CLUSTAL format seed alignment for MF_00014

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RIMM_VEREI      --------------------------------------MHTMATALTLEPTALPSDAIEV
RIMM_POLSJ      -------------------------------------MGANSSSPAGLTPSSLPDDAIEV
RIMM_LEPCP      --------------------------------------------MAAADESSWPADVVEV
RIMM_METPP      ---------------------------------------------MLDDEVVWPEDAIEV
RIMM_JANMA      --------------------------------------------------MKVPEDLVLV
RIMM_PARP8      MSERDSGSSGRAKAKRQPGAKAPFGPFVRKPVEKVEANAAAAQKARAESAESWPDDAVEV
RIMM_RALSO      ------------------------------------------MRPGAGANPSLPDDLVEV
RIMM_BORA1      -----------------------------------------------MSERTLPDDLVEL
RIMM_POLAQ      ------------------------------------------------MSTPSLDNLIEL
RIMM_ECOLI      --------------------------------------------MSKQLTAQAPVDPIVL
RIMM_BAUCH      ----------------------------------------------------MPVNPVVL
RIMM_BLOFL      ---------------------------------------MKVIVINS-----TPINPIVI
RIMM_BLOPB      -------------------------------------MKHDEYSINKEDVMIPPLHPVVI
RIMM_PSYIN      --------------------------------------------------MSKKAEPIVI
RIMM_COLP3      --------------------------------------------------MSTEEKKIIL
RIMM_IDILO      ---------------------------------------------------MQQSEQIVV
RIMM_SHEAM      --------------------------------------------------MSSNQQPVVV
RIMM_PSEA6      --------------------------------------------------MSHASDTLVM
RIMM_HYDCU      ------------------------------------------------MMSSKQDEKIIL
RIMM_XYLFT      --------------------------------------------MKDN------ERRILL
RIMM_ALKEH      --------------------------------------------MEGA------DDIVPM
RIMM_METCA      --------------------------------------------MPGNSG---NDRSVVV
RIMM_ALCBS      ---------------------------------------MAERGQSSSAEGGASSQLVVV
RIMM_NITOC      ----------------------------------------MELGQEATDD----KRYVLV
RIMM_CHRSD      ------------------------------------MSHETGGADTAQDD-----EHVVL
RIMM_MARHV      ---------------------------------------------MTQNS-----QETVI
RIMM_HAHCH      ------------------------------------------------MS-----EKVCI
RIMM_MARMS      ---------------------------------------MSELKQAAAPE-----QALVV
RIMM_CELJU      --------------------------------------------MSAKSS-----NLVSV
RIMM_SACD2      ----------------------------------------MFTPVEAKKS-----NLITV
RIMM_PSEF5      -----------------------------------------MNATPAPAD-----DLIVI
RIMM_LEGPH      ---------------------------------------------MNNKT-----NWVII
RIMM_RUTMC      ------------------------MKNVLLPNNQERKRSLSNSEIFTFDD-----KRLLI
RIMM_DICNV      --------------------------------------------------MKAQPTLIAL
RIMM_METFK      --------------------------------------------------MQIVSELVIM
RIMM_THIDA      -----------------------------MAPSCPTRSRVWSSRTSPPPDLAESEAWVVM
RIMM_CHRVO      --------------------------------------------------MRD-EDLVVM
RIMM_NEIG1      --------------------------------------------------MTDTQNRVAM
RIMM_NITMU      --------------------------------------------------------MVIM
RIMM_NITEC      --------------------------------------------------------MVVL
RIMM_AROAE      --------------------------------------------------------MIVL
RIMM_DECAR      ---------------------------------------------------MTGNDIVVL
RIMM_ACIAD      ----------------------------------------------MTPTQNVPEDRIQI
RIMM_PSYWF      ------------------------------------------------MTKPNADSLMKI
RIMM_COXBR      ---------------------------------------------------MKPNDKVII
RIMM_FRAP2      ----------------------------------------------------MSQDFVEI
RIMM_ROSS1      ----------------------------------------------MMEERPSADEVLLI
RIMM_CHLAA      ----------------------------------------------ML--WVVMDDLLYI
RIMM_HERA2      ----------------------------------------------MT--APNQDDFLLV
RIMM_MYXXD      --------------------------------------------------MTATSPYLEL
RIMM_RUBXD      --------------------------------------------------MGELADPVVI
RIMM_NITWN      -------------------------MTAR----------------------------VCV
RIMM_AZOC5      -------------------------MTDR----------------------------ILI
RIMM_METS4      -------------------------MARRPQRPAPSGRAGAGRGAAGAAPPGPDARLVVL
RIMM_CAUVC      -------------------------MAVSPDDP-----------------------LILV
RIMM_BEII9      ------------------------------------------------------------
RIMM_GRABC      -------------------------MSRD---------------------------LILL
RIMM_GLUDA      -------------------------MDRE---------------------------RILM
RIMM_ACICJ      -------------------------MDDR---------------------------LILM
RIMM_JANSC      -------------------------MTNP--------------------------DHTCV
RIMM_ROSDO      -------------------------MSD---------------------------EKICV
RIMM_RHORT      -------------------------MTE----------------------------RLLV
RIMM_MAGSA      -------------------------MGPR----------------------------VRV
RIMM_PARL1      -------------------------MAPTPDRDG-------------------QDKKVCL
RIMM_MARMM      -------------------------MTEPAD------------------------DLVFI
RIMM_HYPNA      -----------------------MSADTKTQ------------------------RLIPM
RIMM_SPHAL      ------------------------MTADR---------------------------PVTL
RIMM_NOVAD      -------------------------MRDR---------------------------PVTL
RIMM_ZYMMO      ----------------------MVAAPDR---------------------------LITL
RIMM_RHILO      -------------------------MSKP-------------------------QNPVQM
RIMM_CHESB      ---------------------METHMAKPKAPAG-------------------IENPVQL
RIMM_OCHA4      -------------------------MPRP-------------------------ENPIQL
RIMM_BARBK      ----------------------MEHNKKE------------------------LNKAVLL
RIMM_ANAMM      ------------------------MVRGD---------------------------MVLL
RIMM_ANAPZ      -----------------------MNIDDT---------------------------FILL
RIMM_WOLTR      -------------------------MKDN---------------------------LVCM
RIMM_EHRRW      -------------------------MNSD---------------------------FICL
RIMM_RICBR      -----------------------MDSLEN---------------------------LILV
RIMM_ORITB      -----------------------MSSESK---------------------------LIPI
RIMM_DEIRA      -------------------------MTRPEASGP--------------------PDATRL
RIMM_THET8      ------------------------------------------------------MRLVEI
RIMM_HUNT2      -----------------------------------------------------MIQYLQV
RIMM_CALS8      -----------------------------------------------------MYKYLQV
RIMM_CLOD6      --------------------------------------------------MKEKLTHFKV
RIMM_CLONN      -----------------------------------------------------MEQFLAV
RIMM_CLOTE      -----------------------------------------------------MEQFLKI
RIMM_CLOBL      -----------------------------------------------------MKEFLAV
RIMM_CLOPS      -----------------------------------------------------MEDLLVV
RIMM_CLOB8      -----------------------------------------------------MGNLFKI
RIMM_CLOAB      -----------------------------------------------------MEDFFSI
RIMM_ALKOO      -----------------------------------------------------MAKMLRV
RIMM_FINM2      ------------------------------------------------------MEYIAV
RIMM_CALS4      -----------------------------------------------------MADYYNV
RIMM_DESHY      ------------------------------------------------------MDEVLI
RIMM_MOOTA      ----------------------------------------------------MDTERIGV
RIMM_HELMI      -----------------------------------------------------MAKRVRV
RIMM_PELTS      ----------------------------------------------------MHESYIRI
RIMM_CARHZ      -----------------------------------------------------MNNLIAI
RIMM_SYNWW      ---------------------------------------------------MNSDKLVAI
RIMM_SYMTH      ------------------------------------------------MAGQSRPDLIRI
RIMM_DEHM1      --------------------------------------------------MTQEEEYILI
RIMM_CHLTE      ------------------------------------------------------MELFLT
RIMM_CHLPB      ----------------------------------------------------MKEEFYLA
RIMM_CHLPD      ------------------------------------------------------MDLFLT
RIMM_CHLCH      ------------------------------------------------------MELFLT
RIMM_GEOLS      -------------------------------------------------MDGSSDNLIAV
RIMM_PELPD      ------------------------------------------------MID--SESLIPV
RIMM_GEOUR      ------------------------------------------------MSSG--NETVLI
RIMM_GEOSL      ------------------------------------------------MRQ---DDLKLL
RIMM_SYNFM      -----------------------------------------------MSKTVEPACLVPV
RIMM_SYNAS      ------------------------------------------------------MKFFEI
RIMM_PARD8      --------------------------------------------------MIREEEVFKI
RIMM_BACV8      --------------------------------------------------MIKKDEVFKI
RIMM_PORGI      --------------------------------------------------MIDLDSLEHI
RIMM_GRAFK      ---------------------------------------------------MTKEECFYL
RIMM_CYTH3      ---------------------------------------------------MNPADNILW
RIMM_NOSP7      -MKHEEANKEIGGRGAEGQRSKRVGGNSKIQNIQSPAPNPQPIVPNTQSPVPNLDNWLEI
RIMM_MICAN      ----------------------------------------------------MEENWLEI
RIMM_CROS5      -------------------------------------------------MENNKNQWLEI
RIMM_PROMA      --------------------------------------------------MCKKIIWLTI
RIMM_PROMT      --------------------------------------------------MFEKDKWMTI
RIMM_TRIEI      -----------------------------------------------------MSEWIEI
RIMM_SYNR3      ----------------------------------------------------MADEFLVV
RIMM_SYNY3      -------------------------------------------MAEPMTEQQKTENWLEI
RIMM_SYNP2      ---------------------------------------------------MAEQDWIII
RIMM_GLOVI      -----------------------------------------------------MQQWLEI
RIMM_THEEB      -------------------------------------------MVTPFPE---VSEWLCI
RIMM_ACAM1      -------------------------------------MPVSDSLSPDLPNDDTSEEWLEV
RIMM_SYNJA      -------------------------------------------MVASRDT-----AWLLV
RIMM_PROMP      --------------------------------------------------MINHNEWLIV
RIMM_CORDI      -------------------------------------------------------MELMI
RIMM_CORU7      ------------------------------------------------------MPDLQI
RIMM_SALTO      --------------------------------------------------------MLVV
RIMM_NOCSJ      ----------------------------------------------------METIEVLV
RIMM_KINRD      -------------------------------------------------------MEYVV
RIMM_THEFY      -------------------------------------------------------MRLVV
RIMM_STRAW      -------------------------------------------------------MQLVV
RIMM_SACEN      -------------------------------------------------MDDKQPLTLAV
RIMM_RHOJR      -------------------------------------------------------MELVV
RIMM_RENSM      -------------------------------------------------------MQVHV
RIMM_FRASN      -----------------------------------------------------MGEPVVV
RIMM_CUTAK      -------------------------------------------------MEESATVEVVV
RIMM_ACIC1      ----------------------------------------------MTDSPEETTVRVAV
RIMM_LEIXX      --------------------------------------MADHKLPRKEVAPRPDQTELRV
RIMM_DESVV      ---------------------------------------------------MEASRFIEI
RIMM_DESAG      -----------------------------------------------------MDKYVQI
RIMM_LAWIP      ----------------------------------------------------MSEQLVAV
RIMM_NITSB      ------------------------------------------------------MKKLTV
RIMM_SULNB      -------------------------------------------------MQKPINENFFI
RIMM_SULDN      -------------------------------------------------MSKQSNKLLHI
RIMM_ARCB4      ---------------------------------------------------MSMNSNVYV
RIMM_CAMJ8      ---------------------------------------------------MSEKDFVQV
RIMM_CAMHC      ---------------------------------------------------MLKDDMLEV
RIMM_CAMFF      ----------------------------------------------------MKSDFVEV
RIMM_CAMC5      ----------------------------------------------------MNSEFVEV
RIMM_HELAH      --------------------------------------------------------MLLV
RIMM_TREDE      ------------------------------------------------------MDLLAT
RIMM_TREPA      ----------------------------------------------------------MT
RIMM_LACP7      -----------------------------------------------------MEDLLRV
RIMM_OENOB      -----------------------------------------------------MKEL-RI
