGIMQVPENLI--------------
ILVD_LEUMM       NGWMARYQALVTSANTGGVLKGADELFPS------------
ILVD_SYMTH       KGWLGRYAALVTSANTGAVLRTPEE----------------
ILVD_CHLCH       RGYLARYAQLVTSANTGAILGHL------------------
ILVD_CHLPD       KGYLARYAQLVTSACTGAILKTSPYCEPK------------
ILVD_PELLD       KGYLARYAEMVTSANTGAILKTPVSCEPK------------
ILVD_CHLPM       KGYLARYSQMVTSASTGAILKTPVSCEPK------------
ILVD_CHLTE       KGYLARYARMVTSANTGAVLKNDF-----------------
ILVD_BIFAA       SQALKAYAAFARSADKGATRDPELIDKLSGLA---------
ILVD_BIFLO       SQALKAYAAFARSADKGATRDPELINKLSGLD---------
ILVD_CORGL       TKALRAYAKMATSADKGAVRQVD------------------
ILVD_CORGB       TKALRAYAKMATSADKGAVRQVD------------------
ILVD1_COREF      SKALRAYAKMATSADKGAVRQID------------------
ILVD_CORDI       SKALRAYASMATSADKGAVRQLD------------------
ILVD_CORJK       TKALRAYAAMATSADRGAVREVK------------------
ILVD3_NOCFA      TTALRAYAALATSADKGAVRRVP------------------
ILVD_FRACC       SMALRAYAAMATSASTGAARDVGLLGG--------------
ILVD_SALAI       SAALRAYASMATSASDGAYRRVPE-----------------
ILVD_STRAW       SAALRAYAAMATSADKGAVRDVS--KLG-------------
ILVD_STRCO       SAALKAYAAMATSADKGAVRDVS--KLG-------------
ILVD2_NOCFA      STALRAYALLAQSADKGGVRRLPPDELGGPEAAFDTQTRAG
ILVD_THEFY       SAALRAYAAMATSASTGAARDVSQVERTHLHS---------
ILVD_BACFR       TKSLKAYASMVSSADKGAVRLID------------------
ILVD_BACFN       PKSLKAYASMVSSADKGAVRLID------------------
ILVD_BACTN       PKSLKAYASMVSSADKGAVRLID------------------
ILVD_PARD8       SKALRAYGKMVSSADKGGVRIVED-----------------
ILVD_BLOFL       SFSLKAYAKLVTSADTGAVRDRSQL----------------
ILVD_BLOPB       SISLKAYAHLVTSADKGAVRDKSKLLG--------------
ILVD_BUCAI       SSALKAYAFFSTSADQGAVRDYKKISNI-------------
ILVD_BUCDN       SYALKTYAFFAMSADKGAVRDRQKLSKI-------------
ILVD_BUCAP       SFALRAYAHFALSADKGAIRNKKKLFNF-------------
ILVD_BUCMH       SPALKMYAFFAMSADKGAVRKIRF-----------------
ILVD_BUCSC       SSALKMYALFATSADKGAVRKIQY-----------------
ILVD_BUCBP       TSALKLYSKFVTSADKGAVRNIR------------------
ILVD_BUCCC       SDSLKIYSMFATSADKGAVRNIHKINF--------------
ILVD_ACTP2       SMALKMFGHFATSADKGAVRDKTKL----------------
ILVD_MANSM       SFALKVFGHFATSADKGAVRDKTKL----------------
ILVD_HAES1       SFALKVYGYFATSADKGAVRDKTKI----------------
ILVD_HISS2       SFALKVYGYFATSADKGAVRDKTKI----------------
ILVD_PASMU       SFALKVYGHFATSADKGAVRDKTKI----------------
ILVD_HAEI8       SFALKVFGHFATSADKGAVRDKTLLK---------------
ILVD_HAEIG       SFALKVFGHFATSADKGAVRDKTLLK---------------
ILVD_HAEIN       SFALKVFGHFATSADKGAVRDKTLLK---------------
ILVD_HAEIE       SFALKVFGHFATSADKGAVRDKTLLK---------------
ILVD_ACTSZ       STALKIFGHFATSADKGAVRDKTKL----------------
ILVD_AERHH       SFALRAYAMFATSADKGAVRDRSMLGE--------------
