CLUSTAL format seed alignment for MF_00013

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LIPB_LEPIC       -----------------------------MKIIEFRK---KIPYLRYLEMQEKL----RK
LIPB_LEPIN       -----------------------------MKIIEFRK---KIPYLRYLEMQEKL----RK
LIPB_BDEBA       -----------------------------MADLIFQDWG-LINYDEALKKQNDL----VE
LIPB_PYRAE       -----------------------------MKILWI---G-RTQYAEAWRLMKSL----HC
LIPB1_PICTO      --------------------------MMTSKINYYIDLK-RFDYKKCLDIQYRL----VS
LIPB2_PICTO      ----MKAGHKTIDKSYMHVSLIFYSIIIFMNMPDFIIFETPMEYKPVLYFQRKL----VD
LIPB_PSYA2       ----------------MPNTMQALNTQPLNDTLITKSIT-AADYVPTLDAMLSR----TL
LIPB_PSYCK       ----------------MPNTMQALHTRPLNENLITKSLT-AADYVATLDAMLSR----TL
LIPB_BORPE       ------------------------------MIKWLARPA---DYASVWDAMKTF----TA
LIPB_RALSO       -----------------------------MIPIDIVERG-QQDYTACFDAMQTF----TA
LIPB_COXBU       -----------------------------MNDVIIRQLAHLIPYQPLWEAMQTF----TA
LIPB_XYLFT       --------------MDAVNACGAVAPWHVGRAALLRMLG-AQPYVPVWHAMQRF----TD
LIPB_NITEU       -----------------------------MFTVTVKNMG-TTEYLTAWQAMKNF----TA
LIPB_CHRVO       ------------------------------MPRIIKHLG-RVDYEPTWRAMQAF----TD
LIPB_NEIMB       --------------------------------MKIIHKG-LVEYLPTFEAMKTF----NA
LIPB_PSESM       ----------------------------MANALGFRDLG-LIDYETAWHAMQRF----TD
LIPB_SHEON       ---------------------------MQNTTLHIRHLG-QQDYESVWHAMQHY----TD
LIPB_HAEDU       -----------------------------MNHLIIRQLG-IQPYERIWHQMQDF----TD
LIPB_PASMU       --------------------------MSNLSPLLVRQLG-IQDYQTVWQQMQTF----TD
LIPB_VIBVY       ----------------------------MQNQLVVKRLG-RRDYLPVWQAMHEF----TD
LIPB_ECOLI       ---------------------------MYQDKILVRQLG-LQPYEPISQAMHEF----TD
LIPB_YERPE       -----------------------MMPRLQQHKIILRQLG-LQPYAPVSQAMHNF----TE
LIPB_WIGBR       -----------------------------MNKVNFRILG-LQKYQDIYYIMQKF----IT
LIPB_BUCBP       ---------------------------MYKKNIKIRNLG-LRRIQDVCSSMNDF----TI
LIPB_BUCAI       ---------------------------MKKKIIFLRNLG-IEHWLTTFNKMNNF----II
LIPB_BUCAP       ---------------------------MNNRIILFQNFG-LKHWIDMFNKMHAF----TE
LIPB_FRACC       -----------------------------------------------MARMRVM----VR
LIPB_DESVH       --------------------------------MLTIDLG-SLSYAEAEAVQTAR----LG
LIPB_DESAG       --------------------------------MQIIDLG-CIPYAEAVEIQTGR----VQ
LIPB_BACTN       ------------------------------MKTVLVDWN-LIPYAEAWQRQTEWFDTLVR
LIPB_CALS4       -----------------------------MRRGEVLKLG-VVPYLEGKEIQLKA----FE
LIPB_RICPR       ------------------------------MIRFITLQN-LMDYQVTLKLMEDY----VN
LIPB_NEOSM       -------------------------------MEWKIDKD-CVDYQMSLMFMQER----VK
LIPB_EHRRG       -------------------------------MEWKIESL-PVPYDKAMCFMQQR----VE
LIPB_EHRRW       -------------------------------MEWKIESL-PVPYDKAMCFMQQR----VE
LIPB_RHIME       MYRPEKISIRKVPMQREDLIQSMFAPPDAPPVRWRIAPS-LVDYPEAVETMERE----AA
LIPB_CAUVC       -----------------------MRRDDAAPVGWAVSTQ-PVPYPAAVAAMEAR----AA
LIPB_RHILO       ------------MTQRSQIATSFLPLPGSAPVEWRIEPG-LTAYPDALAFMEAR----AE