RIMM_LACDB      ------------------------------------------------------MNYYNV
RIMM_LACJO      -----------------------------------------------------MTEYFEV
RIMM_ENTFA      ----------------------------------------------------MTDY-LNV
RIMM_OCEIH      ----------------------------------------------------MSGVKFNI
RIMM_PEDPA      ------------------------------------------------------MNYFNV
RIMM_LACPL      ------------------------------------------------------MDYYRV
RIMM_LACRD      ------------------------------------------------------MEYYNV
RIMM_LACS1      ------------------------------------------------------MNYYEV
RIMM_LACP3      ----------------------------------------------------MPD-YYDI
RIMM_LACSS      ----------------------------------------------------MPEKYYQV
RIMM_LEUMM      --------------------------------------------------MTNTENYFKV
RIMM_LYSSC      ------------------------------------------------------MEWFNV
RIMM_STAS1      -------------------------------------------------------MKVEI
RIMM_THEP1      ---------------------------------------------MIRTIQDLLNERVAI
RIMM_PETMO      ----------------------------------------------MNSLSNLLDNKISV
RIMM_THEM4      ---------------------------------------------MIKTLHELLKDKVPI
RIMM_FERNB      ---------------------------------------------MMRRVEDLLKDKIPY
RIMM_PSELT      -----------------------------------------------------MSDYVVI
RIMM_BUCAP      ----------------------------------------------MNIFLKKPLHPILI
RIMM_BUCAI      ---------------------------------------------MINISINKPIQPLLI
RIMM_BUCBP      ------------------------------------------------MTKKFLNIHLTI
RIMM_BUCCC      --------------------------------------------------------MITI
RIMM_PELCD      -------------------------------------------------MVLQQSDLLIL
RIMM_ANADF      ------------------------------------------------------MARIRL
RIMM_BIFAA      ----------------------------------------------MHSDDPQQLELLRV
RIMM_SORC5      ----------------------------------------------------MERRYVPV
RIMM_MAGMM      ------------------------------------------------MSGTEEIRWVTL
RIMM_AQUAE      ----------------------------------------------------MMEEYVVI
RIMM_ACHLI      -------------------------------------------------------MLYSI
RIMM_BORBU      --------------------------------------------------------MFIK
RIMM_SALRD      ------------------------------MPPPTASTPDDSADPGPDFADVPPTDLVKV
RIMM_FUSNN      ------------------------------------------------------MELLIA
RIMM_SULSY      ----------------------------------------------------MKKDLIAI
RIMM_NEOSM      -----------------------------------------------------MNDMVCA
RIMM_SOLUE      -------------------------------------------------MSVEETGWVTV
RIMM_KORVE      ---------------------------------------------MSSTSSTNTDDFITI
RIMM_LEPIC      ----------------------------------------------------MTKEWISL
RIMM_AMOA5      ----------------------------------------------------MNKNCVEV
RIMM_BDEBA      ---------------------------------------------------MLESKMKLV
RIMM_MESFL      ---------------------------------------------------MENKNLLSI
                                                                            

RIMM_VEREI      GRIADAWGLQGWFKVQPYSA---DPEALFSCKRWYLQPAAR-------------------
RIMM_POLSJ      GRILDAWGVKGWVKILPHST---DPEALFSAKSWFLQAPEAK------------------
RIMM_LEPCP      AKVIDAWGVKGWFRVHPYAA---DAQAVFTSRRWYLQGPDNR------------------
RIMM_METPP      GRIVDAWGIKGGIKVLPFSS---DPQALFSSRRWFLRPPEKP------------------
RIMM_JANMA      GYISGAYGLNGWVRVRPYSA---DADALLTAKTWWLDK----------------------
RIMM_PARP8      GAIVDAYGLKGWVKVAAHADAGHGGDALLSTKRWWLEKG---------------------
RIMM_RALSO      GYVGGAYGVRGWIKVQPHGD----AEALLHASTWWLKPAAGA------------------
RIMM_BORA1      GRVASAYGVKGWIKVQPHSA---QADVLRAAKQWWLAATP--------------------
RIMM_POLAQ      GAISEAQGLQGQVKVRPHSP---DPVALLSSKVVWLSLLPRRSA----------------
RIMM_ECOLI      GKMGSSYGIRGWLRVFSSTE---DAESIFDYQPWFIQKAG--------------------
RIMM_BAUCH      GTISSAYGISGWLNIISFTQ---NAASIFEYQPWFIKKLN--------------------
RIMM_BLOFL      GRIKGAYGILGWVKILSFTE---KIEDIFVYNPWFIFFRS--------------------
RIMM_BLOPB      GRIIGAYGILGWVRILSFTE---KNDNIFYYSPYFIIVQS--------------------
RIMM_PSYIN      GKFGAVHGIKGWLKVHSYTD---DPESIFEYKPLLMKSKG--------------------
RIMM_COLP3      GKVGAVYGIKGWLKIHSFTD---ETEAILDYFPWSLKLGN--------------------
RIMM_IDILO      GRIGAVYGVKGWLKVQSFTD---DPESIFEYSPWLLSQK---------------------
RIMM_SHEAM      GKIGSTYGVKGWMKITAYTD---SVEGIFDYSPWFLKEHG--------------------
RIMM_PSEA6      GKIGAPYGVKGWVKITSYTD---ELDGIFSYTPWLVGQEG--------------------
RIMM_HYDCU      GQINGIYGVQGWVKIFSHTD---PRQNILSYSPWLVKVKN--------------------
RIMM_XYLFT      GRVVGGFGLRGEIKIESWTE---PRDAIFRYQPWLLRSP---------------------
RIMM_ALKEH      GEVVGLHGVRGWVKVYSHTE---PREAILDYPHWYLRRD---------------------
RIMM_METCA      GRVSGAFGVRGWVKAVSFTD---PPVNLVGYRPWTLRRG---------------------
RIMM_ALCBS      GRILGVHGVKGWVKVYSYTD---PMVNLQQYQPWHLKQGALNS-----------------
RIMM_NITOC      GRISGLYGVQGWLRVYSYTQ---PRNNILDYEPWYLQQN---------------------
RIMM_CHRSD      GRLTSPYGVKGWLKVYSYTS---PIEGIFEHAEWVLSK----------------------
RIMM_MARHV      GRITSVFGVKGWLKVFSYTD---PKDGILNYRDWTLLL----------------------
RIMM_HAHCH      GKIVGVYGVKGWLKVRSFTS---PPENMLRYANWELVRE---------------------
RIMM_MARMS      GRITSVYGVKGWVKLYSHTE---PMQGIFDYKHWWLKTP---------------------
RIMM_CELJU      GRITAVYGIKGWVKVHSYTE---PQDNLFEYHPWWVKTR---------------------
RIMM_SACD2      GRITGVFGIKGWVKLKSFTD---PQDNVLEYSPLLLKTK---------------------
RIMM_PSEF5      GKIYSVHGVRGEVKVFSFTD---PIKNLLDYKTWTLKR----------------------
RIMM_LEGPH      GRFGRPHGIKGFVTVHSFTD---PADNILRYNDWHVFLN---------------------
RIMM_RUTMC      GQINSLFGVQGWVKIFSHTH---PRENILFYQPWHINVD---------------------
RIMM_DICNV      GRIIGVHGVRGWVKIHSECR---PREAIFNYSVFQATRHH--------------------
RIMM_METFK      GRIVAPYGVYGWVKVQPATE---YVDSLFDYGRWMLGRGDPK------------------
RIMM_THIDA      GRVSAPFGVKGWVKVQPFSE---DPGTLMDFESWRVGRG---------------------
RIMM_CHRVO      GFVRGAFGIKGWVKIHADTE---YADGLFDYPTWWLGKNG--------------------
RIMM_NEIG1      GYIKGVFGIKGWLKIAANTE---YSDSLLDYPEWHLAKDG--------------------
RIMM_NITMU      GRVAGPYAVAGWIKVFPYTE---YVDGLLDYPDWWLGSEGG-------------------
RIMM_NITEC      GRVIGPHGIRGQIKVTPFTE---HIDGLMEYPVWWLSNDEK-------------------
RIMM_AROAE      GRIVAPFGVKGWVKVHPFGD---DPLSWGEMPQWWLADDADA------------------
RIMM_DECAR      GRLADPYGIQGWLWLYPFGD---DPLAWAEMPVWWIAREGEP------------------
RIMM_ACIAD      GQLRSAYGLNGWLWVYSNTE---PMSNMFDYLPWFIETKAG-------------------
RIMM_PSYWF      GQLKKPYGIKGWLWVFSETE---EREAIFSYSPWWMKTATG-------------------
RIMM_COXBR      GRLARPYGLRGWIKVVSFTH---PIDNLLNHPTWQIQ-----------------------
RIMM_FRAP2      AKIGATYKLDGELNLYPLAS---SIETLLSYGDWYIQLP---------------------
RIMM_ROSS1      GKVIDAFGLRGEIKIRAITDQ--VDHLRRHVRTVFLGEERR-------------------
RIMM_CHLAA      GALGAPFGVRGQIRLHSISSH--PEHLIRHLRTVFIGPKRV-------------------
RIMM_HERA2      GRISAAFGVRGELKISMISSH--PEHIQK-LKQLFVGDLSK-------------------
RIMM_MYXXD      GYVARAHGLRGEVAIRALDP---ASETLDTVDRIWVRTRAG-------------------
RIMM_RUBXD      GTITAPHGVRGTVRVRPAGE---GRHLREGLSPLVGGRRR--------------------
RIMM_NITWN      ARIGAAHGLRGEVRLWTFTE---DPMSVTRYGPLSTKDG---------------------
RIMM_AZOC5      ARIGAPHGVKGEVRLFAFGE---DPLALKRY-PLTDESG---------------------
RIMM_METS4      GEFGRAHGLQGEVRLKSYTA---EPMAIGGYGPLLASDGRV-------------------
RIMM_CAUVC      GRVAGGFGVRGEVRITTYTE---DPLSIAGFKALKRQDG---------------------
RIMM_BEII9      --------MRGEVRLQSFTE---VPQAISAYGPLSDASG---------------------
RIMM_GRABC      GVIGRPHGVRGLVHVVSYTA---DPDDLTAYGLLHDEAGRQ-------------------
RIMM_GLUDA      GVVGRPHGVRGLVRVHSYAA---VPEDLTAYGALTDEHGQV-------------------
RIMM_ACICJ      GVIGRPHGVRGAVHVTTYSP---DPEGLAEL-PLRDERGRR-------------------
RIMM_JANSC      GAISGSFGVRGEVRLKSFCA---EPSDIGSYGPLSTEDG---------------------
RIMM_ROSDO      GAIAGAYGVRGELRIKSFCA---TAEDIETYSPLTSEDG---------------------
RIMM_RHORT      GVIVGSHGVRGLVRVKSFTQ---DEMALCDYGPLSDETG---------------------
RIMM_MAGSA      GVIVGVHGVRGAVRIKSFTE---DPADIGFYSPVENEAG---------------------
RIMM_PARL1      GVVTGAHGVRGLVRVKPYTE---MPEGVAAYGPVETKDG---------------------
RIMM_MARMM      AAIAGAHGVRGECKVKSFAG---NPADAFKYGAFLDIDG---------------------
RIMM_HYPNA      GVLKGAHGVRGEVRVKSFTA---DPDALFTYGPLMDEAG---------------------
RIMM_SPHAL      AAIAGAHGVRGEVRLKLFGE---GAETLRAFSVF-DAGD---------------------
RIMM_NOVAD      AAITGAHGVAGEVRLKLFGE---GVAALKRYRAFNDSGD---------------------
RIMM_ZYMMO      AVVTGAHGITGEVRLKPFTE---DAAQFKAYGIF--SAN---------------------
RIMM_RHILO      AVIGAAHGIKGELRVKTFTG---EPMALADYGPLYARDG---------------------
RIMM_CHESB      AVIGAAHGIKGEVRVKTFTE---DPMALGSYGPLHMVDG---------------------
RIMM_OCHA4      AVIGAAHGTRGEVRVKTFTG---DPLAIAEYGLLYDEQG---------------------
RIMM_BARBK      AVIRAAHGIRGDVVVNLLGA---EPQRLKTYGVLYDDKG---------------------
RIMM_ANAMM      GVVRAPHGVMGLVKVRTFTE---DPSHISAYGPLTDGHN---------------------
RIMM_ANAPZ      GVIYAAHGVRGCVKIKTFTH---DPSDIAAYGPLTDGSE---------------------
RIMM_WOLTR      GIITSPHGIKGAVKVKIFTE---KPENISLYGKLISGSK---------------------
RIMM_EHRRW      GIITSPHGIKGHVKIKTFTE---NPQNFTSYGKLTDGIT---------------------
RIMM_RICBR      GVIKSCHGIKGHIILRSFTD---PTVKITERELVNESGE---------------------
RIMM_ORITB      GIISSPYGIRGQVAIKSFTD---PASNILNYELKDYRKN---------------------
RIMM_DEIRA      GHLLGPHGVQGGIKLYVLGD---PAQVLALKRVYVESRG---------------------
RIMM_THET8      GRFGAPYALKGGLRFR---G---EPVVLHLERVYVEGHG---------------------
RIMM_HUNT2      GKIVNTHGIKGEVKAIPLTD---NPRRFNKLKWAYVSKEISNE-----------------
RIMM_CALS8      GKIVNTFGLKGEVKVIPLTD---SPDRFSELNYVLLEDNLSQ------------------
RIMM_CLOD6      GQIVNTQGLKGEVRVYPLTD---DIERFDELKDFYLGKDLNN------------------
RIMM_CLONN      GKIINTHGIKGEIKVMPSTD---NVERFKELNEAYIDGNIVE------------------
RIMM_CLOTE      GLIINTHGLKGELKVNPQTD---NIDRFKKLKRVYIAGEEKQ------------------
RIMM_CLOBL      GEIINTHGIKGEVKVYPLTD---DMKRFKKLKEVFIDGEGRK------------------
RIMM_CLOPS      GQIINTHGLRGEMKVMPLTE---DMRRFDYLEYVILKGQKIK------------------
RIMM_CLOB8      GQIINTHGIKGEVKVYPLTE---DVNKFKRLETVLVGGEEKK------------------
RIMM_CLOAB      GQIINTHGVRGELKIYPLTD---DINRFDDLDSVYVDNEIKK------------------
RIMM_ALKOO      GKITNTHGIKGDLKVLPLTD---YFERFEELEWVYIEGFKDK------------------
RIMM_FINM2      AEVLNTHGIKGCLKMRPLTD---NIERFDEDICYYLGDKKVK------------------
RIMM_CALS4      GKVTSPHGIRGEIKVYPLTN---VPERFYDIPYIWVFDEKDI------------------
RIMM_DESHY      GEVIKPHGVQGEIKVYPITD---NPKRFRKLKEVILVQNQE-------------------
RIMM_MOOTA      GKIIGTHGIRGEVKVFPLTD---FPERFRPGTRLILEQEGADG-----------------
RIMM_HELMI      GQIVNTQGVRGQVRLWPLTE---KPSRFNEIKRVFVEAP---------------------
RIMM_PELTS      GKILKTQGNRGAVRVLPLTD---YPERFKNMSRVQVSLK---------------------
RIMM_CARHZ      GYVLGTFGIEGWVKVEPLTD---HPQRFLNTERVFWEKE---------------------
RIMM_SYNWW      GKIAGTYGYAGWLKVIPLTD---FPERFYKLDKVILNQG---------------------
RIMM_SYMTH      GQVTAPHGVRGAVRVYPTTD---FPERFVTLKRVMIDGPDRA------------------
RIMM_DEHM1      GKVLGVWGINGGLKIEVLTD---FPERFDAGNELLIGRAPYT------------------
RIMM_CHLTE      GVVLKPKGLKGELKVKPVTD---FPESFLTRREYYIGKTPED------------------
RIMM_CHLPB      GKILKPKGLRGEVKIQPVTD---FPDSYLERKIFYVGKSEEE------------------
RIMM_CHLPD      GTILKPKGLKGEVKVLPVTD---FPELFLSRKSYLAGKSDAS------------------
RIMM_CHLCH      GKILKPRGLKGEVKVELITD---FPHHFVKRKQFFVGVSPSS------------------
RIMM_GEOLS      GRISGTHGIRGQLRLHSYSG---NLESLQAAKNVLIRFPAGG------------------
RIMM_PELPD      GKLVATHGIRGMLKLHSYSG---SVESLCTCDSVILRSRDGA------------------
RIMM_GEOUR      GKVSATHGVRGQLRITPFSG---DVDSLLTLRSIMVKKPGGE------------------
RIMM_GEOSL      GKIVTTHGIRGQLKVASFSG---EFDTILSLETVVLKGKDGR------------------
RIMM_SYNFM      GKVTRTHGIRGALKIFPYGE---SLAAQAAGERFFLRSKNGG------------------
RIMM_SYNAS      GEIVKSHGLKGRMKAKSYVE---NGEDLSSVHEAMIVKGKEE------------------
RIMM_PARD8      GQFAKPHGIKGELSLVTNSDV----LEDAEDPYIVCEMDGIL------------------
RIMM_BACV8      GIFNKPHGVKGEISFTFTDDI----FDRVECEYLVCLLDGIF------------------
RIMM_PORGI      GVLGKPHGVQGECNARLTADLS-TLFEEEERLFLFFELDALP------------------
RIMM_GRAFK      GKIVAKFSFKGEVLIKLDTDE---PETYTEMESVLVEYNDNL------------------
RIMM_CYTH3      GNIIKVHGVKGEVLVQVFSDD---LTDYETLESVFVEIKQKQ------------------
RIMM_NOSP7      GKIVSPQGLSGELKVYPVSD---FPERFEVPGKRWLLHLDGTE-----------------
RIMM_MICAN      GTIVAPQGLEGELRVLSVSD---FPERFQKRGMRGIQGPQGGE-----------------
RIMM_CROS5      GTIVSARGLKGELKVLSSTD---FPERFEIPGKRWLQPPHDPY-----------------
RIMM_PROMA      GKIVAPQGLSGKVRINPSSD---FPERFIKSGDRWLQYD-NEE-----------------