ILVD_AERS4       SFALRAYAMLATSADKGAVRDRSKLEE--------------
ILVD_VIBCH       SLALKAYASMATSADKGAVRDKSKLEG--------------
ILVD_VIBC3       SLALKAYASMATSADKGAVRDKSKLEG--------------
ILVD_VIBVU       SFALKAYASMATSADKGAVRDKSKLEG--------------
ILVD_VIBVY       SFALKAYASMATSADKGAVRDKSKLEG--------------
ILVD_VIBPA       SFALKAYASMATSADKGAVRDKSKLEG--------------
ILVD_ALIF1       SFALKAYASMATSADKGAVRDKSKLEG--------------
ILVD_PHOPR       SYALRAYALLATSADQGAIRDKSKLEG--------------
ILVD_ECOLC       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECOHS       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECO24       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SHIF8       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SHISS       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SHIFL       SFALCAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECOLI       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SHIBS       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECO57       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SHIDS       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECOUT       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECOK1       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECOL5       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ECOL6       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SALPB       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SALTY       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SALCH       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SALPA       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_SALTI       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_KLEP7       SFALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_ENT38       SYALRAYATLATSADKGAVRDKSKLGG--------------
ILVD_YERPE       SYALRAYAMLATSADKGAVRDKSKLGG--------------
ILVD_YERPA       SYALRAYAMLATSADKGAVRDKSKLGG--------------
ILVD_YERPN       SYALRAYAMLATSADKGAVRDKSKLGG--------------
ILVD_YERPP       SYALRAYAMLATSADKGAVRDKSKLGG--------------
ILVD_YERP3       SYALRAYAMLATSADKGAVRDKSKLGG--------------
ILVD_YERPS       SYALRAYAMLATSADKGAVRDKSKLGG--------------
ILVD_YERE8       SYALRAYALLATSADKGAVRDKSKLGG--------------
ILVD_PECAS       SFALRAYAILATSADKGAVRDKSKLGG--------------
ILVD_SODGM       SFALKAYASLATSADKGAVRDKAKLGG--------------
ILVD_PHOLL       SLALRAYASLATSADKGAVRDKSKLGG--------------
ILVD_COLP3       SYALKNYAMLATSADKGAVRNRDLLDGLVDK----------
ILVD_PSYIN       STALKVYALMATSADKGAIRDISKLK---------------