LIPB_BRADU       ---MVNSPQNPRQDQRQDLDLTSFSATGGEPVEWRISDA-PVPYPEAVAAMEAR----VA
LIPB_PROMP       ---------------------------MINRTSIIKQPDKISFFYDVYKLQKEY----QD
LIPB_PROMA       -----------------MHNLVINDLPEEGLPTALFEPSELIDFKIAWDWQRKW----QE
LIPB_PROMM       -------------MPIDIGKLGTTSTSAQSQSTFLFECSEPVPFEMAWLWQQQW----QQ
LIPB_SYNPX       -------------MPVDIGKLVTPVDSAHPGSAILVEPADAVPFERSWADQRHW----QQ
LIPB_THEEB       ---------------------------MKNALGWHCALG-IIPYRDAWRWQQQL----VA
LIPB_GLOVI       -----------------------------MGRCLLIEPG-LVPYLTAWEWQRQL----MA
LIPB_NOSS1       ---------------------MIRSNKPPENNCLLYNKG-LMPYLAAHAWQRSL----LR
LIPB_SYNY3       ---------------------------MANPSCRLLSFG-LVPYCQAWQYQRRW----VR
LIPB_GEOSL       ---------------------------------MKIVDLAAMEYAEAFALQERL----AA
LIPB_TROWT       ------------MHSNLPGYWLVYSIRVLAIECIRLAPE-YLPFEEGWRMQQELHKKITE
LIPB_CORGL       -----------MTAPRDPFFPADLSIRASAEPIEIQRLG-LIDYQEAWDYQAEL----AT
LIPB_MYCTU       ---------------------MTGSIRSKLSAIDVRQLG-TVDYRTAWQLQREL----AD
                                                                             

LIPB_LEPIC       FR-----------KE-CILFLEHAPTITGGINYNPENLLVKPEFLESMGIQIHWTQRGGD
LIPB_LEPIN       FR-----------KE-CILFLEHAPTITGGINYNPENLLVKPEFLESMGIQIHWTQRGGD
LIPB_BDEBA       KV------HTEDLPGFLVF-CTHPPVVTVGRATQAGDVFSW-------NGPVVEVTRGGR
LIPB_PYRAE       AV------AQGLTGD-IALVTEHEPVVTVGKHGRLNNVIKW-------DVPVYLVERGGD
LIPB1_PICTO      MR------KNDLIGN-TIIFVEHDPVYTIGRKADPRNYS---------NVNVIRTDRGGD
LIPB2_PICTO      LR------NNDKIDD-TFIFLEHNDVYTAGVHYRGND-------------DIIRVERGGY
LIPB_PSYA2       ARIALKKEQGLRTPD-ELWIVDHNDVYTLGQAGKEEHIL--QRT----NTPIIKTDRGGQ
LIPB_PSYCK       ERISLKKEQGLRTPD-ELWIVDHNDVYTLGQAGKEEHIL--QRT----NTPIIKTDRGGQ
LIPB_BORPE       AR-------GPGTAD-EIWLCEHAPVYTLGQVGRPEHLL--NPG----LIPVVHCDRGGQ
LIPB_RALSO       QR-------GPDTPD-TIWLVEHPPVFTLGLAGDPAHLL--APG----NIPLVKVDRGGQ
LIPB_COXBU       RR-------QSQTTD-EIWFLEHEPVFTQGLAGKPEHVL--NSG----NIPLIRTDRGGQ
LIPB_XYLFT       VR-------DATAVD-ELWVVEHEPVFTLGQAGKLEHVL--APG----EIPVVHVDRGGQ
LIPB_NITEU       QR-------TCETPD-EIWLLEHPPVYTQGIAGKPEHLL--FPN----QIPVIKTDRGGQ
LIPB_CHRVO       SR-------GAETRD-ELWVVEHPPVFTQGLAGKPEHLL--QQN----DVPVVKTDRGGQ
LIPB_NEIMB       GR-------NADTED-ELWVVEHPPVFTQGLAGKPEHLL--IRD----DIPVVQIDRGGQ
LIPB_PSESM       GR-------GREAGD-EVWLVQHPPVFTQGQSGKAEHLL--LPG----NIPVVQVDRGGQ
LIPB_SHEON       TR-------NNDSPD-ELWIVEHPPVFTQGQAGKSEHIL--NPG----DIPVIQVDRGGQ
LIPB_HAEDU       QR-------DEHSAD-EIWLVQHPAVFTQGSAGKSEHLL--TSS----HIPVVQTDRGGQ
LIPB_PASMU       SR-------DVDTQD-EIWLVQHPAVFTQGQAGKAEHLL--QQT----TIPVVQSDRGGQ
LIPB_VIBVY       TR-------NEETPD-EVWLVEHNPVFTQGQAGKAEHLL--NTG----DIPVVQSDRGGQ
LIPB_ECOLI       TR-------DDSTLD-EIWLVEHYPVFTQGQAGKAEHIL--MPG----DIPVIQSDRGGQ
LIPB_YERPE       FR-------TDTTPD-EIWLVEHQHVFTQGQAGKAEHVL--MPG----DIPVIQSDRGGQ
LIPB_WIGBR       CL-------KKNNIN-EIWLLEHYPVFTQGNSDNFNKKY--IFN-----IPVVKTDRGGH
LIPB_BUCBP       TR-------KISTPD-EIWLVQHYPVFTIGVSGTKHDVL--VSN----NIPIIFSNRGGK
LIPB_BUCAI       SR-------NPCTYD-EIWFVEHYPIFTQGQSNEQKNLI--VSN----DIPVVQTNRGGQ