RIMM_PROMT      GEIVAPQGLRGDLRIKPSSD---FPERFTKPGKRWIQKT-DEL-----------------
RIMM_TRIEI      GKIVAPQGLKGDLRVYPSSD---FPERFTEPGKRWLLSPGQVE-----------------
RIMM_SYNR3      GQVVAAQGLKGEVRILPASD---FPQRFTEPGSRWLRRRGHNE-----------------
RIMM_SYNY3      GTIVAAQGIQGEVRVLSASD---FPARFLTKGQRWIRKTPQET-----------------
RIMM_SYNP2      GQVVAAQGLKGEVRINPSTD---FPERFEVPGQRWLQLPNQD------------------
RIMM_GLOVI      GKVVAAQGLRGEVRVQPATD---FAERLTRPGARLVGRSLDD------------------
RIMM_THEEB      GQIVGAHGLRGEVKVKPFSD---FPERFTVPGCRWLRSPRQPQ-----------------
RIMM_ACAM1      GTIVGAHGLNGEVKVYPDSD---FPERFTQPGLRWLVSPTEAST----------------
RIMM_SYNJA      GQVVAAHGLRGWLRVKCWSD---FPERLTEPGPRWLQRDSDPE-----------------
RIMM_PROMP      GLITSPQGINGKIKIKSLSD---FEERFTKPGKRWIQKGNETP-----------------
RIMM_CORDI      GRVVKSHGIRGEVAIEVTTE---EPEIRFAQGEVLNGRQGG-------------------
RIMM_CORU7      GRVIKPHGVKGEVVVDPSTD---HVPERFAIGEALRAVQTG-------------------
RIMM_SALTO      GRIGKPHGIRGEVTVEVRTD---EPETRFAPGSVLRTEPGANVP----------------
RIMM_NOCSJ      GRIGKPHGIRGELTLDVRTD---EPERRFAPGAVLRAEPPA-------------------
RIMM_KINRD      ARVGRPHGVRGEVTVEVRTD---DPDTRFAPGAVLRTDPDR-------------------
RIMM_THEFY      GRIGRPHGVKGEVTVEVRTD---SPEERFVVGKALETD----------------------
RIMM_STRAW      ARIGRAHGIKGEVTVEVRTD---EPELRLGPGAVLATD----------------------
RIMM_SACEN      GRIVRPHGVRGELVVEVRTD---SPELRFAPGSVLGMRRRG-------------------
RIMM_RHOJR      GRVAKSHGIKGEIVVEVRTD---EPEDRFAVGAVLRGHKPR-------------------
RIMM_RENSM      GRIGKPHGIRGEVTVEVLTD---TPQERFSAGAVFSTE----------------------
RIMM_FRASN      GRVGRPHGIRGDVTVDVRTD---LPERRFAPGARLVRQVADGPASRPAADAAGAADAVGT
RIMM_CUTAK      GRVGRAHGLRGDVVVEVRTD---EPDARFGVGATVQIE----------------------
RIMM_ACIC1      GRITRAHGVHGEVGVQVRTD---DPDRRFAAGAVLTTD----------------------
RIMM_LEIXX      GRLTKAHGLKGAIKLELFTD---EPGKRFVPGAVFTLQVPT-------------------
RIMM_DESVV      GLLTRPHGLKGEVCVDYYAD---SP--FLLEGTVYLKAGRAA------------------
RIMM_DESAG      GLITKPHGLRGEVCVVSYAD---SP--FLMQERIFLQAGKGP------------------
RIMM_LAWIP      GVLSRPHGIKGEIRLIRYTD---SI--DVFLGEVFLQKSNSL------------------
RIMM_NITSB      ARLGRTVGLHGDMKLHILTD---FPEQFQKGS----------------------------
RIMM_SULNB      AQIGRTVGLWGDLKLHLHTD---FPEQFKVGN----------------------------
RIMM_SULDN      ATIGKSVGLGGDMKLHIKSD---FPEQFKKGV----------------------------
RIMM_ARCB4      AKLGKTVGLQGHLRLFIDSD---FPEQFKKGV----------------------------
RIMM_CAMJ8      AKLGKTVGLKGYVKLHNLSD---FSSQFKKDA----------------------------
RIMM_CAMHC      ALLGKTIGLKGAIKLHNRSD---FPSQFKKGA----------------------------
RIMM_CAMFF      CILGKTVGLKGALKLHDRSD---FPNQFKNGA----------------------------
RIMM_CAMC5      AIIGRCVGLKGCVKLHNKGD---FPEQFKKNA----------------------------
RIMM_HELAH      GRIGKSVGLNGGLKLHLESD---FPECLKKGVKVSVAP----------------------
RIMM_TREDE      GRIRGTFGIEGFVKVESFSG---EYEHFLGFDRVFLSILKEK------------------
RIMM_TREPA      ARIVSTFGVAGLLRLKSFSG---EYAHLATLKQVCLAPPRSRSSGT--------------
RIMM_LACP7      GVISSTHGIKGEVKV-FPTTDD--MNRFKKLKMVTLDTGKEQK-----------------
RIMM_OENOB      GRVINTHGIAGELKIDFNTDFP--EQRFAKNSELLIAGEK--------------------
RIMM_LACDB      GKIIATHGLKGEVKVALTTDFP--EDRFRAGSRLYLGDDS--R-----------------
RIMM_LACJO      GKILSPHGLKGEVKVNATTDFP--EERLATGSRLFIKNNKQYE-----------------
RIMM_ENTFA      GKIVNTQGIKGEVRVISKTDFP--EERYQKGAMLLLFQEKKA------------------
RIMM_OCEIH      GKIVNTHGIRGEVKVVRITDF---EDRFDPGNTVYL-QDNKE------------------
RIMM_PEDPA      AKIVNTRGLRGELKVISYTDFP--EERFKSGAELQIFKTEKDEVP---------------
RIMM_LACPL      GTLVNTHGIRGEVKVVVVTDFP--EERFKVGQQLSLFKTPDETTG---------------
RIMM_LACRD      GKIVNTHGVRGEVRVLATTDFI--DERFAKGNTLYLQQSGE-------------------
RIMM_LACS1      GKIVNTHGIKGELKIISKTDFP--EDRFKPGNILYIRDNGK-------------------
RIMM_LACP3      GTIVNTHGIRGEVRVLVTTDFP--ADRFKVGNTVYVA-TSPKT-----------------
RIMM_LACSS      GKIVNTHGIRGEVRVIATTDFT--EERFKKGTHLAVEMPNGLT-----------------
RIMM_LEUMM      GTIVNTHGIRGEVKIMAITDFA--QDRFKKGADLFIDTKQGR------------------
RIMM_LYSSC      GRIVNTHGIRGEVRILSTTDFE--KERFAVGNKLAAFKKDDKK-----------------
RIMM_STAS1      GKIVNTHGIKGEIKVKSNSDFT--ETRFQPG-ELVIIERKNKE-----------------
RIMM_THEP1      GKIVNTHGLKGEVKFFPYTN---SEEIVKNLSSVVLYNSEKKA-----------------
RIMM_PETMO      AKIVNSHGVHGEVKIVPFTN---VKDVITNLEEVLLYNTSTRN-----------------
RIMM_THEM4      AVLGKTHGLNGELRLFPLTN---MPEVIESLEEVFIYNEKVKK-----------------
RIMM_FERNB      GILSNTHGLNGDLKLYLFSN---MPELVEKITEAVAYNESQKK-----------------
RIMM_PSELT      GKITKTHGLFGSVKVLPLTN---ALEVFQKLENVFIKNDAQSN-----------------
RIMM_BUCAP      GKIGKAYGILGWVKFFSFTE---NKEKIFSYFPWFILKKK--------------------
RIMM_BUCAI      GKVGKSYGILGWINIFSFTE---EQEKIFNYLPWFFFKEKN-------------------
RIMM_BUCBP      AKFGAAHGILGWIRVFSYTE---KKENIFDYVPWFIKKEQK-------------------
RIMM_BUCCC      GKIGKPYGILGWFHMFSYTE---KKNNIFNYFPWKLEKSNIL------------------
RIMM_PELCD      GVVIGTHGLRGDLKIRGSDQ---DFPLLSKMHQLVFLREGE-------------------
RIMM_ANADF      GKVVRAVGLKGHLGVAGSEG------ALATVRRIALRREGEP------------------
RIMM_BIFAA      CRIGRAQGLKGEVTVQIFTD---EPEYRFAPGAVLYTKDGEE------------------
RIMM_SORC5      ADVARPHGVQGELRLRLYNE---ASDLLLTRPPIRLRLPDGS------------------
RIMM_MAGMM      GYVMGAFGLKGEMRVRSLTE---RPDGIFDHPVWWLFNPKQK------------------
RIMM_AQUAE      GKVLDTFGLEGELKVRPYAP----PEVFENLEKVYLKRKGGD------------------
RIMM_ACHLI      GKVVQTHGIKGEVKIKPHTD----FDRFVKGFDVIIKDT---------------------
RIMM_BORBU      GVILSSYGVNGYARVKSISNNFCDFINLKNNKVLLKKSNSSS------------------
RIMM_SALRD      GFIFRPHGLDGELKIDPSATD--DPARFEVLPTVFVGPHPRRV-----------------
RIMM_FUSNN      GKVLGSHNLKGEVKVISDLD---NIEVLVGNKVILELADSQQ------------------
RIMM_SULSY      GKIHGTHGVKGNLKFEIFVK------NFYLPEEIYIKDEENE------------------
RIMM_NEOSM      GRVTSTHGVRGCVRFRSYMS---VDFKFPGIDVSIGGVS---------------------
RIMM_SOLUE      ALVGKTRGNRGEVTAVVLSS---RPERYQDLQEVFLFGPGLPEAG---------------
RIMM_KORVE      ARIQKTQGRVGEVFSELFTD---FPELFEQRHHLYVLPEKGE------------------
RIMM_LEPIC      GQLGKPFGIKGWLRLNVRET---VLCELKTPISLKLSKPDFHFP----------------
RIMM_AMOA5      GKITQARGLKGCVVARIEPI----LESFDPINYIFIKIGHTL------------------
RIMM_BDEBA      GKIREAHGLKGDLYVLVFSGEIAWAKRMKTFGLKAKDSDE--------------------
RIMM_MESFL      GKIVNTFGIKGAVKIALEKSI--EVNDINGIKLLFIENTNNV------------------
                          *                                                 

RIMM_VEREI      -------------GAKAFGGTVLLPIRQAKDHG--GMVLAWAQDIDDRNTAEALRGARIF
RIMM_POLSJ      ----------FRPGFNAFSGTVLLSVDEAKTHS--DTVVAKFSGQDDRNAAEALRGARIF
RIMM_LEPCP      ----------PR-PKDAPALPRLLHVTEVKEHG--DGIVACAPEVADRSAAEALKGARIF
RIMM_METPP      ----------MG-PKAAKPLPTLLRITNAREQG--DVIVATAQDVADRNAAEALRGCSVF
RIMM_JANMA      ------------------PEFHDVEMMQSKIHT--GDVVAKLMGVAGRDAAEALKGATVQ
RIMM_PARP8      ------------------RERQSTPCLQSKVHG--DSIVAQLGGTADRDAALALRGHRVY
RIMM_RALSO      ----------PA----VSSDWRVLPVGTSREHS--GSVVAGSPAVPDRNVAEALRGCTVW
RIMM_BORA1      -----------------KSAPRVYAVQQCRVHG--ATAVAQLEGIADRDQAEALRGATVW
RIMM_POLAQ      ----------GALSSTEEATLTQYKVKSAKMHS--GNVVLTLDGVSDRDQALALKGARIL
RIMM_ECOLI      -------------------QWQQVQLESWKHHNQ-D-MIIKLKGVDDRDAANLLTNCEIV
RIMM_BAUCH      -------------------TWLDVILDEWKYNYH-NKLIIKINSIENREAAQLFANCNII
RIMM_BLOFL      -------------------KWKVIKLEYWRLMNN-KNYIVKFFNVSDRNHAMALSQHNLV
RIMM_BLOPB      -------------------TWKEIFLDKWKLIG--KRYIVKIRGVSNRNSAQSLSRCNII
RIMM_PSYIN      -------------------QFQEVNIADWKRHS--NGFVAKIVGFDVREEAQALVGLELL
RIMM_COLP3      -------------------NTQTVEITDWRKHN--KVLIVKVAGIDDRDEAQALVGSEIL
RIMM_IDILO      -------------------TEREMKVVEWRRHN--NGLIARLEGISDRDEAARLTGADIC
RIMM_SHEAM      -------------------EWREVKVSQWRFHG--KAVVAELEGVSNREQAQMLTNCEIG
RIMM_PSEA6      -------------------NTKEIVVDQWRTHN--KGLVAKLVGVETRDDAESIKNLDIS
RIMM_HYDCU      -------------------EWRTFQVEEGRAQQGGKSVVAKLEGIDDRDLAREYIGCEIA
RIMM_XYLFT      -----------------TGTESMLNGARGYETG--KRLIATFPGINDRNGVEAICGTEIY
RIMM_ALKEH      -----------------DGDWVPVERTAGRCQG--KGLVAAFRDVEDRDRARAYIGLQIG
RIMM_METCA      -----------------D-AERRADVLEGREHG--NAVIVRLQGVDTREQAEALKGFEVT
RIMM_ALCBS      ------------GGSSAAGTWKPVKVTGFRPQG--KGLIAQLEGVSDREAAAALVGQDIG
RIMM_NITOC      ------------------GAWQARRLRKGRVQG--KGIVVALEGIDERDVAALWVGCEIA
RIMM_CHRSD      -----------------RGERRACKLSQGRPHG--KGLVASLEGISSRELAEQWAGADIL
RIMM_MARHV      -----------------DGKRIPIRLEEGRRQG--QGIVVRLKGIDDREVARTYCGAEIR
RIMM_HAHCH      -----------------DGNRSSAKLRSGKPQG--KGIVIALAGVDDRNLAKSYVGCQIE
RIMM_MARMS      -----------------SGWK-TVELSQGRLQG--RGLVASVKGYTDRDQVKDICGMDVY
RIMM_CELJU      -----------------HGVK-QVEIDEARPHG--DAYVAHIKGVDDRDLAMAYTAADIA
RIMM_SACD2      -----------------HGVK-ECEIAEYQFRP--QGLVVRLKGVDDRNAAEALAPVDVA
RIMM_PSEF5      -----------------EGSVKQVELVSGRGND--KFLVAKLKGLDDREEARLLAGYEIC
RIMM_LEGPH      ------------------KQWQPLKLLTIEVRS--KAIIAQIEGYPKRELVSALTNLDIG
RIMM_RUTMC      ------------------ANWQTLEIIQGCVQA--KTIVAQIKDVFDKEQARAYIGIDLY
RIMM_DICNV      -------------------HAQTLKLLDARRSG--KSLIALFADICDRDAALQLNGFTLN
RIMM_METFK      ----------------QPEQWQSCEVEKAKVHN--DLLLVKLQGIDDRDQAFSCKGMYVA
RIMM_THIDA      ------------------EQQAQYAVEAVQDHG--KSLVAKLVGIDDRDAAFALRGQEVS
RIMM_CHRVO      -------------------SWKPYAFENGAVQP--KALAAKLEGVDDRDAAEALRGTQIA
RIMM_NEIG1      -------------------KTVSVTLEAGKVVN--GELQVKFEGIDDRDSAFSLRGYTIE
RIMM_NITMU      -------------------KWHKFKVIEGEVHG--SVLLASLEQCADRDAAARLKGLKIA
RIMM_NITEC      -------------------SWQIVHPTSFSVHD--SLLIITLEEYSDRTNASGLKGWLIA
RIMM_AROAE      ----------------PESAWQPVTLAGFKEHG--AGLVAAFVGHDDRNAAEALQGRFIG
RIMM_DECAR      --------------------WRECRLKSLKAHG--NGVVVLLDGVADRTAAESMKGVLVG
RIMM_ACIAD      --------------------WQTVDVKRWKPHG--KGLVVSLKNVSDRNAAESLIGSTIW
RIMM_PSYWF      --------------------FKPLTVTQWRRQG--TGIVAQFEQVPDRNVAETMNGVSIW
RIMM_COXBR      ----------------HNNEWQPLKLQAGKLHE--PFLVVKLENIDDPETAKHYTNDLIA
RIMM_FRAP2      ----------------ANSAWQPLKDESVLRRA--DKLYIKLASVNDVETAKKYVNSLIG
RIMM_ROSS1      -------------------PFTLQRVHEPKAGI----LILSLGGVTDRTTAEALRGAEVT
RIMM_CHLAA      -------------------PHQVSRLYMHKPGL----LIIQLQTITDRDAAADLRGEEVY
RIMM_HERA2      -------------------PYTIGRLHQHKGSL----YLLRLNEVDTRDAAEAMQGLEAY
RIMM_MYXXD      -------------------VEREMRLEALRPTPK--EDIVVLEGVESRNDAEALVGAKVF
RIMM_RUBXD      ------------------------RILRARRTPK--GFLVDLEGVPDRFRAAELRGEDLL
RIMM_NITWN      ---------------------ARQLEVSHARAASDHL-IATLTGVTTREEAERLNGTELY
RIMM_AZOC5      ---------------------ARRFKVQSLRAAKDHF-VARLEGIADRNAAEALTNTDLF
RIMM_METS4      ---------------------VELTALRPAAGTPDIL-VARVAGVAGRSAAEGLNRLTLS
RIMM_CAUVC      ---------------------SPALTIASARKTKDGV-VCRCPGVETKEAADALRGLRLY
RIMM_BEII9      ---------------------KKSFSIASLRLVKNAVFVARIEGVTTREAAEALTNLSLY
RIMM_GRABC      ---------------------IMLDWRADGLAGI-TIDGV---PVQDRSAAERLTNTRLF
RIMM_GLUDA      ---------------------WSLRWRGDGIAELRDAAGQ---PLSGRDAAQAMVNRRLY
RIMM_ACICJ      ---------------------VGLAWTGAGIARVTIGEGDEAAAIADRDAAAKLTNLRLY
RIMM_JANSC      ----------------------AQTYTITLTRPVKAGYAAMLSGVATKEDADALRGTRLY
RIMM_ROSDO      ----------------------QRHFHLALVRPIKGGFVARIAEVSSKEEADALKGVQLF
RIMM_RHORT      ----------------------TRRFAVEVRNQAKGVVICQIPGVSDRTAADALKGTRLF
RIMM_MAGSA      ----------------------SIKYRLKVTGEVKGLVIATLDGIGDRDAAEALKGTELW
RIMM_PARL1      ----------------------ATSFAISLKGMAKDLVICKLEGVDDRDVAAALRGTELY
RIMM_MARMM      ----------------------KTILTPKAARPVKDGFVVRFAEPLDRDKAQALKGTKLH
RIMM_HYPNA      ----------------------KVLLTPITARPGKDHFIVRPKENLQKEDWDALRGCLLH
RIMM_SPHAL      ---------------------RK-LTLKSVRPANQG-AVAAFVEIADRSAAEALRGTLLT
RIMM_NOVAD      ---------------------GSGLTVVKIKDDGKGGAIARFAEVPDRTAAEKLRGTALT
RIMM_ZYMMO      ---------------------GTPLTLKKLRPDPKG-WVARFSEITDRNQAEALRGTALT
RIMM_RHILO      -----------------------RAFQITDIRPANTVVVVRFKGISDRNAAEALAGTELF
RIMM_CHESB      -----------------------RVLQVAAIRPAKEVVIVRFKGVDGRNAAEALNGEALF
RIMM_OCHA4      -----------------------KSYEVLEARPAKTVVVVRFKGINDRNAAEALNGTELF
RIMM_BARBK      -----------------------RLYEIVSMRVHKNNVIVRFKGVDDRSTAEALKGVQLY
RIMM_ANAMM      -----------------------CFNVTVVSVLGADSVIAKFDGLSSRTESEKLRGKRLY
RIMM_ANAPZ      -----------------------SLKVSVMSVIKNGCVIAKISGIDDRCSAEALKNKKLY
RIMM_WOLTR      -----------------------NYDIDSVSVIGENLVIATINGVNSRNEAEFLRNKKLY
RIMM_EHRRW      -----------------------TYEINIIQVVSKNTIIAKINNITSRTNAELLRNKKLF
RIMM_RICBR      -----------------------KVNINLIKQNSKGELICQFNDISTRNEAANLKGYKLF
RIMM_ORITB      -----------------------IIKIHSAKILSK-KIICNIDQIVTRTAAEQLTRTKLY
RIMM_DEIRA      ------------------------WLSLRRAEGMPPNLVLYLAGVSSREGAEELRGLQVY