ILVD_SHEB5       SLALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHEB9       SLALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHEB8       SLALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHEPC       SLALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHESW       SLALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHESM       SMALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHESR       SMALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHESA       SMALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHEON       SMALKAYAMLATSADKGAVRDRSKLED--------------
ILVD_SHEDO       SLALKAYALLATSADMGAVRDRTLLEG--------------
ILVD_SHEFN       SLALKAYALLATSADKGAVRDRTKLEG--------------
ILVD_SHELP       SLALKAYAMLATSADKGAVRDVSKLED--------------
ILVD_SHEAM       SMALKAYAMLATSADKGAVRDVSKLEG--------------
ILVD_SHEHH       SMALKAYALLATSADKGAVRDTSKLV---------------
ILVD_SHEPA       SMALKAYALLATSADKGAVRDTSKLV---------------
ILVD_SHESH       SLALKAYALLATSADKGAVRDTSKLED--------------
ILVD_PSEA6       SLALKAYALLATSADKGAVRDASKLED--------------
ILVD1_PSEHT      SSALKAYALLATSADKGAVRDLAKLEELS------------
ILVD1_BURL3      SAALKAYAKLVMSADKGAVRDLSLLDD--------------
ILVD_BURVG       SAALKAYAKLVMSADKGAVRDLSLLDD--------------
ILVD2_CUPPJ      SAALKAYAKLVMSADKGAVRDLSLLDD--------------
ILVD_ACIAC       SAALKAYAKLVMSADKGAVRDLSLLDD--------------
ILVD_MARMS       SPALKVYAHFATSADKGAVRDISQID---------------
ILVD_SACD2       SSALKAYALLATSADKGAVRDLKKLESLQ------------
ILVD_PSEAE       STALKAYALLATSADKGAVRNKALLDG--------------
ILVD_PSEAB       STALKAYALLATSADKGAVRNKALLDG--------------
ILVD_PSEA7       STALKAYALLATSADKGAVRNKALLDG--------------
ILVD_PSEMY       STALKAYALLATSADKGAVRDKAMLDG--------------
ILVD_PSEU5       STALKAYALLATSADKGAVRDKAMLDG--------------
ILVD_PSEP1       TTALKAYALLATSADKGAVRNKAMLEGL-------------
ILVD_PSEPK       TTALKAYALLATSADKGAVRNKAMLEGL-------------
ILVD_PSEPG       TTALKAYALLATSADKGAVRNKAMLEGL-------------
ILVD_PSEE4       TTALKAYALLATSADKGAVRNKAMLDGL-------------
ILVD_PSEPF       TTALKAYALLATSADKGAVRNKAMLDGL-------------
ILVD_PSEF5       TTALKAYALLATSADKGAVRNKAMLDGL-------------
ILVD_PSE14       TTALKAYALLATSADKGAVRDKALLDKLVP-----------
ILVD_PSEU2       TTALKAYALLATSADKGAVRDKALLDKLVP-----------
ILVD_PSESM       TTALKAYALLATSADKGAVRDKALLDKLVP-----------
ILVD_XANAC       TTALKAYALLATSADKGAVRDKALLDG--------------
ILVD_XANC5       TTALKAYALLATSADKGAVRDKALLDG--------------
ILVD_XANOR       TTALKAYALLATSADKGAVRDKALLDG--------------
ILVD_XANOM       TTALKAYALLATSADKGAVRDKALLDG--------------
ILVD_XANCP       TTALKAYALLATSADKGAVRDKAMLDG--------------
ILVD_XANC8       TTALKAYALLATSADKGAVRDKAMLDG--------------
ILVD_XYLFA       SSALKAYALLATSADKGAVRNKTLL----------------
ILVD_XYLFT       SSALKAYALLATSADKGAVRNKTLL----------------
ILVD_HAHCH       TTALKAYALLATSADKGAVRDKELLK---------------
