CLUSTAL format seed alignment for MF_00015

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LEXA_DEIRA        -----------------------------MPPELTPTRRSIL----QATLRLGAGATAGQ
C1D2K8_DEIDV      -----------------------------MPPELTRTRRLILDAIL-RLQAEDTPATLGA
Q7V0J4_PROMP      -------------------------MPPSIDNDLTAAQNELFNWIKNYMRDFQHSPSIRQ
B0C8B3_ACAM1      ------------------------------MEPLSKAQQELFDWLVQFIEQHQHAPSIRQ
B1X0G0_CROS5      ------------------------------MEPLTPAQKELYEWLIKYINDNQHAPSIRQ
LEXA_XYLFA        -------------------------------MSLSDIQQAILSLITNHINADGVSPSQTE
LEXA2_XANAC       -------------------------------MDLTDTQQAILALIAERIDADGVPPSQTE
LEXA2_XANCP       -------------------------------MGLTDTQQAILALIAERIETDGVPPSQTE
LEXA_RALSO        ------------------------------MATLTTRQQQIYDLIHQTIQRTGFPPTRAE
LEXA_PSEAE        ------------------------------MQKLTPRQAEILSFIKRCLEDHGFPPTRAE
LEXA1_PSEPK       ------------------------------MLKLTPRQAEILAFIKRCLEDNGFPPTRAE
LEXA_PRORE        ------------------------------MKALTARQQQVYDLVRDHISQTGMPPTRAE
LEXA_PECCC        ------------------------------MKVLTARQQQVYDLIRDHIAQTGMPPTRAE
LEXA_YERPE        ------------------------------MKALTTRQQEVYDLVRDHLAQTGMPPTRAE
LEXA_ECOLI        ------------------------------MKALTARQQEVFDLIRDHISQTGMPPTRAE
LEXA_SALTY        ------------------------------MKALTARQQEVFDLIRDHISQTGMPPTRAE
LEXA_HAEIN        ------------------------------MRPLTARQQEVLDLLKRHLETTGMPPTRAE
LEXA_PASMU        ---------------------------MKPFKALTARQQEVYDLLKRHLENTGMPPTRAE
LEXA_AERHH        ------------------------------MKPLTPRQAEVLELIKANMNETGMPPTRAE
LEXA_VIBCH        ------------------------------MKPLTPRQQEVFDLIKSKIDETGMPPTRAE
B2VA45_SULSY      ---------------------------------MTKRQKEILDFIIEYYQKNGYYPTLME
D8K236_DEHLB      -------------------------MPRTPRKTMSDRQLKMLEYIRNYFNDYGIPPSIRD
D2R3E9_PIRSD      ----------------------MNSAADTLTDTLTKRQSLVFEFIREQIRTRGYGPTVRE
LEXA_RHOS4        --------------------------------MLTRKQMELLDFIKTRMDRDGVPPSFDE
LEXA_CAUVC        --------------------------------MLTRKQHELLMFIHERIKETGVSPSFDE
LEXA_AGRFC        --------------------------------MLTRKQQELLLFIHERMKESGVPPSFDE
LEXA_RHIME        --------------------------------MLTRKQQELLLFIHERMKESGVPPSFDE
LEXA_BRUME        --------------------------------MLTRKQHELLLFIHERLKETGIPPSFDE
LEXA_RHILO        --------------------------------MLTRKQHELLMFIHERLKESGIPPSFDE
LEXA_THEMA        ------------------------------MKDLTERQRKVLLFIEEFIEKNGYPPSVRE
LEXA_THENE        ------------------------------MKDLTAKQRSVLIFIEEFIEKNGYPPSVRE
LEXA_STAAM        ------------------------------MRELTKRQSEIYNYIKQVVQMKGYPPSVRE
LEXA_STAAW        ------------------------------MRELTKRQSEIYNYIKQVVQTKGYPPSVRE
LEXA_STAAC        ------------------------------MRELTKRQSEIYNYIKQVVQTKGYPPSVRE