LIPB_BUCAP       VR-------NINTYD-EIWFLEHYPIFTQGLLQKINTIT--YNNDILHDIPIVSTDRGGQ
LIPB_FRACC       ER------IDGVRPD-TLWFLSHPPVYTVGKRTPPEHRP--LAGL---GIPVHETNRGGL
LIPB_DESVH       EV-------STGGED-TLYLVEHPPVITLGRNGGIENLHAGRGFLAERGIELAQSSRGGN
LIPB_DESAG       EV-------AAGAEN-TLYLLEHPKVITFGRNGGRENLHVDDSTLASMGIEVAQTTRGGN
LIPB_BACTN       AK------AQGEAYENRIIMCEHPHVYTLGRSGKENNMLLNDDQLKAIQATLFHIDRGGD
LIPB_CALS4       KV-------KKEETDGILILLQHKPVYTIGVSGGYDEDILVPIDYIKEKAELYKVERGGK
LIPB_RICPR       KV------INDNEPE-IVYLVEHSEVYTAGTNYKQEELL--NYD----DIPVIYTGRGGK
LIPB_NEOSM       QV------INGSGDE-LVWMLQYEALYTGGTSADPQDLL--NSD----LFPVFNVGRGGK
LIPB_EHRRG       GI------ANKTQDE-LVWLLEHFPLYTAGTSARSEELL--TDS----LFPVYSTGRGGK
LIPB_EHRRW       GI------ANKTQDE-LVWLLEHFPLYTAGTSARSEELL--TDS----LFPVYSTGRGGK
LIPB_RHIME       AI------ADGTADE-LVWLVEHPPLYTAGTSANAADLV--MPD----LLPVFATGRGGE
LIPB_CAUVC       AI------ADGTAGE-LIWLLEHPPLYTAGVSAKAGDLI--QPD----RFPVFESGRGGQ
LIPB_RHILO       AI------RSGGAGE-MVWLVEHPPLYTAGTSARIEDLI--EPD----RFPVFSAGRGGE
LIPB_BRADU       AI------AAGEAPE-LVWLLEHPPLYTSGTSGKDSDLL--DP-----RFPTFATGRGGQ
LIPB_PROMP       SL-----ISGKSNMN-FIWLGEHQLCYTVGRGSNMDNLLFSAD-----EQDVFKIDRGGE
LIPB_PROMA       KL-----LAEPSNKQ-AVWMLEHFDCYTLGRGASEDNLLFDVEKP---PIDFYRIDRGGD
LIPB_PROMM       QL-----FANPLAPQ-AVWLLQHQACYTLGRGASEANLLFDVNNP---PAALHRIDRGGE
LIPB_SYNPX       RL-----LEQPHLPE-AVWLLQHKACYTLGRGASSEHLHFPLDQP---PAPVHRIDRGGE
LIPB_THEEB       ER-----RQNLAAPD-VLLTLEHPAIYTLGQGATTAHIHFDPVAT---GIEVLRIERGGD
LIPB_GLOVI       TR-----IAHRDRPD-VLMLLEHPPVYTLGQGADAKHVLVDPA-----SIELYRTERGGE
LIPB_NOSS1       QR-----IDYPNLED-VLILLEHPPVYTLGQGSSLEFLKFDPNQS---EFEIHRIERGGE
LIPB_SYNY3       AK-----QRDRQRED-GLMLLEHPPVYTLGTGSQTKYLKFDPAYP---PAELWRTERGGE
LIPB_GEOSL       DV------AAGRAEE-TLLLLEHPPVYTLGRRGDGGSLP--DP-----SVRPVEINRGGD
LIPB_TROWT       SQ------TNKNRQA-SMIFCEHEPVYTAGARTRSWE----MPQ----NEKVIRVGRGGK
LIPB_CORGL       RR------ANDEIPD-QLLILEHPSVYTAGKRTQPEDL---PTN----GLPVINADRGGR
LIPB_MYCTU       AR-------VAGGAD-TLLLLEHPAVYTAGRRTETHER---PID----GTPVVDTDRGGK
                                       :    * *                          *** 

LIPB_LEPIC       FTAHEPGQLVLYSHVDLK--KRN-----L-SIRFYLENLLRSVIDSVRS---------TW
LIPB_LEPIN       FTAHEPGQLVLYSHVDLK--KRN-----L-SIRFYLENLLRSVIDSVRS---------TW
LIPB_BDEBA       ATYHGPSQLVVYPILNLA--HVRKGRKDR-EINPYLKVFEDAIVDVLKT----------Y
LIPB_PYRAE       ATYHGPGQAVVYPIVALR----------W-PLKRYIDAIEDAVIKTLGT----------Y
LIPB1_PICTO      ITYHGPGQLVSYFIFDVRINGKK-------EVKTFLNNIENVYINLLKN----------L
LIPB2_PICTO      ETYHGPGQLVVYFIINLR--ERK-----M-NALDLIKKIQNSVVNTLKY----------Y
LIPB_PSYA2       VTWHGHGQLVMYWLFDLD--SVG-----W-SVRNMVSHAEQAIEDVVNDCLKSPASTDTI
LIPB_PSYCK       VTWHGHGQLVMYWLFDLD--SIS-----W-SVRNMVSHAEQAIEDVVNDCLKSTASTDTN
LIPB_BORPE       VTYHGPGQVLAYTLFDLR--RAG-----L-YVREYVDMLEQATLATLRE----------L
LIPB_RALSO       ITYHGPGQVVAYLLLDLR--RRG-----L-FVKALVDAIEAAVIDTLAT----------Y
LIPB_COXBU       VTYHGPGQLMMYLLLDLN--RLG-----L-STRTFVRTIENTVAESLQE----------W
LIPB_XYLFT       VTYHGPGQLVVYPLLDLS--RLG-----L-GVRDYVYGIEQAVINTLAQ----------W
LIPB_NITEU       ITYHGPGQIILYLLLDLH--RWR-----L-NIRQLVRKMEGAVIDLLSE----------Y