ILVD_RHORT       SPALRAYAALTTSADRGAVRDVSQVER--------------
ILVD_HYDCU       SAALRAYAAMTTSAAFGAVRNVEQIEH--------------
ILVD_CAUVC       TPALRAYAAMTTNAARGAVRDVSQIERG-------------
ILVD_GRABC       SPALRAYAAMTTNAARGAVRDVSQVERKR------------
ILVD_ZYMMO       SSALKAYAALTTNAARGAVRDVNQLERR-------------
ILVD_GLUOX       SKALQAYAAMTTSAAHGAVRDLSQIIVKTRI----------
ILVD_AZOSB       SAALQAYAALTTSADTGAVRDITQVQR--------------
ILVD2_AROAE      SAALQAYAALTTSADTGGVRDVTQVQR--------------
ILVD_DECAR       SPALQAYALMATSADKGAVRDVKQIQRRK------------
ILVD1_BORBR      SQALRAYAALATSADRGAVRDLSQLKR--------------
ILVD1_BORPA      SQALRAYAALATSADRGAVRDLSQLKR--------------
ILVD1_BORPE      SQALRAYAALATSADRGAVRDLSQLKR--------------
ILVD_BORA1       SLALQAYAALATSADRGAVRDLSQIKR--------------
ILVD_NEIMA       SAALRAYGAMATSADKGAVRDVAQIER--------------
ILVD_NEIMF       SAALRAYGAMATSADKGAVRDVAQIER--------------
ILVD_NEIMB       SAALRAYGAMATSADKGAVRDVAQIER--------------
ILVD_NEIG1       SAALRAYGAMATSADKGAVRDVSQIER--------------
ILVD_PSYA2       SPALRAYAAMTTSADTGAVRDVSQVER--------------
ILVD_CHRVO       SPALRAYAAMTTSADTGAVRDVSQVERK-------------
ILVD_METFK       SVALRAYAAMSTSAAKGAVRDVSQIEK--------------
ILVD_SYNP6       SQALQAYAAMTTSAARGGVRDLSQILGSR------------
ILVD_SYNE7       SQALQAYAAMTTSAARGGVRDLSQILGSR------------
ILVD_NITOC       SLALQAYAALTTSAAKGAVRDLGQLNRS-------------
ILVD_NOVAD       STALRAYAAMTTSAARGAVRDLSQLKID-------------
ILVD_SPHAL       SVALQAYAAMTTSAARGAVRDLSQLKGKG------------
ILVD1_ACIAD      SKALKVYAMHTTSAAKGAVRIL-------------------
ILVD_DEIRA       TAALRAYASMTTSASRGAVRNI-------------------
ILVD_RHIEC       TTALKAYAAFATSADRGAVRDLDAR----------------
ILVD_RHIL3       TTALKAYAAFATSADRGAVRDLNVR----------------
ILVD_RHIME       TTALKAYAAFATSADRGAVRDLGDR----------------
ILVD_SINMW       TTALKAYAAFATSADRGAVRDLGDR----------------
ILVD_AGRFC       TTALKAYAAFASSADKGAVRILPE-----------------
ILVD1_RHILO      TTALRAYAAFATSADKGAVRHVPE-----------------
ILVD_BRUAB       STALKAYAAMATSAARGAVRKLPD-----------------
ILVD_BRUA2       STALKAYAAMATSAARGAVRKLPD-----------------
ILVD_BRUO2       STALKAYAAMATSAARGAVRKLPD-----------------
ILVD_BRUC2       STALKAYAAMATSAARGAVRKLPD-----------------
ILVD_BRUSU       STALKAYAAMATSAARGAVRKLPD-----------------
ILVD_BRUME       STALKAYAAMATSAARGAVRKLPD-----------------
ILVD_BRUSI       STALKAYAAMATSAARGAVRKLPD-----------------
ILVD_OCHA4       STALKAYASMATSAAKGAVRKLPD-----------------
ILVD_RHOP5       SSALKAYALFASSAAKGAVRVLKD-----------------
ILVD_NITHX       TMALKAYAAHATSAALGAVRVVKD-----------------
ILVD_NITWN       TMALKAYAAHTTSAALGAVRVVKD-----------------
ILVD_AZOC5       SQALQAYAALTTSAARGAVRDVKSLRR--------------
ILVD_RHOPA       SAALQAYAMLTTSAANGAVRDVKRRFGKN------------