RIMM_THET8      ------------------------WRAIEDLYRVGEELVVHLAGVTDRTLAEALVGLRVY
RIMM_HUNT2      ---------------------MPKFDIVSVKHH-KNFVILKFSGIDDMNAAEKLKEHFVI
RIMM_CALS8      -----------------------KLTIERYRVK-DNIVIMKFREISSIDEALKLKNRFLV
RIMM_CLOD6      -----------------------KLAVEKVRYK-GSMVIMKIKGIDSIEKAEKLKNKFMY
RIMM_CLONN      --------------------------IEGCKFQ-PGKVILKIKGIDSIEDAQRLKNKYIK
RIMM_CLOTE      --------------------------VEGCKFL-NDKVVLKIQGIDGIEIANKYRNKYIE
RIMM_CLOBL      --------------------------ILSCKLQ-PNNVVLKIEGIDSIEEANKYRKKLLE
RIMM_CLOPS      --------------------------VEGVKYF-KDKVILKLQGINSIEEAEKLKRTYLE
RIMM_CLOB8      --------------------------ILGVKFQ-KDRVILKIEGIDSMNDAETYKQKYIE
RIMM_CLOAB      --------------------------VISVKKQ-PNKLILKLEGIDTLDEAVKYKNKYIK
RIMM_ALKOO      ------------------------FYIENIKYK-PTLVILSFEGYGDINLVEKFKDRYLL
RIMM_FINM2      ------------------------VTIQNYRMY-KGFLYIDFEEFNDINEVLGFKKQYLY
RIMM_CALS4      ---------------------PCKYEIENVKITSKGMVLLKLKGIDSRNDAEKLKGLFLK
RIMM_DESHY      ---------------------QRRLKVLHANVH-QSEVYLTLEGINTRDKAEAIRGWAVK
RIMM_MOOTA      -----------------REGRTFPVTVISVRPG-KGNLILKLAEINDADQAGAVRGATLK
RIMM_HELMI      -----------------PQGAPEVLTITSAHPL-KKLVIVSFQEISDMTQAERLKGCYLT
RIMM_PELTS      -------------------GFRTFFTVGEVYHH-KNFIIIKFKEIESMAAAEKLKGAFLE
RIMM_CARHZ      -------------------DEIFPLRIEEVQLQ-AERILVKFMEINDIKEANKLIFGYLK
RIMM_SYNWW      -------------------GKLGTFLVDGLKAH-NNFYLFKFSGIDTVEVAQGFQNGILQ
RIMM_SYMTH      -------------------------VGARFRGFVKNLVILELEGITDRNQAERLRGADLL
RIMM_DEHM1      -------------------------ISQ--TSWQKAQVIVHLSEITGIDAAEELSGAQVE
RIMM_CHLTE      ---------------------AVLRKVQSARFH-QGFAWLVFEGAGSREGAEALVGCGLY
RIMM_CHLPB      ---------------------AVRRTVRQAALR-KGFAYLLFSGIDTREKAEEIVGFSVF
RIMM_CHLPD      ---------------------VMPLNVLKASLS-KGFAWLFFEGVDTLEKAEKLSGMHLF
RIMM_CHLCH      ---------------------VVCMQVTKAALH-GGFAWLFFEGIDTFEQATTLVGFSLF
RIMM_GEOLS      ---------------------TRQIQLKKAAYH-SGKFLLTLEGFDTIEKAQELAGAELL
RIMM_PELPD      ---------------------LNRFEPKPVLPR-PGKFLIGFKGVDHIDQAQTLVGSEIC
RIMM_GEOUR      ---------------------MEIFAVAASKAH-GKKVIITLKAFDNINQVLHLVGRELY
RIMM_GEOSL      ---------------------METFPVARATVH-HDRVLLSLTPFTNINEVLHLISAVSY
RIMM_SYNFM      ---------------------YCTLTLIGLRAQ-GRMLVCGFEEIKDVNGAQPFVGEEIF
RIMM_SYNAS      ---------------------PRGYKVRKIVLH-KTYFFLELETIDTVESADSLVGSTVL
RIMM_PARD8      ----------------------VPFFVEDFRYKTDTVVLVKLEDVNSEEDARMFVGKEVF
RIMM_BACV8      ----------------------VPFFIEEYRFRSDTTALVKLEGVDTSEKARMFTNVEVY
RIMM_PORGI      ----------------------VPFRLIGYREKTDDITLLRFAGIESKEEMEQYTGVSLF
RIMM_GRAFK      ----------------------VPFFIERSYLHKSTLLRAKFEDIETEEDAEDMIGAHVY
RIMM_CYTH3      ----------------------IPFFLSTFNFATQKRCILSFEDVTTVEQAKPLVGADIY
RIMM_NOSP7      --------------------PQPIQLLTGRYISNKNLYVIKLAGVENCDQAEALRGCKLM
RIMM_MICAN      --------------------IREITLLRGRELPGKNVYVIKLEGVENREQAEALRGYKLW
RIMM_CROS5      --------------------PQAIELISGKSVAGKNIYIVRLEGIENRNQAETLRGYKLL
RIMM_PROMA      --------------------PQKIQLNSGRQIPGKSIYVVEFQGIDDREKAKALVGKKLL
RIMM_PROMT      --------------------PTEIKLTKGKLIPGKSIYVLSIEGVSTRSSAEEIIGWKLV
RIMM_TRIEI      --------------------PISIELLSGRYVPGKGLYVIELAGIKSRQQAEALRNSQLL
RIMM_SYNR3      --------------------QQVQLLS-GRQLPGKELFVVRFEGINDRTAAESLVHQEFL
RIMM_SYNY3      --------------------PQPLTLKKGKQIPGKNLYILRFTEITDRNQAEALVNYQLL
RIMM_SYNP2      --------------------PQSVELERGRQIPGKNLFVVKFEHIQDRTQAENIRGAKVL
RIMM_GLOVI      --------------------GRVFRLQSGRAIPGKDLFVCRFEGVEERNAAEKLVGSTLW
RIMM_THEEB      --------------------PYAVTLLRGRFLPRAEQFVVTFAEISDRTAAEALKGAEIL
RIMM_ACAM1      --------------------PEEIQLIRGRFVERKGIYVVKLANVNFRDQSEALKGTKLL
RIMM_SYNJA      --------------------PLLHPLIEGQFFPAKGLYLVRLEGIPDRTAAEAWVGAKVL
RIMM_PROMP      ---------------------IEFELTHGFKKPGKESFIITFKGINNRTQAENLKGQKIL
RIMM_CORDI      -------------------KEHSLTIASVRPHQN--RLLVKFKEIADRTAADSLRGTRFF
RIMM_CORU7      -------------------KERQLTVTGMRRHQN--RLLVTFEEIRDRDEAESLRGARFM
RIMM_SALTO      ------------AHPGAYRVPGELTVEAARWHQGR-VLLVTFEGVLDRNVAEALRGTLVG
RIMM_NOCSJ      ---------------GSASRLRRVTVRSARWHQS--TLLVAFEEVADRTAAEAARGILLH
RIMM_KINRD      ---------------------GPLTVATARWHNG--TLLLTFQGVEDRTAVEGLRNTRLV
RIMM_THEFY      -----------------PADVGPLTITAQRWHKD--RLLVRFEEVPDRTAAEQLRGVFLV
RIMM_STRAW      -----------------PASVGPLTIETGRVHSG--RLLLRFEGVRDRNGAEALRNTLLI
RIMM_SACEN      -----------------AHASENFTVAAARPHAG--RLLVRAEGVEGREAAEELRGALLT
RIMM_RHOJR      -----------------EQTVSTYTVEAARDHSG--RLLLRLEGVSDRTAADALRGTLFV
RIMM_RENSM      -----------------PTSAGPLTVETARWNKD--ILLLGFEEVNDRNRAETLRGTRLI
RIMM_FRASN      AAGPGSAGDSGAARAAGPPVATVLSVVASRWHSG--RLLVRFDGVTDRDAAEALRGSFLT
RIMM_CUTAK      ----GSRRD--------------LTVVRSRWAKG--CLIVAFDEVKDRQGAEELRGSVLV
RIMM_ACIC1      -----TGVT--------------LTVQRTRWHSG--RLLVRFAGIDDRTTAEDLRGRVLF
RIMM_LEIXX      ---------------ASKWHGKTLALRELRWYNG--HPVGFFDGVDDRTEAESLVKAILW
RIMM_DESVV      --------------------PRPVKVQSMRMHKG--RPLVIFEGVNDRTAAELLRGHVML
RIMM_DESAG      --------------------CVPYRVRSSRRHSG--TELLLLEGIDDRNAAEKLRQHKVL
RIMM_LAWIP      --------------------PKKAEIISSRIHQG--VALVCFKGFSDRSAVEVLRGQTLL
RIMM_NITSB      -----------------TFESDR-G-SLTIESVNPARGTVKFQGIDSVDEAKKYTNAYLY
RIMM_SULNB      -----------------SYQSNR-G-ELTISDINFKRGTIRFQGYESIDAAKKLTNTKLY
RIMM_SULDN      -----------------SFFINE-NETLTLSDINHERALIKFVGYNSPEDAKKLTNKNLY
RIMM_ARCB4      -----------------TFTTNR-NLQLKVLEYNSSRELVKFENYEDVELAKKLTNQELY
RIMM_CAMJ8      -----------------TFFIKNTKEMLKIKHYNASNSTVLFENYEDIEKAKELINLILF
RIMM_CAMHC      -----------------KFYLTD-GEILEILSFNKTNFVAVFKNYENIECAAKLTNKILY
RIMM_CAMFF      -----------------KFYDIN-SKEFVIKSYDRNNNLVIFENYDSIDLAKTLVNYILY
RIMM_CAMC5      -----------------VFFDKD-GNEFIIKSYDVSKETALFEGYEDIDLAKSLVNKILY
RIMM_HELAH      ----------------LNAFSHASFKDYVIHSYEHAKNLLFLETINTPEMARELTNLGLF
RIMM_TREDE      ---------------LREQKYKDGWFEIEEVNLRKADALVKFKGIDNPEAAKCLTGSELF
RIMM_TREPA      ---------------LACALPREAVHMVEHVLLRAQDALLKLHRVDTVECARTFVGAELR
RIMM_LACP7      ------------------------ELEIENVKFFKQFVILKFKGIDNINDIEKYKGKDLL
RIMM_OENOB      -------------------------LVVQSSRPFKQFWLVKFSDHENINLVEKYKGEDIF
RIMM_LACDB      ------------------------EVTVAAGRPFKQFWLVTFAEITDIDQAEKLKGTEIL
RIMM_LACJO      ------------------------ELIVENTRRHKQFYLVKFEKIDDIDQAEKICSKELY
RIMM_ENTFA      ----------------------PIELVVKSHRKHKNFDILSFEGHPNINDVEKYRDGILK
RIMM_OCEIH      ----------------------YKPLVIATHRVHKGFDLLQFKGYGNINEVEAFKGLMLS
RIMM_PEDPA      ----------------------VQTVTVKNAKEYKGSFIVTLEGMNSINDVEKFKGMILK
RIMM_LACPL      ----------------------GITVKIAKAREQKGLYFLTFEGLDNINDVERYKGWTIK
RIMM_LACRD      ----------------------PLPLTIESTRQHKGFVLVKFVGYDNINDVEQFRDHELM
RIMM_LACS1      ----------------------INSYEIKSHRTHKQFEMITFKGLENINLVENLKGKILE
RIMM_LACP3      ------------------------ALTIQSVREHKGLTLLTFKDYTDINQVLPFKGKKLQ
RIMM_LACSS      ------------------------PVTVSAMRQHKQFYLLQFEGLGNINDVELFKGHNLK
RIMM_LEUMM      -----------------------IPVKVQSSRLHKNMWLVLFVGVTNINEIEKYKGDDVY
RIMM_LYSSC      ----------------------PTGVTIQSVRRHKNFILLTFEGMNNINLVEPFKEGLLK
RIMM_STAS1      ----------------------PLEFTIASYRMHKGLHMLTFEGINNINDIEYLKGETIM
RIMM_THEP1      ----------------------FYNLTVESVRRMNKLFLIRFKSIDTIEAAERIKGCEVF
RIMM_PETMO      ----------------------FFFSKVLQVKPLNKFFVLNLRGIKDMDEAKKMIGYEVF
RIMM_THEM4      ----------------------LLIGRIIHMSLANGYYIVKFRGIDTLNDAKKFVGSTLY
RIMM_FERNB      ----------------------FVIVKFSKVRKASDYFIVHLTGIDTISEAEKLKGFIIY
RIMM_PSELT      ----------------------THRLQIEEIRKAGKGFLIKFSGIDDEERARKIVGLSLA
RIMM_BUCAP      ----------------------WEIIHVDKWKKHNNNFIIHIENILDRSTVSKFTNLEIF
RIMM_BUCAI      ----------------------WTRIQIKNWKKYKNNFIVHIKDISDRSVVSQFTNADII
RIMM_BUCBP      ----------------------IIKILPKYWKILKKTFLVKINDVNNRSMAQKLTNYDIL
RIMM_BUCCC      ----------------------LYKNNIIHYKTHTDHFLIKIKDINNRTQTLNFIKQNIL
RIMM_PELCD      ---------------------TVLKCARRKAGWYKGHLLLQIAGYRDVRAVQHLVGCEVA
RIMM_ANADF      ---------------------EPPLQEVLEARPQGRLWAVRIEGVSDRTSAEAWVGAEVL
RIMM_BIFAA      ------------------------EYVVESSRTFKNRWIIKFEGIDDRDASEAANGVVLY
RIMM_SORC5      ----------------------ARDAKIVATRPVDKALLVRIAGIDDRDAAEALRGATVC
RIMM_MAGMM      ---------------------TRQEMRLGSGRLHGKGVVATLAGVTTREAVQALFGTEIQ
RIMM_AQUAE      ----------------------WVPFEVEWVDFIDDKVIIKFKGYDSIDEVEQFKGAKLF
RIMM_ACHLI      ------------------------KYKIQTVREQKDLLLVSFVGYPTLTDVEHLKQQEIY
RIMM_BORBU      -----------------------VEVKVVDVNIKGNSLFLKFEEIDTPEAVRPLIGFELW
RIMM_SALRD      -------------------VRHDIASVRYQKTKRGITVILGLDGIVDRDDAEAVAKMDVF
RIMM_FUSNN      ----------------------KLLTIKKIEHLVANKWIFSFEEIKNKQDTIEIRNANIK
RIMM_SULSY      ------------------------LQPLNIETVDRKKGLIKFKNYDTPEKAKEISHRLIY
RIMM_NEOSM      ------------------------YTVCGAFSRGFPMFVLTLSRVGSACEAEKLVGFDVF
RIMM_SOLUE      -----------------------ERREVEEAWYHLQTLVLKFRGVDTISEAESLYGAEVR
RIMM_KORVE      ----------------------RRELELEDHWFHKGGVVLKFQGIETIDDAEKLLRSEVQ
RIMM_LEPIC      ----------------------EKEITLLEIRPHGGKFIVRFEGVTTPEEAAKWIGGFLF
RIMM_AMOA5      -----------------------VPYQVEEITGQAQQVFIKFQHISDRDSVRELIGSSIW
RIMM_BDEBA      ----------------------IKTFTVERTKPFKKGLIVKAAEVADRTAAEGLEHMEFF
RIMM_MESFL      ----------------------IIPKQVESISMQKSHLVVYFKEHNHINEVEIFKGKKVK
                                                                            

RIMM_VEREI      VPRS-------SFPSPPP-GEYYWVDLIGLQVINRQG------------------LALGQ
RIMM_POLSJ      LPRS-------SFPVASK-DEYYWVDLIGLNVVNREG------------------VPLGQ
RIMM_LEPCP      VSRA-------SFPTVGD-GEYYWIDLIGLSVVNRDG------------------ESLGT
RIMM_METPP      VSRA-------SFPTADV-DEYYWIDLIGLAVVNREG------------------QALGN
RIMM_JANMA      IPRS-------HFPALSD-NEFYWVDLIGLEVENLQG------------------EHLGQ
RIMM_PARP8      VRRR-------DFPALGT-DEYYWVDLVGLDVVNEAG------------------IELGK
RIMM_RALSO      VRRA-------EFPAPAD-DEFYWVDLIGSTVVNEQQ------------------ETLGT
RIMM_BORA1      VSRA-------LFPAAAE-DEYYWIDLVGCAFYSSVSGSD---------------VRVGV
RIMM_POLAQ      LDRD-------AFPKAES-DSYYWVDLIGCKAKNLQD------------------EILGD
RIMM_ECOLI      VDSS-------QLPQLEE-GDYYWKDLMGCQVVTTEGYD------------------LGK
RIMM_BAUCH      VDAS-------QLPTLSD-GDYYWKDLIGCQVETINSYQ------------------LGK
RIMM_BLOFL      VESI-------QFPKLYNKDEYYWKDIIGCKIMTINGKC------------------LGR
RIMM_BLOPB      IDET-------QFPCIND-DEYYWKDLIGCVVITVQGVL------------------LGD
RIMM_PSYIN      VDSD-------KLPNL-E-EDFYWRDLIGCQVKTDNGYD------------------LGV
RIMM_COLP3      TNEA-------ALPELSE-DDFYWRDLIGMSVVTNKGYD------------------LGV
RIMM_IDILO      ITAD-------ELPALAD-DEFYWRDLIGMRVVNTNGYD------------------MGV
RIMM_SHEAM      ILAE-------QMPELPE-DEFYWRDLIGCEVLNTKGYN------------------LGK
RIMM_PSEA6      IKAQ-------QLPQLDG-DEFYWRELVGMQVVTEQGYN------------------LGV
RIMM_HYDCU      ILPE-------QLPATEE--GFYWMQLIGCQVTSVEGED------------------LGQ
RIMM_XYLFT      VPRS-------ALPPPHP-DEYYWVDLEGLQVHTLEGVV------------------LGS
RIMM_ALKEH      VPRR-------DLPELPE-GQYYWADLEGLAAYTTGGEP------------------LGR
RIMM_METCA      VRRS-------QLPPPAP-GEYYRVDLVGLKVVNLGETV------------------LGE
RIMM_ALCBS      VPAD-------LLPQSGQ-GEYYWRDLIGLRVKHVNGMD------------------LGS
RIMM_NITOC      VHRD-------QLPPPQE-GEYYWSDLIGLQVITLQGEV------------------LGQ
RIMM_CHRSD      LPKQ-------ALPALAP-GDYYWYQLEGLRVETLDGEC------------------LGQ
RIMM_MARHV      VPTE-------QLPELPE-GEFYWHQLEGLDVFTVEGEC------------------LGK
RIMM_HAHCH      IESS-------ELPALEE-GEYYWRQLEGLTVFTSEGVN------------------IGR
RIMM_MARMS      IDAA-------ELPELEE-GDYYWSQLEGLRVITKEGVL------------------LGK
RIMM_CELJU      VERD-------LLPELED-GEYYWNQLEGLSVFTVFGGE----------------QRLGV
RIMM_SACD2      IDKS-------LLPELDD-DDFYWHQLEGLRVVTIYEGNT---------------QDLGV
RIMM_PSEF5      VPRS-------LFPELTD-GEYYWYQLQGLKVIDGLGQL------------------LGK
RIMM_LEGPH      VQES-------QLAALAP-GEYYWYQLIGMSVINSKGDL------------------FGK
RIMM_RUTMC      IKKS-------QLPQLKS-GEYYWDDLIGLEVINKAKII------------------LGK
RIMM_DICNV      VTRA-------DLPQLKN-GQYYWTDVLGLTVINRSGEH------------------LGK
RIMM_METFK      VYRD-------ELPEPEE-GEYYWSDLIGLQVRNQQEV------------------DFGQ
RIMM_THIDA      VAKS-------ALPPPEE-NEFYWSDLIGLTVMNREGV------------------ELGK
RIMM_CHRVO      IPRS-------ELPEAGD-GEYYWADLIGLSVVNQQGE------------------TLGK
RIMM_NEIG1      IPRE-------AFAPTEE-DEYYWADLVGMTVVNKDDT------------------VLGK
RIMM_NITMU      IPRRLLP----ALPESGE-EGYYWSDLIGLAVINLQGE------------------VLGK
RIMM_NITEC      VPRSQLP----QLSEDGK-EGYYWSDLIGISVVNTQGE------------------FIGT