LIPB_CHRVO       ITYHGPGQLVVYLLVDFK--RMH-----V-GVRELVRRIEQAIIDMLAE----------Q
LIPB_NEIMB       ITYHGPGQLVVYTMIDFK--RRK-----T-SVRNIVSALENSIIATLAE----------Y
LIPB_PSESM       VTYHGPGQLVAYLMLDVR--RLG-----F-GVRDLVTRIENTLIALLAD----------Y
LIPB_SHEON       VTYHGPGQLVVYPLLDIK--RSK-----I-GVRQLVTYIEQSIIDMLAK----------Y
LIPB_HAEDU       ITYHGEGQQIMYVLIDIK--RLKAQGKDI-SVRELVTALEQCVVRTLED----------Y
LIPB_PASMU       ITYHGLGQQVMYVLVDIK--RQKALGNEF-NVRQLVSALEQAVVNTLAD----------Y
LIPB_VIBVY       VTYHGPGQLVAYFLINLR--RKK-----L-GVRDLVTTIENLVINTLKA----------Y
LIPB_ECOLI       VTYHGPGQQVMYVLLNLK--RRK-----L-GVRELVTLLEQTVVNTLAE----------L
LIPB_YERPE       VTYHGPGQQVMYVMVDLK--RAK-----I-GVRQLVTAIENTVIETLAH----------F
LIPB_WIGBR       MTFHGPGQKIIYFLLNIK--NLN-----I-KISKLIFYLENIIISTLSY----------F
LIPB_BUCBP       ITYHAPGQLIIYVLINLF--RRK-----L-TVRRLILLMQNIIISTLKS----------F
LIPB_BUCAI       ITYHGPGQQILYFLIDLK--RRK-----M-NIRQLINIMEQTVIETLNN----------F
LIPB_BUCAP       ITYHGPGQQILYFLIDLK--RRK-----I-TIRDLINIMQNLIIETLNY----------F
LIPB_FRACC       LTYHAPGQLVGYVMCHIG--AMN-------AVVPFLRLLEARLVDTVEA----------L
LIPB_DESVH       ITCHFPGQLVAYPVFRIE--RRP-----G-GLRSFFHDLEEVVLRTLHT----------F
LIPB_DESAG       ITCHFPGQLVAYPVFRIA--GRP-----G-GMRALFYSLEEVVIRTLAR----------F
LIPB_BACTN       ITYHGPGQLVCYPILNLE--EFH-----L-GLKEYVHLLEEAVIRVCAS----------Y
LIPB_CALS4       ITFHGPGQVVAYPIFNLA--KWQ-----K-DVHLFVHNLEEAVIRLLRE----------Y
LIPB_RICPR       FTFHGPGQRVIYPILNLALPNRH-----K-DLKLYIKMLEEWIINSLNY----------F
LIPB_NEOSM       YTYHGPGQRVIYPILNLR--SRN-----ICDLHKYIYLLEEVVIVTLDN----------F
LIPB_EHRRG       YTYHGPGQRIAYVMMDLK--ARD-----KCNVRLYVETLGEWIVKTLKH----------F
LIPB_EHRRW       YTYHGPGQRIAYVMMDLK--ARD-----KCNVRLYVETLGEWIVKTLKH----------F
LIPB_RHIME       YTYHGPGQRVVYVMLDLK--RRR-----Q-DVRGFVAALESVIIATLDS----------M
LIPB_CAUVC       FTYHGPGQRVAYVMLDLT--QRG-----R-DVRAFVAALEAWIIDALAA----------F
LIPB_RHILO       YTYHGPGQRVAYVMLDLK--RRR-----E-DVRAFVAALEQWIIGTLAA----------F
LIPB_BRADU       LTYHGPGQRVAYIMLDLK--RRR-----P-DVRAYVASLEELILKTLAA----------F
LIPB_PROMP       VTCHMPGQLVTYLVLDLS--NLN-----K-DLNWYLRKIEKIIIKTLRS----------F
LIPB_PROMA       VTHHLPGQLVVYLVLDLR--RYK-----T-DLDWYLRQLENVLLDVLDG----------L
LIPB_PROMM       VTHHLPGQLVVYPVLDLR--RYQ-----T-DLHWYLRQLEQVLIDVLAV----------L
LIPB_SYNPX       VTHHLPGQLVAYPVLDLR--RRQ-----P-DLHWYLRELEQVLIDVLAQ----------L
LIPB_THEEB       VTYHCPGQLVAYPILNLR--RHC-----C-DLHWYLHQLEEVIIQTLRH----------Y
LIPB_GLOVI       VTYHGPGQLVGYPILDLT--GYR-----Q-DLHWYLRTLEQVLIEVLAD----------F
LIPB_NOSS1       VTYHCPGQLVGYPILNLH--RHR-----Q-DLHWYLRQLEEVIIRVLAV----------Y
LIPB_SYNY3       VTYHCPGQLVGYPILDLN--HFQ-----K-DLHWYLRQLEEVLIITLEK----------L
LIPB_GEOSL       VTWHGPGQLVGYPILDLG--CRG-----R-DLHRYLRFLEQVLMDAAAS----------L
LIPB_TROWT       ITWHGPGQLVGYPILSLG--ATP-------DVLRYVRQIEEGLINALQS----------V
LIPB_CORGL       ITWHGPGQLVIYPIIKLA--DPI-------DVVDYVRRLEEALIQVVGD----------M
LIPB_MYCTU       ITWHGPGQLVGYPIIGLA--EP------L-DVVNYVRRLEESLIQVCAD----------L
                  * *  .* : *    .                  .                        