LEXA_BACHD        ------------------------------MSKLSRRQQEILDYIKEEVRAKGYPPSVRE
LEXA_BACSU        ------------------------------MTKLSKRQLDILRFIKAEVKSKGYPPSVRE
LEXA_LISIN        -------------------------------MKISKRQQDIYEFIKSEVKEKGYPPSVRE
LEXA_LISMO        -------------------------------MKISKRQQDIYEFIKSEVKEKGYPPSVRE
LEXA_CLOAB        ---------------------------MATDKITRDVQSEIYEFIRQEVLDKGYPPSVRE
LEXA_CLOPE        ----------------------------MIIKENSDKQTQIYNFLIEFTKSKGYPPSVRE
LEXA_CORGL        -----------------------MPNGKPDPASLSDRQRRILEVIRDAVVLRGYPPSIRE
LEXA_STRCL        MTEAATGPEGADPSRAARSLPGRPPGIRADSSGLTDRQRRVIEVIRDSVQRRGYPPSMRE
LEXA_STRCO        ------MSDAANPEGHKRSLPGRPPGIRADSSGLTDRQRRVIEVIRDSVQRRGYPPSMRE
LEXA_MYCLE        -----------MSDSTDISGITVDGRLHSMDSGLTERQRTILNVIRASVTSRGYPPSIRE
LEXA_MYCTU        -------MNDSNDTSVAGGAAGADSRVLSADSALTERQRTILDVIRASVTSRGYPPSIRE
                                                       .  :              .:   

LEXA_DEIRA        VAQEVGI-TKQAISQQVNILRKLGYLQPAETRYGPL-QVTDRARAALG------------
C1D2K8_DEIDV      VAQATGL-TKQAVSYQTVLLREAHYLEPAASRYAPL-ILTSKARALIGGG----------
Q7V0J4_PROMP      MMKAMGLKSPAPVQSRLRHLQDKGYISWQEGKARTM-QIVDEIF----------------
B0C8B3_ACAM1      MMQAMKLKSPAPVQSRLDHLRKKGYVDWEIGQARTL-RIVHPEHLQ--------------
B1X0G0_CROS5      MMKAMNLRSPAPVQSRLERLRNKGYIDWTEGKARTL-RILHHQP----------------
LEXA_XYLFA        IARAFGFKGVRAVQHHLDVLEQQGMIRRVPRQARGI-RLKHLTEVDETALALQS------
LEXA2_XANAC       IARAFGFKGIRAAQYHLEALEHAGAIRRVPGQARGI-RLAGQGAQTRTAP----------
LEXA2_XANCP       IARAFGFKGVRAAQYHLEALEQAGAIRRVPGQARGI-RLAGAAAHARAAP----------
LEXA_RALSO        IAAEFGFSSPNAAEEHLRALARKGVIELTPGASRGI-RLRAEGGASPHQF----------
LEXA_PSEAE        IAQELGFKSPNAAEEHLKALARKGAIEMTPGASRGI-RIPGFEPHAA-------------
LEXA1_PSEPK       IAQELGFKSPNAAEEHLKALARKGAIEMTPGASRGI-RIPGLEAK---------------
LEXA_PRORE        IAASLGFRSPNAAEEHLKALARKGVIEIVSGASRGI-RLLLEEE----------------
LEXA_PECCC        IAQQLGFRSPNAAEEHLKALARKGVIEIVSGASRGI-RLLMEEE----------------
LEXA_YERPE        IAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGI-RLLMEEE----------------
LEXA_ECOLI        IAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGI-RLLQEEE----------------
LEXA_SALTY        IAQRLGFRSPNAAEEHLKALARKGVLEIVSGASRGI-RLLQEEE----------------
LEXA_HAEIN        ISRELGFKSANAAEEHLKALSRKGAIEIIPGASRGI-RILDNSSN---------------
LEXA_PASMU        ISKELGFRSPNAAEEHLKALARKGVIEIISGTSRGI-RLLLEESES--------------
LEXA_AERHH        IAQKLGFKSANAAEEHLKALAKKGVIEIMPGTSRGI-RLLLEEEEP--------------
LEXA_VIBCH        IAKELGFRSANAAEEHLKALARKQVIEMVPGASRGI-RILVDNAANEE------------
B2VA45_SULSY      IAKHFNLSAVSTIHEHLQKLEQEGYIKR-SGKGKI--EIVEKSPKN--------------
D8K236_DEHLB      IVSGCNISSTSVADYNLRHLERAGYIRRHKDVSRGI-ELLGSEG----------------
D2R3E9_PIRSD      IGEHFDIRSPNGVMCHLKALEKKGLLQRVRKQDRAVARAIELAPEIV-------------