RIMM_AROAE      APRE-------ALPKPDV-DEYYWGDLIGLAVVNQADE------------------ALGT
RIMM_DECAR      APRE-------ALPTTEK-NEFYWTDLIGLDVINTADE------------------RIGK
RIMM_ACIAD      VAKS-------QLPKTDV-DEYYWSDLKGLTVLGLDEEEQE--------------VNLGQ
RIMM_PSYWF      IDKD-------SLPSTEE-DEYYWSDLVGLSVINKQDE------------------CLGT
RIMM_COXBR      IERR-------ALGALKE-GDYYWTDLIGLAVVNTHGI------------------ELGT
RIMM_FRAP2      VPKE-------ALPKVGN-DEAYFTDLIGCTIVNTAND------------------SFGK
RIMM_ROSS1      IREC-------DAAPLDQ-DEYFIHQLYGLRVIESGGGE------------------IGV
RIMM_CHLAA      IAAA-------DAAPLAA-DEFFYHDVIGMQAVTDSGED------------------IGE
RIMM_HERA2      IHRS-------DAAPLAN-DEYFLHDLVGLQVQTEAGED------------------IGR
RIMM_MYXXD      VFRE-------DLEPPAE-GEFFQGDLVGLDAVDANGNA------------------LGR
RIMM_RUBXD      LDRS-------ELDAPEE-DEFYVADLVGLEAVDERGGA------------------LGE
RIMM_NITWN      VARDK------LPE-TD-EGEFYHADLIGLAAF----DAAG--------------TALGT
RIMM_AZOC5      VPRDA------LPA-AEDEDTFYHADLMGLRVE----DQSG--------------ALLGT
RIMM_METS4      VPRDR------LGA-PEDEDEFFTADLVGLAAV----DAAG--------------TRLGT
RIMM_CAUVC      VPRSA------LPE-PD-DDEFYLTDLVGLTVRHIQTDQ-----------------LLGR
RIMM_BEII9      VSREA------LPP-PE-EEEFYLADLIGLDAFVADADGKE--------------VLFGR
RIMM_GRABC      INRDA------LPP-VEDEDDFYLVDLIGLEARLVA---DE--------------TLLGQ
RIMM_GLUDA      VARTS------LPE-P-DQDEFYFTDLIGMDVRAQG---TD--------------APLGR
RIMM_ACICJ      VRRAD------LPP-PEDEDEFYFADLIGLHAVGP----DG--------------AALGT
RIMM_JANSC      APRSA------LPS--LPDDEFYHADLVGLTVLDTG----G--------------EVIGT
RIMM_ROSDO      ALRDQ------LPS--LPDDEYYYTDLIGLQVLDTG----G--------------ELLGS
RIMM_RHORT      LDRAA------LPADALEEDEYYHADLIGLPVDLVD----G--------------GRLGV
RIMM_MAGSA      VARER------LPRLAEDE--FLYSDLIGLVAEGVD----G--------------KRLGI
RIMM_PARL1      VPRER------LPRASGDEEGWYYADLIGLRAVGLD----G--------------RDYGR
RIMM_MARMM      VLRSA------LPE--LEEDEFYHSDLLGLKVQGLD----G--------------APMGT
RIMM_HYPNA      ASRDQ------LPE--ADEDEFYFEDLIGMPVYTVG----E--------------EPEAR
RIMM_SPHAL      VPRSA------LPP--LGPGEYYHHDLIGLPCVSTE----G--------------APVGH
RIMM_NOVAD      VRRSE------LPS--LPEGEYYHADLIGLPAVSTE----G--------------EMLGE
RIMM_ZYMMO      VPRKA------LPD--LPADEYYYIDLIGLPCVDPS----G--------------QSIGV
RIMM_RHILO      VDRSM------LPDD-GEEDEFYHADLVGLEVRDDT----G--------------TALGK
RIMM_CHESB      VDRSA------LPEK-LEEEEFYYADLIGMAVLDEK----G--------------ENLGR
RIMM_OCHA4      IDRSQ------LPDDELDEDEFFQTDLIGLLAVDAE----G--------------KTYGV
RIMM_BARBK      IERDQ------FADD-LDTDEFYQIDLIGLRVYDNT----N--------------QLLGE
RIMM_ANAMM      VSRSS------LPRLQ--EDEFYENELIGMDAKLED----G--------------TAYGV
RIMM_ANAPZ      VSSSC------LPKLK--NDEFYKDELIGLSVKLPD----D--------------TIFGI
RIMM_WOLTR      VERNK------LLKLND-ENEFYQSDLVNMEIRLEN----D--------------ELYGY
RIMM_EHRRW      IEKTK------LPNLI--ENEFYHSDLVGLQVILED----N--------------NIFGT
RIMM_RICBR      CLRSS------LPKLE--EDEFYITDLNNLPILDNN----H--------------TEIGK
RIMM_ORITB      IYKHE------LPQLP--DSEYYVANLNGIKVKNLE----G--------------EIIGK
RIMM_DEIRA      ATDAE------LPD--LEEGTFYYHDLRGLEVYGAGG------------------ERLGT
RIMM_THET8      AEVAD------LPP--LEEGRYYYFALIGLPVYVEG-------------------RQVGE
RIMM_HUNT2      IDRKD--------AVKLPKDTFFICDLIGMNVFDTEE------------------KKLGV
RIMM_CALS8      IERER--------AKKLPEDTYFICDIIGLEVYDLDG------------------RKLGK
RIMM_CLOD6      VSRED--------SRELEEGEFFIADMIGMEVLTVDG------------------KYVGI
RIMM_CLONN      VSREN--------AATLDEDCYYEADIVGCTVYDENE------------------KQLGN
RIMM_CLOTE      VKRED--------AVELPEGRYYVADIIGCKVLDEDG------------------NYLGK
RIMM_CLOBL      IKREN--------SVKLPKGSYFIADLIECRVIDENG------------------REIGQ
RIMM_CLOPS      IERED--------AIELEEDEYFIVDLVGCTVVDTEG------------------FEYGK
RIMM_CLOB8      IPREN--------EPELPPDTYYVSDLKECTIYDTNE------------------KEIGR
RIMM_CLOAB      VLRED--------AVELKEGQYFIKDIIGCNVFDEND------------------KDLGE
RIMM_ALKOO      IDESQ--------RRILPEDTYYIADIIGLDVFTVKD------------------EYIGK
RIMM_FINM2      IDEKD--------RYELKDGSFYIDDLIGLKAY-FNG------------------EYIGD
RIMM_CALS4      VDAEN--------ALKLEEDEYFITDLIGMKVYTEEG------------------ELIGT
RIMM_DESHY      ADRDQ--------VPPLKEGWYYF-ELEGMQVYEGD-------------------VLLGT
RIMM_MOOTA      VEPWE--------VEPLPEGHYYIYQLLGSRVYTTGG------------------EFLGI
RIMM_HELMI      IPVEE--------VPAPEPDSYYHFQLEGLSVFTEAG------------------ERLGQ
RIMM_PELTS      VGRDE--------LVPLPEDRFYIFDIIGLKVYDTGG------------------RNLGR
RIMM_CARHZ      IPKNE--------IVQLKENEFYLFQLKGLTVYDLNY------------------QKIGV
RIMM_SYNWW      IDESE--------LYPLPEGYFYHFQLQGLSVYDEEK------------------GLLGE
RIMM_SYMTH      VPREE--------VHPLPEGYYYDFDIIGIEVVDPDG------------------RQLGR
RIMM_DEHM1      IPAAA--------LKKLPKGVYYDFQLIGLEVTDLSG------------------NRIGQ
RIMM_CHLTE      VTRDA--------LVAMPDDRAYIHELIGLDVFDETE------------------GRVGK
RIMM_CHLPB      VRSDA--------LIQLPPDRAYLHELRGLKVLNERH------------------EELGI
RIMM_CHLPD      VEEKE--------LARQPTGRAYLHELIGMKVLDGNR------------------YEAGV
RIMM_CHLCH      ITEEE--------LAPQPENHVYRHEIVGMRVVDGNG------------------KLFGT
RIMM_GEOLS      LQREQ--------LPPPDADEYYWHDLLGLSVVTNEG------------------QALGI
RIMM_PELPD      LRRDQ--------LPEPEEDEYYWCDLIGLEVATVEG------------------MALGV
RIMM_GEOUR      ALREQ--------LPELPEDEYYWCDLLGLQVVTEEG------------------ESLGE
RIMM_GEOSL      AHRDQ--------FPPLEEGEYYWCDLIGLQVVTAAG------------------TVIGR
RIMM_SYNFM      LPEDR--------LPPVSEGEYYHYRLIGLDIVTLDG------------------ESLGV
RIMM_SYNAS      IPEDD--------RAALSGDEYYWRDLMGLQVVTEEG------------------RFLGR
RIMM_PARD8      YPLDA------VDEEDLVGDM-TWDSFIGYTVTDVQK------------------GYLGE
RIMM_BACV8      FPKKY------VGEEEDSDDIPTWNYFIGFKVEDVNH------------------GELGE
RIMM_PORGI      MERRY------FDTDSI---EFTWEHFIGFTVFDREG------------------CFVGT
RIMM_GRAFK      LPLSM------LPKLPE--DKFYFHEIIGFNVIDAEH------------------GNIGK
RIMM_CYTH3      IPVSK------MAEADE--SRLSYQAIIGFEVMDTIQ------------------GKLGV
RIMM_NOSP7      VPAS--------DRPQLAEDEYHVLDLIGLEVFM--QASGE---------------LVGT
RIMM_MICAN      ANKL--------EKPRLKADEYHVSELVNLEVYH--HLTGE---------------KIGV
RIMM_CROS5      IMDQ--------ELPELEEEEYHVSQLINVQVYH--HKTGE---------------LLGT
RIMM_PROMA      IDSS--------HRPTLAPGEFHLLDLLGLKVRL--KNDHR---------------EIGE
RIMM_PROMT      IPID--------SRPMLSKDEYHYHDLIGLEARR--GPSKA---------------LIGY
RIMM_TRIEI      IEKG--------DRPQLEADEFYVPDLIGLTVIN--QLNGK---------------TIGK
RIMM_SYNR3      VAAD--------DIPELEDGEFHVRDLQGLSVRL--DTESD---------------PIGV
RIMM_SYNY3      VPAT--------DRLPLEPGEFHVTDLLGLIVYD--HDNGD---------------RLGI
RIMM_SYNP2      VRAG--------DRPELEADEYHVSDLIGLEVFD--YNTQA---------------KLGI
RIMM_GLOVI      IGAA--------ERPVLAAGEFWLPDLMGVRVFR--QDTGE---------------AIGE
RIMM_THEEB      VPAS--------DRPPLAANEYHLMDLIGLAVYH--QGER-----------------VGE
RIMM_ACAM1      VRSN--------DRPTLAEGEYYLSDLIGVTVVD--HQTQA---------------VVGS
RIMM_SYNJA      VPAS--------QRLPLEPEEYHYSDLIGLAVYH--QGRL-----------------LGH
RIMM_PROMP      VKVD--------AIPKLSHGEYHLTELINLNVKISENNQLH---------------IIGK
RIMM_CORDI      AAPL----------DDDVDDGFYDHELEGLAVIH---------------GEE----KIGE
RIMM_CORU7      AAPL----------HDDSDDGYYDHELIGLRVLNVGSVDADTANRRAYEGEQPEPVDIGE
RIMM_SALTO      VDRA------DVAP-PTDPEEFHDHQLVGLAVVTSAG------------------ERLGE
RIMM_NOCSJ      ATVP------ADAA-PDDPDEYYDHQLVGLAAYDVSG------------------AALGS
RIMM_KINRD      VDLD------DEAD-PDD-DAWYPHQLQGLAAVTTTG------------------TPLGT
RIMM_THEFY      VDSA------ELPP-LDDPDEFHDHELIGLRVETVDG------------------EAVGE
RIMM_STRAW      AEVD------PDEV-PEDPDEYYDHQLMDLDVVTKDG------------------TEVGR
RIMM_SACEN      VTAD------ELES-TDDPDEFHDHQLEGLRVVFPAG------------------EEAGV
RIMM_RHOJR      IDSA------ELEP-SDDPDEFYDHELEGLSVRLADG------------------TEVGT
RIMM_RENSM      FETD------SVASDESESDSWYEHELIGLEARVGD-------------------QTVGK
RIMM_FRASN      IDSDECGPAVDPDDEDDDGELWWDRDLVGLHARTPAG------------------DVLGE
RIMM_CUTAK      VD-------VEPNDDPDDPDEFWDRRLRGLTVVDESG------------------KSRGA
RIMM_ACIC1      AE-------VDERVRPEDPEEYYDYQLIGMRVETVTG------------------QEIGV
RIMM_LEIXX      VNQD-------VRELPDEEDAWYDNQLVGLSA-HRDG------------------AVVGA
RIMM_DESVV      VPED--------TLPELDEDEVYLFELEGISVVIDESGE-----------------HLGV
RIMM_DESAG      IPHA--------ELPELEDDEVYIEDILGFTVVLDEDGS-----------------TLGT
RIMM_LAWIP      VSRS--------FLPEIESNESYLCDLLGFSVVLDNTDE-----------------VIGK
RIMM_NITSB      SDEET-----TKKSFPLGEDEYFWFDILGCDVFEEGK-------------------RLGK
RIMM_SULNB      ADEAQ-----TKEQCPLEEGQHFWFNVIGCTVNQGDE-------------------LLGV
RIMM_SULDN      TTIER-----TRKECRLEKDEYFWFDIEGCSVVEDGK-------------------VLGI
RIMM_ARCB4      ATIEQ-----TKENCKLAKNEFFWFDLISCEVFENNL-------------------KLGT
RIMM_CAMJ8      QSIEK-----SRQTCKLKKDEFFYFDILECEVFEEDK-------------------RLGK
RIMM_CAMHC      QSKEI-----TKKTCKLGKDEFFYFEILGLEVFENEE-------------------KLGK
RIMM_CAMFF      RSIND-----TIRDCKLAKDEFFYFDIIGCNVFEDKI-------------------LLGE
RIMM_CAMC5      TTKEL-----TRKNCKLKEGEFFYFDVLGLNIVENGE-------------------ILGV
RIMM_HELAH      MSETE-----SKKLCVLKEGEFFYCDLIGLSVVEENE-------------------ILGK
RIMM_TREDE      IPRD--------KAAPLDEGEVYVHDLCNCNLVCEGT-------------------LVGK
RIMM_TREPA      VPRA--------EACPLSAGEFYLADLCRCELVFEGS-------------------AVGV
RIMM_LACP7      ISRENAV-------DLAE-GEFFIFDLIGLQAEE-E-----------------DGNSLGE
RIMM_OENOB      INERKEP-------RLSE-GEFLVSQIIGLKVID-E-----------------KGNSIGE
RIMM_LACDB      ISEEDQG-------ELPD-GVYYYRELLGCKVLDDE-----------------SGEEIGE
RIMM_LACJO      VAETDQQ-------ELPE-GSYYFKDILNCPVYDAE-----------------TGEKLGV
RIMM_ENTFA      VAKDNLA-------ELAE-DEFYYHQIIGATVYDE------------------TGSELGK
RIMM_OCEIH      IDEDQLT-------DLEE-DAYYYHEIVGCKVVTS------------------EGEELGK
RIMM_PEDPA      VEEDQLQ-------DLEE-GEFYLHQIIGLDVIEN-------------------DQKIGT
RIMM_LACPL      VPAEALH-------ALPA-GEYYYHQIVGLQVVTT------------------ADEPLGT
RIMM_LACRD      VSADDQQ-------PLDD-GQYYYHQIIGLDVETT------------------DGRHLGK
RIMM_LACS1      ISEEQQE-------NLSD-GNYYHHQIIGLDVFSE------------------DNNYIGV
RIMM_LACP3      VTETALQ-------PLDE-GSYYYKDIIGLTVIDE------------------QGQTLGK
RIMM_LACSS      IAASERDD------QLED-DEYYYGDIIGLEVIEES-----------------DGTSYGK
RIMM_LEUMM      IEGTARP-------ELED-DQYYYDEIIDSTVVDL------------------DGNKIGV
RIMM_LYSSC      VTKDQMTD------DLLEENEFFFHEIIGCTVVSE------------------EGETIGV
RIMM_STAS1      QERDHEEI------ELGE-HEFYYSDIIGCTVFDD------------------DDTPIGR
RIMM_THEP1      IKYEE-------LPKLSE-DEYYFYEILDCDVFYESG------------------ENVGK
RIMM_PETMO      IDKKD-------LPSLNS-EEYYWYEILDSEVYYEDG------------------EYVGK
RIMM_THEM4      IEKSR-------LPILSS-DEYYFYEVIGMKVYDEKG------------------IFLGN
RIMM_FERNB      LDKSF-------FPKSKD-GEYYFFEILNAEVYDNAG------------------EFIGI
RIMM_PSELT      VRVTD-------LPKPKSPNEYYYYELLNVEVLDQSG------------------NFIGR
RIMM_BUCAP      IDKSI-------LPILKE-DEYYWNDVIDCKVFNSRK------------------EYLGK
RIMM_BUCAI      ISKHT-------LPALKK-NDYYWNDIINYKVFNIDQ------------------HYLGT
RIMM_BUCBP      INQKT-------LPKLNN-NEYYWKDIVDCTVFDTNF------------------IKLGR
RIMM_BUCCC      IKNFQ-------LPKLKN-KEYYWNDIFSCYIFDLKK------------------KKIGS
RIMM_PELCD      VRRDD--------VPGLPAGEYYWFQLKGMTAVDRRL------------------GALGC
RIMM_ANADF      ALRED--------LPEAGEARHYWADLEGLPVVTVAG------------------AAIGT
RIMM_BIFAA      GEADD-------PEEMLEADEWYPKDLISLEARLAEGNTLGLA----------PGTVVGK
RIMM_SORC5      VPRDA--------FAPLSEGEFYACDVEGARVMTPDG------------------DLLGH
RIMM_MAGMM      VPRSMLP-----DGGDDPGVDGIWADLIGCQVVEVDG------------------TELGR
RIMM_AQUAE      LPKEE--------LPELGEEEYYAYELVGMEVETDKG------------------KKLGK
RIMM_ACHLI      TDEEP---------LDLESDAFHLPKLIGLKVYDQHN------------------YLIGT
RIMM_BORBU      VDDSL--------ASSLKEGEYYLGKLIGYAIVNNNK-------------------KLGE
RIMM_SALRD      ATEAA---------LGLEDDELFADDLVGWTVVTEEG------------------AVQGT
RIMM_FUSNN      VRRDI---------VGIGEDEYLVSDMIGFKVYDVKGD-----------------EYLGE
RIMM_SULSY      VPEDL--------LPKLGEDEFYEFQLIGMDVYYNDK-------------------LIGK
RIMM_NEOSM      LSESL--------LPPLQVGEYYCKDLVGLAVYDLEE-------------------CVGH
RIMM_SOLUE      IPASQ--------RISLDEGEYFESDLIGCEVVDRQSG-----------------QSLGK
RIMM_KORVE      IPRQD--------RAQLEEGATYVSDLVGCELFEIHGSE---------------ARKVGV
RIMM_LEPIC      LPQKL-------LPKIETKNEFYITDLIGLQAIDESGK-----------------KLDWK
RIMM_AMOA5      LSQEI--------LDKLVVQEEPYIDIIGYQVTDKYQ------------------GELGI
RIMM_BDEBA      IDDEL--------MVSKPGETIFLSEIKNFKLKNPEQ------------------TVLGE
RIMM_MESFL      YLNDN-------------DAFSIFYDLTYYSVVYNKQ--------------------NGK
                                          .                                 