LIPB_LEPIC       DLQ-LI-SDS------DS-----PGLYL------E----------SNPS-----QKICSI
LIPB_LEPIN       DLQ-LI-SDS------DS-----PGLYL------E----------SNPS-----QKICSI
LIPB_BDEBA       GLT-GIEGRSSAKSSFNRADADDTGVWV------N-------------D-----LKIASV
LIPB_PYRAE       GIL-AG-KKQ------GH-----RGVWV------G-------------D-----RKIASI
LIPB1_PICTO      GYS-AS--TG------DE-----PGIWI------EKNGKL--------------KKVASI
LIPB2_PICTO      NIE-SYPMLN------EK-----TGVWH------E-------------D-----RKICSI
LIPB_PSYA2       HIS-AR-ARR------DA-----PGVYIYADTAAEIDSAHRSTDEIKVDNTIMIGKIASL
LIPB_PSYCK       HIS-AR-ARR------DA-----PGVYLYAD-MATETDSAPTSDEIEVDNTIMIGKIASL
LIPB_BORPE       GLEQAC-RKP------GA-----PGIYVPQP-GGE-------------L-----AKIAAL
LIPB_RALSO       NVA-SE-RKA------GA-----PGIYLSAG-PHQ-------------G-----AKIAAL
LIPB_COXBU       GIP-AQ-GKE------TA-----PGVYV------D-------------D-----KKICSI
LIPB_XYLFT       NIL-GE-RRE------HA-----PGVYV------G-------------D-----AKIAAL
LIPB_NITEU       DVV-AQ-GDE------NA-----PGVYV------D-------------G-----AKIASL
LIPB_CHRVO       GIA-AN-GDV------DA-----PGVYV------D-------------G-----AKIASL
LIPB_NEIMB       GIE-AA-ADP------KR-----PGVYV------G-------------E-----RKIASL
LIPB_PSESM       GVT-AA-AKA------DA-----PGVYV------D-------------G-----AKIASL
LIPB_SHEON       TIN-AY-AKA------DA-----PGVYV------D-------------E-----RKVASL
LIPB_HAEDU       GID-GY-PKP------DA-----PGVYI------E-------------G-----KKICSL
LIPB_PASMU       GIH-AY-PKA------DA-----PGVYI------D-------------E-----KKICSL
LIPB_VIBVY       NID-SA-ARP------DA-----PGVYV------E-------------G-----RKICSL
LIPB_ECOLI       GIE-AH-PRA------DA-----PGVYV------G-------------E-----KKICSL
LIPB_YERPE       NID-SH-ARP------DA-----PGVYV------E-------------Q-----QKICSL
LIPB_WIGBR       KIN-SY-SIK------NS-----PGVYV------D-------------K-----KKICSI
LIPB_BUCBP       SID-SY-ILN------NF-----PGVYV------N-------------N-----KKICSL
LIPB_BUCAI       SIQ-AY-TKK------KM-----PGVYI------N-------------E-----KKICSL
LIPB_BUCAP       SIK-SH-IKK------NS-----PGVYV------N-------------N-----KKISSL
LIPB_FRACC       GIP-AE-RRDTPPGSVEL-----TGVWT------R-----------RTN-----RKIASI
LIPB_DESVH       GLE-AS-RHE------GR-----PGVWI------D-------------N-----RKICSI
LIPB_DESAG       GLQ-AF-RSE------GR-----PGVWI------E-------------N-----RKICSI
LIPB_BACTN       GIE-AG-RLE------KA-----TGVWL------E--------GSTPRA-----RKICAI
LIPB_CALS4       GII-AG-RKE------KY-----TGVWV------G-------------D-----EKICAI
LIPB_RICPR       GIK-GY-LIK------DK-----VGIWI------KV--------NKGEF-----AKIAAI
LIPB_NEOSM       GIN-GC-RKE------GH-----IGVWV------GT--------GCQPP-----KKIAAI
LIPB_EHRRG       SIR-SY-FNP------NL-----IGVWV------N---------HNGSE-----KKIAAF
LIPB_EHRRW       SIR-SY-FNP------NL-----IGVWV------N---------HNGSE-----KKIAAF