LEXA_RHOS4        MKDALDLRSKSGIHRLITALEERGFIRRLAHRARAI-EIVKLPEAMERAGFSARA-----
LEXA_CAUVC        MKEALDLASKSGIHRLITALEERGFIRRLAHRARAL-EVVKLPQQATAAAPPKGRGAFRP
LEXA_AGRFC        MKDALDLASKSGIHRLITALEERGFIRRLPNRARAL-EVIKLPEAYTPGARPQRG--FSP
LEXA_RHIME        MKDALDLASKSGIHRLITALEERGFIRRLPNRARAL-EVIKLPEAYAGASQVRRG--FSP
LEXA_BRUME        MKEALDLASKSGIHRLITALEERGFIRRLPNRARAL-EVLRLPDSIAPGLSPQKK--FAP
LEXA_RHILO        MKEALDLASKSGIHRLITALEERGFIRRLPNRARAL-EVLRLPDSIAPGLNAAKK--FSP
LEXA_THEMA        IARRFRI-TPRGALLHLIALEKKGYIERKNGKPRAL-RISKSIR----------------
LEXA_THENE        IARRFRI-TPRGAQLHLVALEKKGYIERKNGKPRAM-RVTKSVK----------------
LEXA_STAAM        IGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAI-EIVSDQTNDNINM----------
LEXA_STAAW        IGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAI-EIVSDQTNDNINM----------
LEXA_STAAC        IGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAI-EIVSDQTNDNINM----------
LEXA_BACHD        IGEAVGLASSSTVHGHLSRLEKKGYIRRDPTKPRAI-EVLDLENLASETTE---------
LEXA_BACSU        IGEAVGLASSSTVHGHLARLETKGLIRRDPTKPRAI-EILDEEVDIPQ------------
LEXA_LISIN        IGEAVGLASSSTVHGHLARLEGKGLIRRDPTKPRAI-EILSLEDEAET------------
LEXA_LISMO        IGEAVGLASSSTVHGHLARLEGKGLIRRDPTKPRAI-EILSLEDEAET------------
LEXA_CLOAB        ICAKVGLSSTSTVHGHLSRLEKKGLIRRDPTKPRAI-ELIKDPISK--------------
LEXA_CLOPE        ICQAVSLKSTSTVHGHLKRLEKKGLIYRDPTKPRAL-EIVELSNEE--------------
LEXA_CORGL        IGDAAGLQSTSSVAYQLKELEKKGFLRRDPNKPRAV-DVRHLPETESRSSKAATQ-----
LEXA_STRCL        IGQAVGLSSTSSVAHQLMALERKGFLRRDPHRPRAY-EVRGSDQPSAQPADTSGK-----
LEXA_STRCO        IGQAVGLSSTSSVAHQLMALERKGFLRRDPHRPRAY-EVRGSDQAASVQP----------
LEXA_MYCLE        IADAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAV-NVRGVEETQAAGPAVLTE-----
LEXA_MYCTU        IGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAV-NVRGADDAALPPV----------
                  :     :            *     :                                  

LEXA_DEIRA        -----------------------------------EGLPIYGQIAAGIPALA-------E
C1D2K8_DEIDV      ------------------------------------GFPLVGEIAAGQPGHA-------E
Q7V0J4_PROMP      -----------------------------------EGVPIMGSVAAGGLIET-------F
B0C8B3_ACAM1      --------------------------------SDMDQIPILGAIAAGGLIEP-------F
B1X0G0_CROS5      -----------------------------------KGVPILGAIAAGGLVEP-------F
LEXA_XYLFA        --------------------------------EDVLRLPVLGRVAAGQPIGA-------D
LEXA2_XANAC       --------------------------VSEVARDDVLRLPVLGRVAAGLPIGA-------D
LEXA2_XANCP       --------------------------AEEPVRDDVLRLPVLGRVAAGLPIGA-------D
LEXA_RALSO        --------------------------SLPSMGLMQLTLPLVGRVAAGSPILA-------A
LEXA_PSEAE        --------------------------------NDDEGLPVIGRVAAGAPILA-------E
LEXA1_PSEPK       --------------------------------AEEAGLPIIGRVAAGAPILA-------E