ILVD_RHOP2       SAALQAYAMLTTSAANGAVRDVNRRLGKGK-----------
ILVD1_BRADU      STALQAYAALTTSAARGAVREVKRRSN--------------
ILVD_BARHE       SKALKAYAAMTTSAAKGAVRNI-------------------
ILVD_BART1       SKALKAYAAMTTSAAKGAVRNI-------------------
ILVD_RHOS4       SQALKVYAQFASSADKGAVRVLPE-----------------
ILVD_RHOS1       SQALKVYAQFASSADKGAVRVLPE-----------------
ILVD_PARDP       SAALKVYAQFAASADKGAVRILPE-----------------
ILVD_RUEPO       STALKAYAKLTTSAAKGAVRQV-------------------
ILVD_RUEST       STALKAYALLATSAAKGAVRQLPDDE---------------
ILVD_HYPNA       SRALKVYAAHVGNASLGAVRLDP------------------
ILVD_MAGSA       SAALRAYAAMTTSAARGAVRDVSQLER--------------
ILVD_ACICJ       SAALQAYAALTTSAANGAVRDVTQVQRGR------------
ILVD_MAGMM       SKALQAYAALTTSAAEGAVRNLEQIHIKRD-----------
ILVD_NOSS1       TGILAKYAKLVASSSVGAVTDLDLFNK--------------
ILVD_TRIEI       RGVLAKYAKLVSSSSVGAVTDAGLG----------------
ILVD_ACAM1       KGVLAKYAKLVSSSSVGAVTDLDLF----------------
ILVD_MICAN       TGILGKFAKLVSSSSLGALTDLNLF----------------
ILVD_SYNY3       RGILAKYAKLVSSSSLGAVTDIDLF----------------
ILVD_THEEB       RGVLAKYAKLVSSSSLGAVTDRFV-----------------
ILVD_SYNJB       RGTLAKYAKLVSSSSLGAVTDLNLWD---------------
ILVD_SYNJA       RGVLAKYAKLVSSSSLGAVTDLNLWD---------------
ILVD_GLOVI       RGVLAKYARQVNSSSLGAVTDAFI-----------------
ILVD_NITEU       RGVLAKYAKLVSTASRGAVTD--------------------
ILVD_NITEC       RGVLAKYAKLVSTASRGAVTD--------------------
ILVD_NITMU       RGVLAKYSKLVSSASRGAITD--------------------
ILVD_CHLAA       RGVLAKYARLVSSASLGAVTDRFSE----------------
ILVD_DEIGD       RGVLAKYARLVGSAARGAVTD--------------------
ILVD_HALHL       RGVLGKYARLAASASRGAVTDADLFPEQE------------
ILVD_PROMS       RGILSKYSRIVSTSSLGAVTDL-------------------
ILVD_PROM9       RGILSKYSRIVSTSSLGAVTDL-------------------
ILVD_PROM0       RGILSKYSRIVSTSSLGAVTDL-------------------
ILVD_PROM2       RGILSKYSKIVSTSSLGAVTDL-------------------
ILVD_PROM5       KGVLSKYSRIVSTSSLGAVTDLEK-----------------
ILVD_PROMP       KGVLSKYSRIVSTSSLGAVTDLEE-----------------
ILVD_PROMA       SGVLGKYATLVSSSSKGAVTDQNC-----------------
ILVD_PROM3       TGVLGKYARMVSSSSKGAVTDQP------------------
ILVD_PROMM       TGVLGKYARMVSSASNGAVTDQP------------------
ILVD_SYNSC       SGILGKYARLVSSSSRGATTDHAD-----------------
ILVD_SYNPX       TGILGKYARLVSSSSRGAVTDQPD-----------------
ILVD_SYNS9       TGILGKYARLVSTSSKGAVTDQPD-----------------
ILVD_SYNR3       TGVLGKYARLVSSSSKGAVTDQP------------------
ILVD_PROMT       TGILGKYSRLVSSSSQGATTDQI------------------
ILVD1_AROAE      RGVLAKFAKFASSASKGAVTDLDL-----------------
ILVD3_AROAE      RGVLAKFAKLTSSASKGAVTDLDL-----------------
ILVD3_BORBR      RGVLAKFGKLACTASRGAVTDAFEE----------------
ILVD2_BORPA      RGVLAKFGKLACTASRGAVTDAFEE----------------