LIPB_RHIME       NVK-GE-RRE------DR-----VGVWV------RRPEKPPLMDGSMAE-----DKIAAI
LIPB_CAUVC       NVT-GE-LRE------GR-----VGVWV------ERKGA-----GWSRE-----DKIAAI
LIPB_RHILO       NVR-GE-RRE------DR-----VGVWV------VRPDRPRLPDGSPAE-----DKIAAI
LIPB_BRADU       NVR-GE-RRE------DR-----VGVWV------KRPDK-----GDGYE-----DKIAAI
LIPB_PROMP       NIN-CS-TKD------GF-----TGVWI------G-------------E-----RKIASI
LIPB_PROMA       GLN-GY-RIN------GM-----TGVWC------N-------------G-----KKVASI
LIPB_PROMM       GLA-GE-RLQ------GL-----TGLWL------E-------------G-----RKVAAI
LIPB_SYNPX       DLR-GE-RLP------GL-----TGLWL------D-------------N-----RKVAAI
LIPB_THEEB       GIK-GE-RVA------GL-----TGVWV------E-------------G-----YKVAAI
LIPB_GLOVI       GVQ-GE-REA------GF-----TGVWA------G-------------G-----RKIAAL
LIPB_NOSS1       DLK-GD-RLP------SL-----TGVWL------E-------------G-----RKVAAI
LIPB_SYNY3       DLQ-GE-RIA------GL-----TGVWL------E-------------G-----HKVAAI
LIPB_GEOSL       GVQ-AW-RVA------GR-----TGIWT------E-------------G-----GKLASI
LIPB_TROWT       GIN-GF-RIA------GR-----SGVWV------R---------NGVSD-----EKVAAI
LIPB_CORGL       GVA-GAGRID------GR-----SGVWV------PAH-------DGWVD-----SKVAAI
LIPB_MYCTU       GLH-AG-RVD------GR-----SGVWL------P----------GRPA-----RKVAAI
                                         *::                            *:.:.

LIPB_LEPIC       GVNFKSFFTSHGIAFNLSND-LKTFRCINPCGRNW--TNMTSVKDLGL--DFGL--H-KR
LIPB_LEPIN       GVNFKSFFTSHGIAFNLSND-LKTFRCINPCGRNW--TNMTSVKDLGF--DFGL--H-KR
LIPB_BDEBA       GVGVRKWVAFHGAAINLTFD-EKAFLGLRPCGFPS--EVMVSLEQLT----GAK--V-DV
LIPB_PYRAE       GIAVENNVAYHGVAINVTID-PREFARINPCGLPA--STMISMKELG-----VV--A-EV
LIPB1_PICTO      GMAIDDYVSYHGVALNINKEVLNGFIKINPCGLPP------AVMDYI------D--I-KR
LIPB2_PICTO      GIAIRGFSTFHGMALNVNTD-LSKFNRIMPCNFSP--DIMTSMERIS----GRP--F-NI
LIPB_PSYA2       GFKIKHGFSYHGVAINLNCD-LSAFNAINPCGYAG--MQMLRLADFV---NMNQ--A-TT
LIPB_PSYCK       GFKIKHGFSYHGIAINLDCD-LSAFNAINPCGYAG--MQMLRLADFV---NMNQ--A-TN
LIPB_BORPE       GVKVRNGYAYHGLALNIDMD-LSPFLGINPCGYEG--LRTVDLAACG-----VR--T-SV
LIPB_RALSO       GLKIRNGCSYHGVSLNLAMD-LSPFTQINPCGYAG--LETVDMVTAG---ARDA----SG
LIPB_COXBU       GLRVRKGFSYHGLALNVAMD-LTPFSCINPCGFKG--LTMTQIQDYV-----NP--I-EM
LIPB_XYLFT       GIRVRRGCSFHGVAFNVAMD-LEPFHRIHPCGYRG--LQVTSVLDLG-----GP--S-EM
LIPB_NITEU       GLKIRRGACYHGIAFNADMD-LTPFTAINPCGYRG--LRVTQAKDLG------------I
LIPB_CHRVO       GLRIKNGATYHGLSLNVDMD-LTPFSWINPCGYAN--LKVTQMKNLG-----VN--L-TV
LIPB_NEIMB       GLRIKNGSVYHGLALNVNMD-LSPFTHINPCGYAG--MEMTQIADFV----QPC--P-TP
LIPB_PSESM       GLRIRNGCSFHGLALNVDMD-LEPFRRINPCGYAG--LAMTQLSDQA-----GQ--I-EF
LIPB_SHEON       GLRIRKGCSFHGLALNVDMD-LAPFRRINPCGYAG--LEMVQCRELG-----GP--Q-TV