LEXA_PRORE        --------------------------------TEDQGLPLIGRVAAGEPLLA-------Q
LEXA_PECCC        -----------------------------------TGIPLVGRVAAGEPLLA-------Q
LEXA_YERPE        -----------------------------------EGLPLIGRVAAGEPLLA-------Q
LEXA_ECOLI        -----------------------------------EGLPLVGRVAAGEPLLA-------Q
LEXA_SALTY        -----------------------------------DGLPLVGRVAAGEPLLA-------Q
LEXA_HAEIN        --------------------------------DEFDGLPLVGRVRAGEPILA-------E
LEXA_PASMU        --------------------------------DENQGLPLVGRVAAGEPILA-------E
LEXA_AERHH        --------------------------------LEESGLPLIGKVAAGEPILA-------Q
LEXA_VIBCH        --------------------------------EAETGLPLIGRVAAGEPILA-------Q
B2VA45_SULSY      --------------------------------ENSFIFPYYGTISAGKPIAI-------E
D8K236_DEHLB      --------------------------------RPLQLVPLLGKIAAGRPIPVPDVETWKP
D2R3E9_PIRSD      --------------------------------AEDKGLPLAGTVAAGLTNLA-------F
LEXA_RHOS4        ---------------AKAAAAPLPKGAVTVETAGALDLPLMGRIAAGLPIEA-------I
LEXA_CAUVC        QVFEG-------------GGAPPPAASPAAAANDSRELPILGRIAAGTPIDA-------I
LEXA_AGRFC        SVIEGSLGK-----PKEPEPAPAVKAPANDFA-GAATIPVMGRIAAGVPISA-------I
LEXA_RHIME        SVIEGSLGK-----PAAPPPAPKPAPPAE--A-ASVAVPVMGRIAAGVPISA-------I
LEXA_BRUME        SVIEGSLGKVASVQPVRPAP-----APQNSEAPATVSVPVMGRIAAGVPISA-------I
LEXA_RHILO        SVIQGSLGQGGLGRQIKPAPSRLPAAGNDDDAVSAVSIPVMGRIAAGVPIDA-------I
LEXA_THEMA        -----------------------------------NKIPLIGEIRAGEKREA-------I
LEXA_THENE        -----------------------------------NRVPLIGEIRAGEKKEA-------I
LEXA_STAAM        --------------------------------EETIHVPVIGKVTAGVPITA-------V
LEXA_STAAW        --------------------------------EETIHVPVIGKVTAGVPITA-------V
LEXA_STAAC        --------------------------------EETIHVPVIGKVTAGVPITA-------V
LEXA_BACHD        --------------------------------AKATYIPVVGKVTAGLPITA-------V
LEXA_BACSU        --------------------------------SQVVNVPVIGKVTAGSPITA-------V
LEXA_LISIN        --------------------------------PNVVNIPIIGKVTAGMPITA-------I
LEXA_LISMO        --------------------------------PNVVNIPIIGKVTAGMPITA-------I
LEXA_CLOAB        --------------------------------REMIDIPIVGKVQAGQPILA-------V
LEXA_CLOPE        --------------------------------KELIDIPIVGKVTAGMPILA-------T
LEXA_CORGL        ----------------AKSKAPQAGVHDPELAGQTSFVPVVGKIAAGSPITA-------E
LEXA_STRCL        --------------------------------PAASYVPLVGRIAAGGPILA-------E
LEXA_STRCO        --------------------------TDTAGKPAASYVPLVGRIAAGGPILA-------E
LEXA_MYCLE        -------------------------VAGSDVLPEPTFVPILGRIAAGSPIFA-------E
LEXA_MYCTU        -----------------------TEVAGSDALPEPTFVPVLGRIAAGGPILA-------E
                                                       .*  * : **             