ILVD2_BORPE      RGVLAKFGKLACTASRGAVTDAFEE----------------
ILVD_BURMA       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURM9       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURM7       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURMS       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURPS       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURP6       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURP1       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURP0       RGVLAKYAALARPANQGAVTG--------------------
ILVD_BURTA       RGVLAKYAALARPANKGAVTG--------------------
ILVD2_BURL3      RGVLAKFAALARPANQGAVTG--------------------
ILVD1_CUPPJ      RGVLAKFARLASTASKGAVTD--------------------
ILVD_RALSO       RGVLAKFAQLTSTASKGAVTD--------------------
ILVD_HERAR       RGVLAKYAALASTASKGAVTG--------------------
ILVD_JANMA       RGVLSKFAALASSASKGAVTG--------------------
ILVD_POLNA       RGVQAKFAFNASSASKGAVLDDY------------------
ILVD_POLSJ       RGVQAKFAFNASSASKGAVLDDY------------------
ILVD_RHOFT       RGVQAKFAFNASTASKGAVLDNY------------------
ILVD_VEREI       RGVQAKFAFNASSASQGAVLDAY------------------
ILVD_METPP       RGVLAKFAKNASSASSGAVLDRFE-----------------
ILVD_TREPR       EGLLRKYHDGVGQSHNGAIAA--------------------
ILVD_CHRSD       RGTLAKYAKTVSSASKGAVTDLPEALDD-------------
ILVD2_PSEHT      RGLLAKYARTVSSASTGAVTDKPS-----------------
ILVD2_ACIAD      SGALAKFAKLAAGADKGAVTDLNLDV---------------
ILVD_METCA       KGVLAKYARLVSPASEGAVTDDGL-----------------
ILVD_RUTMC       KGVLAKFAKLAKSASEGAVTD--------------------
ILVD_LACLS       RGVLAKFAKLTRPASEGCVTDL-------------------
ILVD_LACLA       RGVLAKFAKLTRPASEGCVTDL-------------------
ILVD_CYTH3       SGVLYKYMKLVSSASEGCVTDN-------------------
ILVD_FRATN       RGTLKKYIKTVSSASTGCVTDLD------------------
ILVD_FRATT       RGTLKKYIKTVSSA---------------------------
ILVD_FRAP2       RGTLKKYIKTVSSASTGCVTDLD------------------
ILVD_RHOBA       RGTLYKYIKCVKSASEGCVTDE-------------------
ILVD_LEPBJ       SGVLAKYAKLVQSATNGAITNLL------------------
ILVD_LEPBL       SGVLAKYAKLVQSATNGAITNLL------------------
ILVD_LEPIN       TGVLAKYVKLVQSATNGAITNLL------------------
ILVD_LEPIC       TGVLAKYVKLVQSATNGAITNLL------------------
ILVD_STRPN       RGVLGKYAHIVSSASRGAVTDFWNMDKSGKK----------
ILVD_STRR6       RGVLGKYAHIVSSASRGAVTDFWNMDKSGKK----------
ILVD_STRP2       RGVLGKYAHIVSSASRGAVTDFWNMDKSGKK----------
ILVD_STRT2       RGVLGKYAHIVSSASRGAVTDFWNMDKSGKA----------
ILVD_STRT1       RGVLGKYAHIVSSASRGAVTDFWNMDKSGKA----------
ILVD_STRSY       RGVLGKYAHTVSSASKGAVTDFWRPERTGKK----------
ILVD_STRS2       RGVLGKYAHTVSSASKGAVTDFWRPERTGKK----------
ILVD_STRSV       RGVLGKYAHMVSSAAKGAVTDFWKPEETGKK----------