LIPB_HAEDU       GLRIRKGCSFHGLAFNVNMD-LTPFSHINPCGYAG--LEMTQLKDYI-----SEDNA-QC
LIPB_PASMU       GLRIRKGCSFHGLALNINMD-LSPFHFINPCGYAG--LEMCQLADFI-----DPQQA-SC
LIPB_VIBVY       GLRIRKGCSFHGLALNVNMD-LSPFLRINPCGYQG--MEMVQVSELG-----GP--T-DI
LIPB_ECOLI       GLRIRRGCSFHGLALNVNMD-LSPFLRINPCGYAG--MEMAKISQWK-----PE--A-TT
LIPB_YERPE       GLRIRRGCSFHGLALNIAMD-LEPFQRINPCGYAG--MQMTQVSALQ-----PG--V-TV
LIPB_WIGBR       GLRIKDGYSLHGLALNVDMD-LYPFSHIHPCGDKN--IKMTQIRDLI-----SN--I-NL
LIPB_BUCBP       GLRIRNGCSFHGMALNINMD-LLPFEYINPCGNS---FKMTQVIDIK-----PN--L-CF
LIPB_BUCAI       GLRIKKGFTLHGLALNVNMN-LTPFNYIHPCGDKN--MKMTQIKDFN-----SN--V-KL
LIPB_BUCAP       GLRVKKGFTLHGLSLNVDMD-LTPFNYIYPCGDIN--IKMTQVKEFN-----SF--L-TL
LIPB_FRACC       GLRCTRKVTSHGFALNVDCD-MRPWTWATPCGMPE--VEMTSVQRELTDAGHAV--P-SM
LIPB_DESVH       GVAVRRWTTYHGLALNVGRD-LSLFNLITLCGLPD--AEATSLHREL---DDDS--V-TM
LIPB_DESAG       GIAMRRWTSYHGLALNVCRD-VSLFDMITLCGLTD--ARATSLQAEC---NDDS--I-TL
LIPB_BACTN       GVRSSHYVTMHGLALNVNTD-LRYFSYIHPCGFID--KGVTSLRQEL----KHE--V-PM
LIPB_CALS4       GIAVKRWITWHGIALNVNTD-LSYFGLINACGITE--FGVTSMKKLG-----IE--V-EI
LIPB_RICPR       GVRVRKWVTYHGIAINISTD-LCKFNGIIPCGLES--SLVTSLNQLG-----IY--V-EM
LIPB_NEOSM       GVRVSKWVSYHGIAVNLYPD-LSHYDAIIPCGIKN--FGVTSAKEMG-----IE--IRSF
LIPB_EHRRG       GIRIRKWITYHGVSINVFTD-LSHYSGIIPCGIKE--YGITSLKTLG-----VN--I-LY
LIPB_EHRRW       GIRIRKWITYHGVSINVFTD-LSHYSGIIPCGIKE--YGITSLKTLG-----VN--I-LY
LIPB_RHIME       GIRLRKWVSFHGLSLNVDPD-LEHFGGIVPCGIRG--YGVTSLVDLG-----LP--V-MM
LIPB_CAUVC       GVKLRRWVSFHGISLNVEPD-LSHFSGIVPCGQTE--HGVTSLVDLG-----LP--V-TL
LIPB_RHILO       GIRLRRWVSFHGIAINVEPE-LTHFGGIVPCGVQD--HGVTSLVDLG-----LP--V-GM
LIPB_BRADU       GVRLKRWVSFHGIAINVEPE-LSHFAGIVPCGVADPRYGVTSLVDLG-----QL--V-TM
LIPB_PROMP       GIGCKRWVTIHGFSINVNCK-LENFNKIVPCGIKG--CQMVNMSDYN-----KN--V-DI
LIPB_PROMA       GISCRRWITQHGIALNVDCD-LLGFNQIVPCGLKD--YQTGRLNSWL-----PK--L-QM
LIPB_PROMM       GVGCRRWITQHGLALNVDCD-LESFSAVVPCGLVG--HPVGRLNQWI-----PG--L-TM
LIPB_SYNPX       GVGCRRWITQHGLALNIDCE-LAGFDQVTPCGLSG--RAVGRLVDWI-----PG--L-RL
LIPB_THEEB       GIKVTRWISFHGIALNVVND-LKGFGRIVPCGIGD--RPVGNLRQFC-----AD--I-QL
LIPB_GLOVI       GIKVSRWVTMHGFALNVDPD-LDAFARIVPCGLT---RPVGSLVQLC-----PG--V-SV
LIPB_NOSS1       GIKVSRWITMHGFALNVCPD-MTGFSRIVPCGITD--KPVGSLAQWI-----PG--I-TC
LIPB_SYNY3       AIKVSGWVTCHGFALNICPD-LEGFSHIVPCGIGD--RPVGSLNQFL-----PG--L-TV
LIPB_GEOSL       GVGVRRWVTMHGFALNICND-LAPFSRIHPCGIVG--CPVTTLSREA-----GR--AITV
LIPB_TROWT       GVRVQKNVTLHGFALNCSND-LAPFEKIVPCGISD--AGVTTISRIL-----KR--TITP
LIPB_CORGL       GIRITRGVAMHGVAINCNNT-LDFYEHIIPCGIAD--AGLSTLSREL----KRD--V-SV
LIPB_MYCTU       GVRVSRATTLHGFALNCDCD-LAAFTAIVPCGISD--AAVTSLSAEL----GRT--V-TV
                 ..        ** :.*        :     *.                            