RIMM_VEREI      VRELRATGA-QTLLVL---AHEQD-------------------------GKA--GKRMIP
RIMM_POLSJ      VRDLMTTGP-HSVLCVEYTAQQED-------------------------GTAVTAERMIP
RIMM_LEPCP      VTDLIDTGP-HSVLRLGYPSVDDK-------------------------GAPVEGERLIP
RIMM_METPP      VADLLDTGA-HSVLRVTQVETDDQ-------------------------GRSLERERLIP
RIMM_JANMA      VSDMMDNGA-HPILRVAVPQAAETT-----------------------DPKAAPQELLIP
RIMM_PARP8      VADLIDNGA-QSVLRIEYPAIGK-------------------------DGKPVIGERLIP
RIMM_RALSO      VAGLIDNGA-HQILRIVD---------------------------------EGGTERLVP
RIMM_BORA1      VEEVFDNPA-HAILRVVCQDAEGKALL---------------------DAKGRAREMLVP
RIMM_POLAQ      VIDVTENGA-HGVIAIGDISTKTI-------------------------------QYLVP
RIMM_ECOLI      VVDMMETGS-NDVLVIKANLKDAF----------------------------GIKERLVP
RIMM_BAUCH      VIDLIETGS-NDVMVVQANQQHST----------------------------KINELLIP
RIMM_BLOFL      VISIIDTKA-HDILVVRSEEYGFT----------------------------KYVDCLIP
RIMM_BLOPB      IISIIETTA-NDVLVVKMCQNNLY----------------------------KIKNCLIP
RIMM_PSYIN      VTEIMETGS-NDVLVVKANSNDAF----------------------------GQKERLIP
RIMM_COLP3      VTDMMETGA-NDVLVVKANLKDGF----------------------------SKKERLIP
RIMM_IDILO      VEQIMPTAS-NDVLVVKANSNDGF----------------------------GKSERLIP
RIMM_SHEAM      VDQILETGS-NDVLMVKANAKDAF----------------------------GKTERMIP
RIMM_PSEA6      VKELFETGA-NDVMLIKANLKDAF----------------------------GQKERMVP
RIMM_HYDCU      VTEIVETGA-HDVLRVEKQSD--A----------------------------GLVSTLIP
RIMM_XYLFT      VSHLFSNGA-NDVIVIHGE-----------------------------------RERLIP
RIMM_ALKEH      VSHLFATGA-NDVLVLQGD-----------------------------------RERLVP
RIMM_METCA      VVDVMETGA-NDVLVVQGD-----------------------------------RERLLP
RIMM_ALCBS      VTRMVETGA-NDVVVVRGDRNS-L----------------------------DRRERLIP
RIMM_NITOC      VDRLLETGA-NDVLVVRGE-----------------------------------RERLLP
RIMM_CHRSD      VNYLFETGA-NDVLVIRPSEAS-L----------------------------DERERLLP
RIMM_MARHV      VHHLLETGS-NDVLVVHATAGS-I----------------------------DQRERLIP
RIMM_HAHCH      VSHLIETGA-NDVLVVIGSAES-I----------------------------DKRERLIP
RIMM_MARMS      VSQLMETGA-NDVIVVRACEGS-F----------------------------DREERLIP
RIMM_CELJU      VTKLLETGA-NDVLVVQGDAQS-I----------------------------DQRERLIP
RIMM_SACD2      VSKVMATGA-NDVLEVKPDAQS-I----------------------------DDRDRLVP
RIMM_PSEF5      IDHLLETGS-NDVMVVKPCAGS-L----------------------------DDRERLLP
RIMM_LEGPH      VVEIMPTGS-NDVLVVEGE-----------------------------------KRHLIP
RIMM_RUTMC      VSNLVDTGS-NNVLVINGE-----------------------------------REHWVP
RIMM_DICNV      VCDIFETGA-NDVLVINKDG----------------------------------QEYLIP
RIMM_METFK      VVDVFATGA-NDVLVVKG-----------------------------------DRERLVP
RIMM_THIDA      VDSLMESGA-HDLLVVKG-----------------------------------RREHLIP
RIMM_CHRVO      VDSLLETGA-NDVLVVKGG---------------------------------DGQQRLIP
RIMM_NEIG1      VSNLMETGA-NDVLMIDGE---------------------------------HGQI-LIP
RIMM_NITMU      VAGLLETGA-NDVLQVQNP---------------------------------EETERLIP
RIMM_NITEC      VAGLFETGA-NDVLRIQLP---------------------------------GGKEELIP
RIMM_AROAE      VEALMSTGA-HDVLQVR-D---------------------------------GDDERLIP
RIMM_DECAR      VVGLIETGA-NSVLRVMGD---------------------------------DKVERLLP
RIMM_ACIAD      IHELFETGA-NDVMVVRATADS-V----------------------------DAEERMIP
RIMM_PSYWF      VKELFETGA-HPIMKVVPSQDS-I----------------------------DDEPRMIP
RIMM_COXBR      VDSLIETGS-NDVLVVRSK----------------------------------ERERLIP
RIMM_FRAP2      VIGIIETGA-NEVLVCKKD----------------------------------SDEYLIP
RIMM_ROSS1      VREVVQTGA-NDVIVVERQGRS---------------------------------DTLLP
RIMM_CHLAA      VRDILETGA-GEIVVITRRGRP---------------------------------DALVP
RIMM_HERA2      AVEIIETGA-NDVLVVRKLGQA---------------------------------DILVP
RIMM_MYXXD      VEEIWTTGE-VPNLVIRASGRE---------------------------------ELVVP
RIMM_RUBXD      VIETFPTPA-HEVLVVRGEGG----------------------------------LLYVP
RIMM_NITWN      VAAIHNFGA-GDIIEIA---------------------------------P-ARGPTLML
RIMM_AZOC5      VLAMHDFGA-GDVLEYT---------------------------------PEGGGRTLLL
RIMM_METS4      IRAVPNYGG-GDLLEIE---------------------------------PEGGGRPALL
RIMM_CAUVC      VKSVQNFGA-GDILEIT---------------------------------PDLGGPTWYL
RIMM_BEII9      IADVLNFGG-GDILEIA---------------------------------PSDGGETRLL
RIMM_GRABC      VAQVHDYGA-GASLEIT---------------------------------RSGGAS-LLV
RIMM_GLUDA      VLVVHDYGA-GVSLELG---------------------------------GQGHAP-LIL
RIMM_ACICJ      IRAVHDFGA-GASIELS---------------------------------DGS-----LL
RIMM_JANSC      VASVANHGA-GDILELS---------------------------------GPGLPSGLLI
RIMM_ROSDO      VKTVADHGA-GDILEVQ---------------------------------RPGTSETILL
RIMM_RHORT      VHSVHDFGA-GDMLEVT---------------------------------LAQGRRSVLL
RIMM_MAGSA      VKAVADYGA-GDVLDIK---------------------------------LEPKG-DMMV
RIMM_PARL1      IAGVENFGA-GDLLEIA---------------------------------PAEGGQTVLM
RIMM_MARMM      LKAVHNFGS-GDLLEITG--------------------------------TPDRNGSWML
RIMM_HYPNA      VRAVQNFGS-GDLLEIE---------------------------------IPGAPATIYV
RIMM_SPHAL      VAAVDNFGA-GDILEIE----------------------------------KPDGKRFMV
RIMM_NOVAD      CIAVENFGA-GDVIEIR----------------------------------KADGKKFMV
RIMM_ZYMMO      SVAVENYGA-GDILEIE----------------------------------KADEKRFMV
RIMM_RHILO      VVAVHNFGG-GDILDVT----------------------------------LAGRKGVLI
RIMM_CHESB      VVAVHNFGA-GDLLEFR----------------------------------ENSGPTVII
RIMM_OCHA4      VSALFDFGG-GDLIELS----------------------------------EKGKRPMLI
RIMM_BARBK      VSGFFNFGA-GDLLEVR----------------------------------LISHKTELI
RIMM_ANAMM      ISAILNFGS-CDIIELS---------------------------------TSTGKV-VMV
RIMM_ANAPZ      VTEVFNFGS-GDIVEIS---------------------------------TPQGKK-EMF
RIMM_WOLTR      IKSIYNFGS-GDILEIS---------------------------------VISTKKNIML
RIMM_EHRRW      IKKIYNFGS-CDIIEIL---------------------------------LYNSKKSTML
RIMM_RICBR      IKNILNFGA-GDIIEVE---------------------------------FLDKTT-ELL
RIMM_ORITB      INNICNYNA-GDIIEVV---------------------------------YNDGKK-IMY
RIMM_DEIRA      VSDVMDAGH-QDLLVVDY--------------------------------GG------GT
RIMM_THET8      VVDILDAGA-QDVLIIRG--------------------------------VGERLRDRAE
RIMM_HUNT2      LTDVLSTGS-NDVYVVKSD---------------------------------N-NKEILI
RIMM_CALS8      VKDVLQTGS-NDVYICQSY---------------------------------IGKKDLLI
RIMM_CLOD6      LEDVLQYSA-NDVYVVKGE---------------------------------E-DKEFMI
RIMM_CLONN      IDEIIHTGS-NDVYWIK------------------------------------GPNELLI
RIMM_CLOTE      VKEVIHTKN-NDVYWVE------------------------------------GKKELLI
RIMM_CLOBL      ISDVIKTGS-NDVYEVK------------------------------------GKSEVLV
RIMM_CLOPS      IKDVIQTPS-NDVYWVQ------------------------------------GKKEVLV
RIMM_CLOB8      IFDVISTPN-NDVYWIK------------------------------------EPKELLI
RIMM_CLOAB      VYDVISTKN-NDVYCIRK----------------------------------EGQQDILV
RIMM_ALKOO      VVDIIQTGS-SEVYVIRM----------------------------------NNLKEIMI
RIMM_FINM2      LVDVISIYS-NDVYVIK-----------------------------------NDEKEFMI
RIMM_CALS4      LEEVLQTGA-NDVYVVKAK---------------------------------E--REVLL
RIMM_DESHY      LAQVIQTGA-NDVYLVKGD---------------------------------K--GEICV
RIMM_MOOTA      LRDILATGA-NDVYVVRNE---------------------------------D-AGEILI
RIMM_HELMI      IEEILETGS-NDVYVVRQA---------------------------------SPPGEVLI
RIMM_PELTS      VTDVLQTGA-NDVYVVDTG-----------------------------------GKPLLI
RIMM_CARHZ      VRTVLKNPA-NDLLVIDTI---------------------------------H-DKELLL
RIMM_SYNWW      LTDIIETGA-NDVYVVDSP---------------------------------Q-YGEILI
RIMM_SYMTH      VVEVDHTSPVHDLYVVETA---------------------------------P-GKRYLV
RIMM_DEHM1      IKEILHMPS-NDIYVSSYG-----------------------------------AKEALI
RIMM_CHLTE      ISDVLQMPA-HDVYEVD-----------------------------------TGDRKVLI
RIMM_CHLPB      IEDVLGMPA-HDVYEIR-----------------------------------AEGGLVYV
RIMM_CHLPD      ISDILKMPA-HEVYEVQ-----------------------------------ANGRKILI
RIMM_CHLCH      VTDIFNMPA-HDVYEVQ-----------------------------------VEGKTVLL
RIMM_GEOLS      IKDILETGA-NDVYLVRDD---------------------------------ATKREYLI
RIMM_PELPD      LEEIFKAGS-SDIYVVR-----------------------------------GAGREYLI
RIMM_GEOUR      LVDIIVTGS-NDVYVVQ-----------------------------------GSGREILI
RIMM_GEOSL      LDSILPTES-HDVYVVR-----------------------------------GADREYLI
RIMM_SYNFM      LRKIIETGG-NDVYVAE-----------------------------------REGREILI
RIMM_SYNAS      IESIFPTGS-NDVYVCA-----------------------------------GGSREILL
RIMM_PARD8      ITDVDETTI-NVLLRVDH-----------------------------------KGEELLI
RIMM_BACV8      IVAVDDSTM-NVLFAIEK-----------------------------------GGEELLL
RIMM_PORGI      IDDVDESTL-NVLLSITTP----------------------------------EGKELLL
RIMM_GRAFK      IVSINDSTA-QALFEIEK-----------------------------------DGKQILI
RIMM_CYTH3      ISNFFQKTG-QDLLMMDY-----------------------------------QDAEILI
RIMM_NOSP7      VVDIIPA--GNDLLEVKLHP--------------------SFTTDKKQK-------TVLI
RIMM_MICAN      VVDIFWA--GNDILAVQLEA--------------------NLASVKKKSPSSDSEARALV
RIMM_CROS5      VIDLFTT--GHDLLEIQLIN--------------------NSEREAKKTK----ERKVLI
RIMM_PROMA      VTNLTSA--GNDLLEVRLLS----------------------------------GKKVLV
RIMM_PROMT      VTDLIKG--GNDLLEIELVE----------------------------------GKKVLV
RIMM_TRIEI      VINIIFA--GNDLLEVEKISTDTPVISEVVENNLPSKSKRSRDTKNQKKNQSPPSKKILI
RIMM_SYNR3      VVDLHHG--GNDLLEIELKAD---------------------------------GRRCLV
RIMM_SYNY3      VTDFYSA--GNDLLGITLDKNP--------------------------------DKEVLV
RIMM_SYNP2      VSDLYTA--AQDVLEVTDANQ----------------------------------KKHLV
RIMM_GLOVI      VSDMTRA--GNDLLVIRLSG----------------------------------GKTVMV
RIMM_THEEB      VVGLVNA--GNDLLEVQLLDPA-----------------------------PKAPQSVYI
RIMM_ACAM1      VVSLASA--GNDLLEIQL---------------------------------DNTTKTILL
RIMM_SYNJA      VSAIWAA--GQDVLEIATP----------------------------------DKRQVLI
RIMM_PROMP      VINLSNE--KNNLLVIQLLKN---------------------------------NKEVLI
RIMM_CORDI      VSGVIHGP-AQSLLEVTLES----------------------------------GKEVLI
RIMM_CORU7      VTGVSHGP-AGATLEVAVDADADLPTA---------------------------GSTILI
RIMM_SALTO      IARIDHAP-AADLLVLRRPGRR----------------------------------DVLI
RIMM_NOCSJ      VTGLVHGG-AQDLLTVRTPDGR----------------------------------DALV
RIMM_KINRD      VKDLLTGG-AQDVLVVTGTDGR----------------------------------EVLV
RIMM_THEFY      VVDVLHH--AQDMLVVSGEKGS----------------------------------EVLV
RIMM_STRAW      ITEISHLP-SQDLFVVERSDGS----------------------------------EVYI
RIMM_SACEN      VAEVVHTP-AGELLAVRTPDDR----------------------------------EVLV
RIMM_RHOJR      VIEVLHSA-AGELLSIRRAGDQS--------------------------------GELLV
RIMM_RENSM      VSALNPMP-AQDLLVITTAAGE----------------------------------EVLV
RIMM_FRASN      VVDVIHSP-GGEILAIGRPEGG----------------------------------EYLV
RIMM_CUTAK      VKDVLHMP-AQDVLVIDVS-GE----------------------------------EHLV
RIMM_ACIC1      VREVLHLP-GQDVLAIERSADG----------------------------------DAFV
RIMM_LEIXX      IVRVDHLP-GQDLLAIKTPGGE-----------------------------------VLV
RIMM_DESVV      IERIDTDA-YQEIWVIRTPQGK----------------------------------EVLF
RIMM_DESAG      LTAFSAPTPEQEVWEITTPDGK----------------------------------EVLF
RIMM_LAWIP      LEYVSFPG-GQELWSIITPEGK----------------------------------EVLL
RIMM_NITSB      VVDIQRLPAGDYLLVETDKSFVDMK---------------------------KAKSFLIP
RIMM_SULNB      VDDIQRLADVDYLSIKTDKALVDTG---------------------------LPKNFLVP
RIMM_SULDN      VDELDRMGITNYLCVITDETLVKSG---------------------------FAKSFLIP
RIMM_ARCB4      VKEIHRYPLNDYLEIITDSELVKKA---------------------------LPKNFLIP
RIMM_CAMJ8      VIDILETGASYLFEIQSDEKWVEKK---------------------------YPKIFFIP
RIMM_CAMHC      VADIFEAG-NFVFEIATDEKLIKKG---------------------------FPKIFYLP
RIMM_CAMFF      VIDILEVGAGFLFSIKTEGDLVKAG---------------------------LNSNFYIP