ILVD_STRMU       RGILGKYAHIVSSASRGAVTDFWKPEETGKK----------
ILVD_OCEIH       KGVLGKYAHNVTCSSKGAVTDYLNRE---------------
ILVD2_STAS1      RGTLAKYAKLVSSASKGAITD--------------------
ILVD_ROSCS       WGVMARYSALVSSASEGAVLVTP------------------
ILVD_ROSS1       WGVMARYGALVSSASEGAVLVTP------------------
ILVD_KORVE       RGVFAKYASTVSSASFGAVTGSTIENKTLAGSTK-------
ILVD_THET2       HGLFARYAALVRQADEGAVLEDPL-----------------
ILVD_THET8       HGLFARYAALVRQADEGAVLEDPL-----------------
ILVD_HALMA       SGVLAKYHNDFGSAANGAVTNPGAKWD--------------
ILVD_NATPD       NGVVAKYGSLFGSAANGAVTNPGLHNDQH------------
ILVD2_BORBR      AGALEKYAALVRPACLGAVTHSGQVDWPYETPEAE------
ILVD3_BRADU      AGALAKYARLVGQAPGGAVTHEGPAEWPWFE----------
ILVD2_BRADU      TGALWKYAQQVGPAVGGAVTHPGGAHEKQCYADI-------
ILVD2_RHILO      SGAIWKYAQTVGSARDGAVTHPGGAKETHCYADI-------
ILVD_PARL1       SGALWKYAQLVGTARKGAVTHPGGKAEKHVYADI-------
ILVD_PELUB       SGTIWKYAQTVGPAYLGAPTHPGKRKEVKVYADI-------
ILVD_DINSH       SGALWKYAQLVGGARLGAVTHPGAKDEKHIYADL-------
ILVD_PYRAR       GGLLAKYAALVQQADKGAVTSPSAWGT--------------
ILVD_PYRIL       GGLLAKYAALVQQADKGAVTAIPLR----------------
ILVD_PYRAE       GGLLAKYASLVQQADKGAVTSPPVL----------------
ILVD_PYRCJ       GGLLAKYAALVSQADQGAVTTPETCQC--------------
ILVD_AERPE       QGLLRKYAKLVTQADEGAVTH--------------------
ILVD_METS5       TGLLAQYAKLVTSSARGAVLV--------------------
ILVD_SULTO       SGLLAQYARLVSSSSLGAVLLT-------------------
ILVD_PICTO       TGYLSQYAKLVGSASRGAVLE--------------------
ILVD_SULAC       SGLLAKYASLVAQSSMGAVTRPVIK----------------
ILVD_SACS2       SGLLAKYASLVSQASMGAVTRPA------------------
ILVD_MYCA1       TGVLAKYVKLVGSAAIGAVCG--------------------
ILVD_MYCPA       TGVLAKYVKLVGSAAIGAVCG--------------------
ILVD_MYCUA       TGVLAKYVKLVGSAAIGAVCG--------------------
ILVD_MYCBO       TGVLSKYVKLVSSAAVGAVCG--------------------
ILVD_MYCTU       TGVLSKYVKLVSSAAVGAVCG--------------------
ILVD_MYCLE       TGVLAKYVKLVSSATVGAVCG--------------------
ILVD_MYCSJ       TGVLAKYTKLVGSAAVGAVCG--------------------
ILVD1_NOCFA      RGVLAKYTKLVGSASVGAVCD--------------------
ILVD_ACIC1       TGVAAKYVKLVGSASEGAICR--------------------
ILVD_NOCSJ       RGVLGKYAKIVQSAAHGAITG--------------------
ILVD_ARTS2       KGVLAKYAKLVHSASTGAYCG--------------------
ILVD_RENSM       KGVLAKYAKLVHSASEGAYCG--------------------
ILVD_CLAM3       RGVLAKYAKLVHSAAEGAITG--------------------
ILVD_CLAMS       RGVLAKYAKLVHSAAEGAITG--------------------
ILVD_LEIXX       RGVLAKYSKLVRSAAEGAVTG--------------------
ILVD_TROW8       SGVLSKYSKLVKSASLGAIT---------------------
ILVD_TROWT       SGVLSKYSKLVKSASLGAIT---------------------
ILVD2_COREF      HGVLGKYAKLVQSASMGAVCF--------------------
                       :      .