LIPB_LEPIC       DELISCLKKNLCSFLEPINVSSS--------------------------------
LIPB_LEPIN       DELISCLKKNLCSFLEPINVSSS--------------------------------
LIPB_BDEBA       GEFKEKLKRRLLEVL----------------------------------------
LIPB_PYRAE       RDVGIETAKKLALELGLTPELISKPPEVPQVAEELKPVRVAINA-----------
LIPB1_PICTO      DDAIDLIIREIEKIYGKFNKIEYEGLIS---------------------------
LIPB2_PICTO      NSVRERLIQSIEKEFDIKEKNIYKNVDLVGYGNGLLP------------------
LIPB_PSYA2       PQPNNPTLTDDAKTITYEQFTQKLIDNIAQRHAGVIPLRELAPK-----------
LIPB_PSYCK       IQPNNLPLTDDKKTLTYEQFTQQLIDNIAQRHAGDIPLRELAPK-----------
LIPB_BORPE       ERAGELLAAQLARAHGQAVQQRAAALAGVPG------------------------
LIPB_RALSO       RAVDAADWQRVSHVLADRLVAQLQHRANAHPAEAATA------------------
LIPB_COXBU       DAVKRTIIPLFLKNFGYNQPAIMVETSLEFLIDDHLRSFSEKLGERETVTNSRQN
LIPB_XYLFT       DTVAAALLAELARQFGFVLHPTSGWLSS---------------------------
LIPB_NITEU       ADCKEMLATKLAQSFINQLTDV---------------------------------
LIPB_CHRVO       AEAADKLLPHLERHLSTSKETA---------------------------------
LIPB_NEIMB       DEVAAKLTAHLETQFTPKADNNE--------------------------------
LIPB_PSESM       SEVSVRLRAQLVKHLDYAEQATLTGGINQYD------------------------
LIPB_SHEON       IEAGDQLIITLSQLLGYQHLVHHQGLAAS--------------------------
LIPB_HAEDU       KLVASKLVAHFCNILGYNSQKITNKSEIQAV------------------------
LIPB_PASMU       EKVAPKLVAHFAQLLGYNATNF---------------------------------
LIPB_VIBVY       ALVEQQLVKELVNLLGYEQVEFSTEAEVREA------------------------
LIPB_ECOLI       NNIAPRLLENILALLNNPDFEYITA------------------------------
LIPB_YERPE       ADVQPVLVREFTRQLGYPTAKLQPWSLSDYLLSSHSSSSVL--------------
LIPB_WIGBR       EKLNTQIINNCKKFLMMNNFEINFLNSIKIF------------------------
LIPB_BUCBP       KIIKLMLMHKIREIFS---------------------------------------
LIPB_BUCAI       KDVRFILIKELSKFLEIFIINSN--------------------------------
LIPB_BUCAP       NDIRVILIKKLSQLLNVSIIEKFSIK-----------------------------
LIPB_FRACC       AEVREIAAEMLGARNAPHPPAPNLSSGDLGTGTRAGRT-----------------
LIPB_DESVH       QEVKDVLTRQFLAIFTHPAVAAGEAAL----------------------------
LIPB_DESAG       QEVKDVCAGEFRAVFAHPPVAAHQNSV----------------------------
LIPB_BACTN       DEVKQRLECELGRLLNEKKQQIAQ-------------------------------
LIPB_CALS4       EEVMDRLVDKFEEVFEIKFEEIDLTRLAVVDSAKA--------------------
LIPB_RICPR       SEFDKIIQTEFNKIFK---------------------------------------
LIPB_NEOSM       NAFDRYFKKSFVKIFGE--------------------------------------
LIPB_EHRRG       EEFDVVLKKEFNKVFCNC-------------------------------------
LIPB_EHRRW       EEFDVVLKKEFNKVFCNC-------------------------------------
LIPB_RHIME       ADVDIRLREAFERVFGPTRTENE--------------------------------
LIPB_CAUVC       DDADAALRASFSKVFGPVEDAEAPV------------------------------
LIPB_RHILO       ADLDLALKSAFEDVFGPVAALPAEVARKTG-------------------------
LIPB_BRADU       ADVDVALRQAFEELFGPTRALVPEAAA----------------------------
LIPB_PROMP       KEVKKIVKKIIHEEFNFNFVSE---------------------------------
LIPB_PROMA       KEVRFLMKKSLNKRFGLLWI-----------------------------------
LIPB_PROMM       AEVQPLMRQSLSDRFGLVWQIPEPLAKPGAFASDA--------------------
LIPB_SYNPX       AEVQPLLRDALAARFHLAWCDEA--------------------------------
LIPB_THEEB       EDVRQQFVAAFSRVFGLEFAPKALADLLIPTSS----------------------
LIPB_GLOVI       EQVQPVVACAFARVFGVQCEPGALEACLAVKPGC---------------------
LIPB_NOSS1       EEVRVHVVQAFAEVFGLELVDS---------------------------------
LIPB_SYNY3       EIVQPLVIQAFAEVFPVTWIATGEMPCWLSDDVA---------------------
LIPB_GEOSL       AEAKAAVAAPFAGLPADALPEQPRDAVQPSSCDDVHAPSTTSRRPPCPLTV----
LIPB_TROWT       KEILDSVFNSICSALEYINTCRGNV------------------------------
LIPB_CORGL       EELVEPSIRALDDALAGRLVVSDHSFGSAPDPTKNLPKRG---------------
LIPB_MYCTU       DEVRATVAAAVCAALDGVLPVGDRVPSHAVPSPL---------------------