RIMM_CAMC5      VKDIEDNLNNALLYVKTSDDLVSIG---------------------------FAKNFYVP
RIMM_HELAH      VIEIQRISHIDYFMVETTLNLVEKG---------------------------LAKIFLIP
RIMM_TREDE      ITSVAEGGGGYLLEIAGKTSEAAA-----------------------------ESSFYVP
RIMM_TREPA      VLSVVEGGGSSLLEVQRTHGGVC----------------------------------YVP
RIMM_LACP7      LTEVLQTGA-NDVFVIKTKQ----------------------------------GKEILI
RIMM_OENOB      IADSFHTGA-NDVWTIKKSN----------------------------------GKEILI
RIMM_LACDB      LTDIEAPGA-NDIWEVTDKN----------------------------------GKSFWL
RIMM_LACJO      LENIETPGA-NDIWEIKPEK----------------------------------GKSFWI
RIMM_ENTFA      IKEILSPGA-NDVWVVQRPK----------------------------------KKDLLL
RIMM_OCEIH      VKEILSPGA-NDVWVVQRMN----------------------------------AKDLLI
RIMM_PEDPA      IKEVLSYGP-NDVWVVKRPN----------------------------------QNDLLL
RIMM_LACPL      IKEILSPGA-NDVWVVKRDHG---------------------------------QSDVLL
RIMM_LACRD      IKEILSPGA-NDVWVVERPE----------------------------------KRDLLL
RIMM_LACS1      IKEIMSPGA-NDVWVVKRKG----------------------------------SSDLLL
RIMM_LACP3      VNEILSPGP-NDVWVIPRSG----------------------------------KSDILL
RIMM_LACSS      VSEIIDPGP-NDVWVIKRRG----------------------------------RSDLLL
RIMM_LEUMM      VKEIMETGA-NDVWIVQRDG----------------------------------QSDALI
RIMM_LYSSC      VNDILQTGA-NDVWVVK--GS---------------------------------KKEHYI
RIMM_STAS1      VTEIFETGA-NDVWVVK--GD---------------------------------K-EYLI
RIMM_THEP1      VVDIIETGS-NDVLVVRKKK-----------------------------------KETLI
RIMM_PETMO      VEEIIQTGA-NDVISIKNLED---------------------------------DKEVLI
RIMM_THEM4      IDEVIQTGS-NDVFVINKDT----------------------------------KDEILI
RIMM_FERNB      VEDIIETGN-NDVIVVKKE-----------------------------------KEEVLI
RIMM_PSELT      VEDIIQTGS-NEVAVVKNGS-----------------------------------FEMLI
RIMM_BUCAP      VINLIRNQN-NDVLIIR-NNLKKNN-----------------------------FKKIMI
RIMM_BUCAI      VINLIRTRN-NDILIVK-NKLKIH------------------------------QKNILI
RIMM_BUCBP      VSELIRTPS-NDILVVKASNIKNIS-----------------------------QNDMLI
RIMM_BUCCC      IKNIIDNKF-YCTLEIL------YK-----------------------------KKKIYI
RIMM_PELCD      LEDIFTTAA-HDIYVINGD-----------------------------------YGEVLV
RIMM_ANADF      VTGLYETGGVDVLVVTTE-------------------------------------EGGEK
RIMM_BIFAA      VVDVIEVAQWLLKIRLANPVKDADG--------------------------VVVENSALV
RIMM_SORC5      VRSLQSYPT-CDVLVVERQG----------------------------------ADSIEV
RIMM_MAGMM      VVEMMATGA-NDVLIVRGGP----------------------------------EGEKLL
RIMM_AQUAE      VERVQDMGPYDALVLDK--------------------------------------ENLLV
RIMM_ACHLI      VLELVDVPQGYLLRILRDDN----------------------------------GKTVLI
RIMM_BORBU      VVAFFEYLN-SVFLEVRVGI-----------------------------------KFFFI
RIMM_SALRD      VADFMEMPA-QDLFVVRTPE----------------------------------DTEAMI
RIMM_FUSNN      ITEIMDTAA-HDIYVIESE-----------------------------------EFETMI
RIMM_SULSY      VEKIDDRLSQAYLIIKCTD-----------------------------------EKTRHL
RIMM_NEOSM      VSMLYDFGAAAEVLEIVLLS----------------------------------GKKVMI
RIMM_SOLUE      VSAWDDGGG-SGLLVVG---------------------------------------DLLI
RIMM_KORVE      VADVDFSAGEAPLLVVKGD------------------------------------REHLI
RIMM_LEPIC      LKDVQDNPAHPILVFVKEN-----------------------------------GEEILI
RIMM_AMOA5      IKDIEQFPL-HVCLVVDYL-----------------------------------DKELLI
RIMM_BDEBA      IVGFSSNGV-QDLLVVETTD----------------------------------GKTAEV
RIMM_MESFL      VIETMFNGNHDLVKVLLENE----------------------------------EKAFWV
                                                                            

RIMM_VEREI      FVP-AFVDQVELPQKR-------IIVDWQPDY----------------------------
RIMM_POLSJ      FVS-AYIDTVDIAGKC-------ITVDWQPDY----------------------------
RIMM_LEPCP      FVA-AYIDSVQLDQKR-------IVADWGLDY----------------------------
RIMM_METPP      FVA-AYIDAVSLEQRC-------ITVDWGLDF----------------------------
RIMM_JANMA      FVE-QFVITVDRTAKK-------ITVDWGLDY----------------------------
RIMM_PARP8      FVG-VYVKTVDQAAKK-------IIVDWEADY----------------------------
RIMM_RALSO      FVE-VYVKSVDVAGKH-------IVVDWGLDY----------------------------
RIMM_BORA1      FVS-AHIQAVDIAARR-------IDSDWPLED----------------------------
RIMM_POLAQ      FVK-EVVRNVDLPNKL-------LTLDWQSDWV---------------------------
RIMM_ECOLI      FLDGQVIKKVDLTTRS-------IEVDWDPGF----------------------------
RIMM_BAUCH      FIYGQVIKNVDLATHI-------IKVDWDPEF----------------------------
RIMM_BLOFL      FILKKIIKDVDLIKNI-------VVVDWEIYKF---------------------------
RIMM_BLOPB      FLIKRVIKNINLVTRT-------VTVDWDPNF----------------------------
RIMM_PSYIN      FIDKQVISNVDITSKL-------IQVNWEPDF----------------------------
RIMM_COLP3      YLFEQVIESVSIENKQ-------ICVDWDPGF----------------------------
RIMM_IDILO      FIQSEYVTAVDKEAKQ-------IQVEWPSDF----------------------------
RIMM_SHEAM      YLPDQFVLEVKLSEKQ-------IIVDWDPDF----------------------------
RIMM_PSEA6      YLIDQVVKKVDREAKT-------IQVDWDPSF----------------------------
RIMM_HYDCU      FVMETFILDVDVESKQ-------IQVDWQLEDATES------------------------
RIMM_XYLFT      FVQPDYVKSVDFEAER-------IVVDWDPEF----------------------------
RIMM_ALKEH      FVYGQTVRRVDLTAGR-------IELDWDPDF----------------------------
RIMM_METCA      FVQGVFVKSVNLEESR-------IVVDWDPGF----------------------------
RIMM_ALCBS      WLPEDVITAISLEDGE-------MTVDWDPDF----------------------------
RIMM_NITOC      FLMGMIVKQVDLQQGL-------LTVDWDPDF----------------------------
RIMM_CHRSD      FLPDDVIRQVDLDAGR-------MIVDWDPEF----------------------------
RIMM_MARHV      YLPDQVVQQVDLKGSR-------MVVDWDPEF----------------------------
RIMM_HAHCH      YLPGQFIENIDLDKNL-------MVVDWDPDF----------------------------
RIMM_MARMS      YAPGTYVLNIDLEQQE-------MVVDWDPEF----------------------------
RIMM_CELJU      YVPGQFVLSVDLDSKR-------ILVDWDPEF----------------------------
RIMM_SACD2      YVLDLYVKKVDLSAEC-------ITVDWDPEF----------------------------
RIMM_PSEF5      Y-TEQCVLAVDLAAGE-------MKVEWDADF----------------------------
RIMM_LEGPH      YLPGQFVINVDESQQV-------ITVDWDMNF----------------------------
RIMM_RUTMC      YIS-PFLIKVDIDNQI-------ILVDWDENF----------------------------
RIMM_DICNV      FISERYIDRIDFENKY-------LYVDWQMAWTDDAD-----------------------
RIMM_METFK      FIG-QVVLEVDTDGKT-------MLVDWDPEF----------------------------
RIMM_THIDA      FVA-AFVGKVDLAGGT-------VEVDWGEDY----------------------------
RIMM_CHRVO      FVD-QYVLEVVPAEGR-------ILVDWGLDY----------------------------
RIMM_NEIG1      FVS-QYIETVDTGSKT-------ITADWGLDY----------------------------
RIMM_NITMU      FID-QVIIKVDLAAGR-------ITVDWGLDY----------------------------
RIMM_NITEC      FVD-QVVRQVDMRSRQ-------IMVDWELDY----------------------------
RIMM_AROAE      FVA-AYVLDVDLAART-------IRVDWQKDW----------------------------
RIMM_DECAR      FVS-AVVLAVEKEAGQ-------IRVEWGSDW----------------------------
RIMM_ACIAD      WHK-DVVQRVDLEAGR-------IYVNWGVDY----------------------------
RIMM_PSYWF      WHK-QTVDVVDLAAGR-------MVVDWERDF----------------------------
RIMM_COXBR      YTS-YTIQSIDLEKKI-------IVVEWDADF----------------------------
RIMM_FRAP2      YVK-QYIVSEDLDLKK-------IVVDWEYDY----------------------------
RIMM_ROSS1      MIH-DVVERLDVAAGQ-------IVVRLLPGLIDDDNQEG--------------------
RIMM_CHLAA      MVR-DFIVAIDVGERR-------LVIRPIAGLLD--------------------------
RIMM_HERA2      MVR-TVVRSIDIAGGT-------ITVTSLADIVPE-------------------------
RIMM_MYXXD      FAD-EFVPTVDLEARR-------IVIHPPEYVEAGRKGAESGGGPEDAE-----------
RIMM_RUBXD      FTR-EHVPEVDPRAGR-------AVVRPPEE-----------------------------
RIMM_NITWN      PFTDAVVPIVDIAGGR-------VVIEAPAE---IDGEEPNSV-----------------
RIMM_AZOC5      PFTKAAVPVVDVPGGR-------IVVVPDTN---PDETPPEDADQA--------------
RIMM_METS4      PFTRLFVPKVEIAAGR-------VTIAPPEDLFAPPGPPPEGEG----------------
RIMM_CAUVC      PFTRAAVPEVRVSEGL-------ILADPPALVGDHEGPE-EKGLDENEELGDRD------
RIMM_BEII9      PFTRQVVPRIDLTARR-------VLVVPPEEVEAQEPPEKDAGGDEPSP-----------
RIMM_GRABC      PFTRAAVPVVDIAAGR-------VLIDPPQE-ENAPEFG-RNELGHDDGGEAA-------
RIMM_GLUDA      PFTRACFPVVDVAAGR-------IEAVLPDEIEVQGDLSDKGEVEVSATGGAS-------
RIMM_ACICJ      PFTRAVVPEIDLPGGR-------AVVVRPVEVEMRE------------------------
RIMM_JANSC      PFTLAVVPTVDIAAGR-------VIVDMPDGLIGGDKPDTSDTAPLGQDFD---------
RIMM_ROSDO      PFTRAVVPTVDLLAGK-------LIADPPEGAL---------------------------
RIMM_RHORT      PFTKAVVPLVDVKAGR-------LVADPPLGLLDDTRPPAGVEGEVEEDPGVGIDEDGDG
RIMM_MAGSA      PFTQASVPEVDIAGGR-------LVVVPPVYAPDENEEKSGGA-----------------
RIMM_PARL1      GFTDENVPEVDIAGGR-------VVIDPPAGTFGDDAEAERGE-----------------
RIMM_MARMM      PFTREFVPHVSIAEGV-------ITIDPPEDVGSKAEEEGGGAPDD--------------
RIMM_HYPNA      PLTRADVPVIDMAAHR-------IVI-PELSLWANQDEDDAS------------------
RIMM_SPHAL      PMTVTAVPTWDAETVT-------VNAAFIE------------------------------
RIMM_NOVAD      PMKTEAVPEWTDERIV-------IEAAYADQ-----------------------------
RIMM_ZYMMO      PIAQAV--DVHDDHLV-------IAADFIE------------------------------
RIMM_RHILO      PFTQAAVPDVSVAEGF-------VRVDPVAAGLVEDE-DGDAPREEDFD-PKG-RPRGPR
RIMM_CHESB      PFTRDAVPDIDLSNNT-------IRIDSITAGLDNAELSGEEDEAEGPESARGSRPRGPK
RIMM_OCHA4      PFTEAAVPEIDLDKGT-------LLVEPYAAGLIADD-EDERPQNEKKK---------PK
RIMM_BARBK      PFSKAAVPEICVASGF-------LVVDPVAAGLFSDPHSFNDLALNDLE----------K
RIMM_ANAMM      PFSRSTFPVVDVERRV-------VIVVPPEVIGVGSR-----------------------
RIMM_ANAPZ      SFTSNIFPSIDMKTRE-------MTIVPPEIVGVYK------------------------
RIMM_WOLTR      PFTKEIFPYVNIKERY-------ITLNMPEFIG---------------------------
RIMM_EHRRW      PFSKDIFTHINTKERY-------VILKLPEIIGSNSGI----------------------
RIMM_RICBR      PFNKDFFPIITKDYAI-------LNYKRDEL-----------------------------
RIMM_ORITB      PFTNEIFPQITEDFVV-------IVPPEFI------------------------------
RIMM_DEIRA      SFVPLQAPYVEVPLAGGKPGAVHLTADAPAGLIGPEPGEEDGAAES--------------
RIMM_THET8      RLVPLQAPYVRVEEGS-------IHVDPIPGLFD--------------------------
RIMM_HUNT2      PALKSVVKKVCFEDNK-------MVVDLPQGLIDDEV-----------------------
RIMM_CALS8      PALKDIVKEVNIEQGY-------MKIKVIEGLLD--------------------------
RIMM_CLOD6      PAIKKFVPTIDIDERK-------MIIDPIKGMID--------------------------
RIMM_CLONN      PAIKSVIVDIDVNNKK-------IIIKPLEVWQ---------------------------
RIMM_CLOTE      PVLKTIVVKIDIENEE-------IIIKPVKTWLLE-------------------------
RIMM_CLOBL      PAIKDIVTNIDIENKT-------VTIKPLEIWQCE-------------------------
RIMM_CLOPS      PVLKDIVLDINMDEKL-------ITIRPSGEWQYED------------------------
RIMM_CLOB8      PVLRDIVLDIDIKLKK-------IIIKPVGEWQDED------------------------
RIMM_CLOAB      PALKDIVLKIEIENKK-------IVIKAVEEWLES-------------------------
RIMM_ALKOO      PSVKEFMPEISLEKKR-------ITIDPIEGMIE--------------------------
RIMM_FINM2      PAVKEFIKKIDLENGL-------IDVVIIEGM----------------------------
RIMM_CALS4      PAIKEVIKKVDVEGKV-------MIVRLLEGL----------------------------
RIMM_DESHY      PALKTVVKHVDVAGKR-------MDVELPPGLIDGEELR---------------------
RIMM_MOOTA      PALKTVVRQVDLARKE-------IRVELPPGLRD--------------------------
RIMM_HELMI      PALKSVVLKVDLAAGT-------MTVRLPDGLR---------------------------
RIMM_PELTS      PALKQVVKSVNLTEGK-------MVVELPEGLEEL-------------------------
RIMM_CARHZ      PFIKVFVKEVNLPEGF-------IKVELLPGMLEEKK-----------------------
RIMM_SYNWW      PAIKDVILAVKLEEKR-------MEIKLLPGLIED-------------------------
RIMM_SYMTH      PAVRRFVKEIDLETGR-------MVIDPIPGLLED-------------------------
RIMM_DEHM1      PAVKDVVKEINLQKGQ-------VIIDPIPGLLD--------------------------
RIMM_CHLTE      PAVEDFITETDLEKGM-------VRLKRFKEFL---------------------------
RIMM_CHLPB      PAVEEFVEEISIDEGY-------MVLKRFEEFL---------------------------
RIMM_CHLPD      PAVEEFVEEIDMAGRY-------MVVPRFDEFL---------------------------
RIMM_CHLCH      PAIEAFVESFELASKT-------IVMSRCWEFL---------------------------
RIMM_GEOLS      PAIASVISSVNIHTGT-------MTITPLEGLLDL-------------------------
RIMM_PELPD      PAIADVIHSVDLEMGR-------MLITPLEGLLDL-------------------------
RIMM_GEOUR      PALADVVLDVDSDAKR-------MTVSLPEGLLDL-------------------------
RIMM_GEOSL      PAVEDVVVQVDLEAGT-------MTVSPPEGLLDL-------------------------
RIMM_SYNFM      PAIEDVIREIDLERKR-------MVVDLPEGLVDA-------------------------
RIMM_SYNAS      PAISDVILKIDLDKKE-------MVVRLLPGL----------------------------
RIMM_PARD8      PAVEELITEADHEARS-------LTVSLPEGLIDL-------------------------
RIMM_BACV8      PAHEEFITKLDKKKRL-------LTVEVPDGLI---------------------------
RIMM_PORGI      PVAEDLLEEIDVPNRK-------LTMIIPDGLLQL-------------------------
RIMM_GRAFK      PMNDEFIEKVDKKNNT-------VRVITPEGLVELYLG----------------------
RIMM_CYTH3      PVTEEIVHSVDVKTKQ-------VITTLPEGLIEIYLNEDASEPDAD-------------
RIMM_NOSP7      PFVEAIAPVVDLKSNR-------IEITPPPGLLEINN-----------------------
RIMM_MICAN      PFVKEIVPLVDLKAAR-------IEIAPPPGLLEINLS----------------------
RIMM_CROS5      PFVYEIVPVVDLENNR-------IEINPPKGLLSLGDS----------------------
RIMM_PROMA      PFVKEIVPEIKLQEGW-------LMVCPPPGLFDL-------------------------
RIMM_PROMT      PFVKEIVPEIEIKEKW-------LLINPPPGLLEL-------------------------
RIMM_TRIEI      PFVKEIVPIVNFEQSI-------IEITPPDGLIDL-------------------------
RIMM_SYNR3      PFVDAIVPQVELEEGW-------LLITPPKGLLDG-------------------------
RIMM_SYNY3      PFVEAIVPTVELAEQR-------LEIKTIPGLLD--------------------------
RIMM_SYNP2      PFVKAIVPVVDLVENR-------LEVDAPPGLFEI-------------------------
RIMM_GLOVI      PFVHALVPVVDLEAGR-------IEVVAIPGLLDPEAAEADEA-----------------
RIMM_THEEB      PFVPAIVPVVDLAARR-------IEIDPPLGLLP--------------------------
RIMM_ACAM1      PFVSALVPIVDIATKR-------IEITPPKGLIPE-------------------------
RIMM_SYNJA      PFVKALVPVVDLEKGE-------LQVQPPPGLVESFLGQDRARN----------------
RIMM_PROMP      PFVKEIVPIVDIKKNF-------ILLTPPSGLLEL-------------------------
RIMM_CORDI      PFVHDIVPEVDLDAGT-------CVITPPEGLLEL-------------------------
RIMM_CORU7      PFKLAIVPIVDLDNEA-------LVVTPPEGLLELA------------------------
RIMM_SALTO      PFVQAIVPEIDLAGGR-------VVVDPPGGLLDL-------------------------
RIMM_NOCSJ      PFVKALVPEVDLAGRR-------VVIADRPGLVTPLPEDDEH------------------
RIMM_KINRD      PFVTPLVPRVDVKRGK-------VVLSPPGGLFVELPGEPEE------------------
RIMM_THEFY      PFVRELVPDVDTAAGR-------VVIDPPPGLLELGR-----------------------
RIMM_STRAW      PFVEEIVVEIDLEEQR-------AVIDPPPGLIDDRAEVDSSDTEAATEADA--------
RIMM_SACEN      PFVSEMVPEIDLEAGR-------IVVDPPEGLFDAEE-----------------------
RIMM_RHOJR      PFVAAIVTSVSVADGV-------ALIDPPEGLLDPDFGESADGK----------------
RIMM_RENSM      PFVAEIVPEVDIAAGF-------IRLVPPGGLFDINRKDAE-------------------
RIMM_FRASN      PFVREIVPTVDPAAGH-------IVVDPPPGLLDLD------------------------
RIMM_CUTAK      PFVHQLVPTVDVASGR-------IVVSGIPGLLDSNAEEAR-------------------
RIMM_ACIC1      PFVAALVPEVDVDQRR-------LRIDPPPGLLEL-------------------------
RIMM_LEIXX      PFVKAIVPEVDLAART-------VTLTPPPGLFEDLPDDAPAAGDESEPVSPPVTAEETP
RIMM_DESVV      PAAAPFVLDIDLDSRT-------ARIAPPPGLLDIYLSD---------------------
RIMM_DESAG      PAAEEFVAEIDVDSET-------IRITPPPGLLEIYLSGS--------------------
RIMM_LAWIP      PAIPEFVLEVDTNAQL-------IRINPPKGLLELYK-----------------------
RIMM_NITSB      FL-DMFIEDVHLDQKRID-------TKGAQDILEAS------------------------
RIMM_SULNB      YI-DRYVINTDEKSKIVH-------VKDAKDILEAS------------------------
RIMM_SULDN      FR-EPFTINTDIKEKIIT-------VIGAMDILEAS------------------------
RIMM_ARCB4      HIFDKFILNIDIENKRID-------VINSFDILENS------------------------
RIMM_CAMJ8      YL-DKFVKNIDIEKRQIFC------TQDAFLILENS------------------------
RIMM_CAMHC      YT-DHFIDKISIEEGKIF-------SRFGFEILQNS------------------------
RIMM_CAMFF      YN-DNFTQNIDIKSKKIQ-------VKNSLDILKNS------------------------
RIMM_CAMC5      YI-DRFVISVSLENKEIL-------TKDAKSILENS------------------------
RIMM_HELAH      YR-DFYIKEILLQDKKIT-------TNNAKTLLENS------------------------
RIMM_TREDE      FN-KEFIGKIDLKAKTVE--------LMHRWILE--------------------------
RIMM_TREPA      FH-RTFIGDVDVGRKKIE--------LLQRWILE--------------------------
RIMM_LACP7      PYIDDCVKKIDLNEKK-------LVVHLIPGLVE--------------------------
RIMM_OENOB      PYIDQVVKKVDLQTST-------VTIELLEGLDED-------------------------
RIMM_LACDB      PYIPQVVKSVDIDKKE-------VRVELMEGLR---------------------------
RIMM_LACJO      PNIESVVKKVDLANKR-------IEVTLLEGLRDEN------------------------
RIMM_ENTFA      PYIEGVVTKVDVENQR-------IDVDIPEGLIDDEN-----------------------
RIMM_OCEIH      PYIEQVVKQVDIENKI-------IKVQLMEGMLD--------------------------
RIMM_PEDPA      PYLKDVILNVDLEQGA-------VQVSVPEGLD---------------------------
RIMM_LACPL      PKIPQVIKDVDLDAGV-------VTVELMEGLID--------------------------
RIMM_LACRD      PVIDEVVKNVDLDKNF-------VTVELMEGLE---------------------------
RIMM_LACS1      PAIKDVIKKIDLEQNK-------VIIELLDGLD---------------------------
RIMM_LACP3      PFLKSVVQSIDLDQKV-------AHVIVPEGLIDDAD-----------------------
RIMM_LACSS      PFLKSVIKKIDIEAGK-------AYVEVPEGLIDNED-----------------------
RIMM_LEUMM      PMIDDVVKSVDVDAKL-------ITIDALEGLLD--------------------------
RIMM_LYSSC      PYIEDIVKDIDVDEKK-------IVIHVMEGLL---------------------------
RIMM_STAS1      PYIADVVKDIDVEGRR-------IQITPMEGLLD--------------------------
RIMM_THEP1      PMTKDCIVEIDKGAKK-------IIAKEMEWI----------------------------
RIMM_PETMO      PMTDHYIIELKKEDKS-------IIVKKIEWYENGTNQAD--------------------
RIMM_THEM4      PVIKEYVLQIDKKSNK-------IVVKLPEWLD---------------------------
RIMM_FERNB      PVIERYILKIDKEAKK-------IIVNMPEWLE---------------------------
RIMM_PSELT      PVIHDYIIKFEKR-KR-------LVVKVPEWI----------------------------
RIMM_BUCAP      PFIHKKIVKYINVK-H-------KIITVIWN-----------------------------
RIMM_BUCAI      PFIDNKIIKNVNTD-K-------KFILVQWD-----------------------------
RIMM_BUCBP      PFLHPQIISEVNINNK-------KIVIKNWKQTFE-------------------------
RIMM_BUCCC      PFIQPNFIKKIDIKKK-------IIVIDLTNLNNQLI-----------------------
RIMM_PELCD      PAVKAFIADVDLESNR-------ILFDLPDGLVQET------------------------
RIMM_ANADF      LVPLAPYVEVDVAGRR-------VVVDPPEGLLD--------------------------
RIMM_BIFAA      PFVDELVPDIDLEGGY-------LTLDPPGGLIPGL------------------------
RIMM_SORC5      PLTESFVSSVDAERQV-------VQLATLEGLV---------------------------
RIMM_MAGMM      PYIEEVVVELDLDRQI-------IKVKLMEGM----------------------------
RIMM_AQUAE      PFVSDIVLKVDKENKK---------IIVKEELLPV-------------------------
RIMM_ACHLI      PFIDKFIKSVDETSIH---------IETIEGLI---------------------------
RIMM_BORBU      PFLSIYIGDINTQEKT-------IELKVLDLLK---------------------------
RIMM_SALRD      PAIDDFIIEIDEEAER-------IVVRPIDGLMDA-------------------------
RIMM_FUSNN      PDVDVFIKNIDFENRK-------MLVDTIEGMKESKVKK---------------------
RIMM_SULSY      PFINEFVKDVNVKENK-------MQITPPEGWFSL-------------------------
RIMM_NEOSM      PFTSAFVADIDLNKKR-------LAVVFPPEI----------------------------
RIMM_SOLUE      PFARAICVEINPAAKR-------ITVELPEGLKDLNRP----------------------
RIMM_KORVE      PYVESFLKSTDFKAKR-------IEMVLPQGMLELDAPLSKAEKERQKSEADETREAGER
RIMM_LEPIC      PFLQVFVGDLDLEKNT-------IVLIQPEIWNEI-------------------------
RIMM_AMOA5      PYEPALIQDLDHEQKK-------IIVELPMGFLEAMGCK---------------------
RIMM_BDEBA      PFVDAFIKKIDFKHQA-------VVMDLPEGLFDIENA----------------------
RIMM_MESFL      PLVDVYTNNIDDESRI-------ITLKNIEGLK---------------------------
                                                                            

RIMM_VEREI      ------
RIMM_POLSJ      ------
RIMM_LEPCP      ------
RIMM_METPP      ------
RIMM_JANMA      ------
RIMM_PARP8      ------
RIMM_RALSO      ------
RIMM_BORA1      ------
RIMM_POLAQ      ------
RIMM_ECOLI      ------
RIMM_BAUCH      ------
RIMM_BLOFL      ------
RIMM_BLOPB      ------
RIMM_PSYIN      ------
RIMM_COLP3      ------
RIMM_IDILO      ------
RIMM_SHEAM      ------
RIMM_PSEA6      ------
RIMM_HYDCU      ------
RIMM_XYLFT      ------
RIMM_ALKEH      ------
RIMM_METCA      ------
RIMM_ALCBS      ------
RIMM_NITOC      ------
RIMM_CHRSD      ------
RIMM_MARHV      ------
RIMM_HAHCH      ------
RIMM_MARMS      ------
RIMM_CELJU      ------
RIMM_SACD2      ------
RIMM_PSEF5      ------
RIMM_LEGPH      ------
RIMM_RUTMC      ------
RIMM_DICNV      ------
RIMM_METFK      ------
RIMM_THIDA      ------
RIMM_CHRVO      ------
RIMM_NEIG1      ------
RIMM_NITMU      ------
RIMM_NITEC      ------
RIMM_AROAE      ------
RIMM_DECAR      ------
RIMM_ACIAD      ------
RIMM_PSYWF      ------
RIMM_COXBR      ------
RIMM_FRAP2      ------
RIMM_ROSS1      ------
RIMM_CHLAA      ------
RIMM_HERA2      ------
RIMM_MYXXD      ------
RIMM_RUBXD      ------
RIMM_NITWN      ------
RIMM_AZOC5      ------
RIMM_METS4      ------
RIMM_CAUVC      ------
RIMM_BEII9      ------
RIMM_GRABC      ------
RIMM_GLUDA      ------
RIMM_ACICJ      ------
RIMM_JANSC      ------
RIMM_ROSDO      ------
RIMM_RHORT      KGGAS-
RIMM_MAGSA      ------
RIMM_PARL1      ------
RIMM_MARMM      ------
RIMM_HYPNA      ------
RIMM_SPHAL      ------
RIMM_NOVAD      ------
RIMM_ZYMMO      ------
RIMM_RHILO      DAGGNR
RIMM_CHESB      SAGEPR
RIMM_OCHA4      KS----
RIMM_BARBK      G-----
RIMM_ANAMM      ------
RIMM_ANAPZ      ------
RIMM_WOLTR      ------
RIMM_EHRRW      ------
RIMM_RICBR      ------
RIMM_ORITB      ------
RIMM_DEIRA      ------
RIMM_THET8      ------
RIMM_HUNT2      ------
RIMM_CALS8      ------
RIMM_CLOD6      ------
RIMM_CLONN      ------
RIMM_CLOTE      ------
RIMM_CLOBL      ------
RIMM_CLOPS      ------
RIMM_CLOB8      ------
RIMM_CLOAB      ------
RIMM_ALKOO      ------
RIMM_FINM2      ------
RIMM_CALS4      ------
RIMM_DESHY      ------
RIMM_MOOTA      ------
RIMM_HELMI      ------
RIMM_PELTS      ------
RIMM_CARHZ      ------
RIMM_SYNWW      ------
RIMM_SYMTH      ------
RIMM_DEHM1      ------
RIMM_CHLTE      ------
RIMM_CHLPB      ------
RIMM_CHLPD      ------
RIMM_CHLCH      ------
RIMM_GEOLS      ------
RIMM_PELPD      ------
RIMM_GEOUR      ------
RIMM_GEOSL      ------
RIMM_SYNFM      ------
RIMM_SYNAS      ------
RIMM_PARD8      ------
RIMM_BACV8      ------
RIMM_PORGI      ------
RIMM_GRAFK      ------
RIMM_CYTH3      ------
RIMM_NOSP7      ------
RIMM_MICAN      ------
RIMM_CROS5      ------
RIMM_PROMA      ------
RIMM_PROMT      ------
RIMM_TRIEI      ------
RIMM_SYNR3      ------
RIMM_SYNY3      ------
RIMM_SYNP2      ------
RIMM_GLOVI      ------
RIMM_THEEB      ------
RIMM_ACAM1      ------
RIMM_SYNJA      ------
RIMM_PROMP      ------
RIMM_CORDI      ------
RIMM_CORU7      ------
RIMM_SALTO      ------
RIMM_NOCSJ      ------
RIMM_KINRD      ------
RIMM_THEFY      ------
RIMM_STRAW      ------
RIMM_SACEN      ------
RIMM_RHOJR      ------
RIMM_RENSM      ------
RIMM_FRASN      ------
RIMM_CUTAK      ------
RIMM_ACIC1      ------
RIMM_LEIXX      GGE---
RIMM_DESVV      ------
RIMM_DESAG      ------
RIMM_LAWIP      ------
RIMM_NITSB      ------
RIMM_SULNB      ------
RIMM_SULDN      ------
RIMM_ARCB4      ------
RIMM_CAMJ8      ------
RIMM_CAMHC      ------
RIMM_CAMFF      ------
RIMM_CAMC5      ------
RIMM_HELAH      ------
RIMM_TREDE      ------
RIMM_TREPA      ------
RIMM_LACP7      ------
RIMM_OENOB      ------
RIMM_LACDB      ------
RIMM_LACJO      ------
RIMM_ENTFA      ------
RIMM_OCEIH      ------
RIMM_PEDPA      ------
RIMM_LACPL      ------
RIMM_LACRD      ------
RIMM_LACS1      ------
RIMM_LACP3      ------
RIMM_LACSS      ------
RIMM_LEUMM      ------
RIMM_LYSSC      ------
RIMM_STAS1      ------
RIMM_THEP1      ------
RIMM_PETMO      ------
RIMM_THEM4      ------
RIMM_FERNB      ------
RIMM_PSELT      ------
RIMM_BUCAP      ------
RIMM_BUCAI      ------
RIMM_BUCBP      ------
RIMM_BUCCC      ------
RIMM_PELCD      ------
RIMM_ANADF      ------
RIMM_BIFAA      ------
RIMM_SORC5      ------
RIMM_MAGMM      ------
RIMM_AQUAE      ------
RIMM_ACHLI      ------
RIMM_BORBU      ------
RIMM_SALRD      ------
RIMM_FUSNN      ------
RIMM_SULSY      ------
RIMM_NEOSM      ------
RIMM_SOLUE      ------
RIMM_KORVE      RKR---
RIMM_LEPIC      ------
RIMM_AMOA5      ------
RIMM_BDEBA      ------
RIMM_MESFL      ------