LEXA_DEIRA        QSPEDFTPSIEALLG-LKAGDFLLRVRGESMTGIGVMDGDYVVVRPAPEVHD---GEVAV
C1D2K8_DEIDV      QNVEAYITRLDQVID-MKEGDYLLRVRGDSMIGVGIYPQDIVIVRPNETVPN---GDIAV
Q7V0J4_PROMP      SDLQENLDVSEIF---RKKDVFALTVNGDSMIDACIADGDMVLMEPIKDSFSLRNGTIVS
B0C8B3_ACAM1      VEVVDSLEFSPKQL---PPKSYALRVNGDSMIDAHITDGDIVIMRPVQEPKTIKNGTIVA
B1X0G0_CROS5      TDEQERLDLSHLI---HANNYWGLRVTGDSMIEDLITDGDLAIMRSLDPDETLKNGEIVA
LEXA_XYLFA        IGEGRVVLLDRVFF--SPAPDYLLRVQGDSMRDEGIFDGDLIGVHRTQDAHS---GQIVV
LEXA2_XANAC       IGSDDFVVLDRVFF--SPSPDYLLKVQGDSMRDEGIFNGDLIGVHRTRDARS---GQIVV
LEXA2_XANCP       IGSDDFVVLDRVFF--SPSPDYLLKVQGDSMRDEGIFNGDLIGVHRTRDARS---GQIVV
LEXA_RALSO        EHIDRQYQVDPSLF--SSRPDFLLKVRGMSMRDAGILDGDLLAVQRAAEAAN---GKIVV
LEXA_PSEAE        QNIEESCRINPAFF--NPRADYLLRVRGMSMKDIGILDGDLLAVHVTREARN---GQVVV
LEXA1_PSEPK       QHIEQSCNINPAFF--HPQADYLLRVHGMSMKDVGIFDGDLLAVHTCREARN---GQIVV
LEXA_PRORE        EHIESHYQVDPELF--KPHADFLLRVNGMSMKDIGIMDGDLLAVHKTQNVHN---GQVVV
LEXA_PECCC        EHIECRYQVDPAMF--KPSADFLLRVSGMSMKNIGIMDGDLLAVHKTEDVRN---GQIVV
LEXA_YERPE        QHIEGHYKVDPSLF--KPGADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRN---GQVVV
LEXA_ECOLI        QHIEGHYQVDPSLF--KPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRN---GQVVV
LEXA_SALTY        QHIEGHYQVDPSLF--KPSADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRN---GQVVV
LEXA_HAEIN        QHIEATYRVDADMF--KPQADFLLKVYGLSMKNVGILDGDLLAVHSTKDVRN---GQIVV
LEXA_PASMU        QHIEGTYQVDANMF--KPQANFLLKVYGQSMKNIGILDGDLLAVHSTKDVRN---GQIVV
LEXA_AERHH        EHIESHYQVDPALF--HPRADFLLRVQGMSMKNIGILDGDLLAVHKTQEVRN---GQVVV
LEXA_VIBCH        EHVEAHYQVDPSMF--RPQADFLLRVHGESMKNIGILDGDLLAVHKTQDVRN---GQVVV
B2VA45_SULSY      NQTFEYIDLSDIL---RCENCYALRVKGNSMIGEFILNDDIIIVENRKEALN---GEIVV
D8K236_DEHLB      ELAAENVDVPETMIG-HHKNLFALKVRGNSMIDALVNDGDIVIMQAADDVEN---GQMAA
D2R3E9_PIRSD      EQ-NERIDFAEMF---SKKNLFVLQVRGDSMIEAHISDGDYVVVKKQKSANA---GQMVV
LEXA_RHOS4        NGGPQSVTVPGMMLS-GRGQHYALEVKGDSMIAAGINDGDIVVIREQQTADN---GDIVV
LEXA_CAUVC        QHERERLPVPEAML--GAGEHYVLEVQGDSMIEAGILDGDYVIIKKGDTATS---GEIVV
LEXA_AGRFC        QNNTHDLAVPVDML--GSGEHYALEVKGDSMIEAGIFDGDTVIIRNGNTANP---GDIVV
LEXA_RHIME        QNNMHDISVPVEMI--GSGEHYALEIKGDSMIEAGILDGDTVIIRNGSTASP---GDIVV
LEXA_BRUME        QNQTHMLSLPPEMI--GAGEHYALEVKGDSMIDAGIFDGDTIIIKRGDTANP---GEIVV
LEXA_RHILO        QHQTHSISVPPDMI--MGGEHYALEVKGDSMIDAGIFDGDTVIIRNADTASP---GEIVV
LEXA_THEMA        EYLEDYIEIPESFLS-SGYDHFLLKVKGESMIEEHICDGDLVLVRRQDWAQN---GDIVA
LEXA_THENE        EYLEDYIEVPGSFLS-SGYEHFLLRVKGESMIEEHICDGDLVLIRRQDWAQN---GDIVA
LEXA_STAAM        ENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAEN---GDIIV
LEXA_STAAW        ENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAEN---GDIIV
LEXA_STAAC        ENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAEN---GDIIV
LEXA_BACHD        ENVEEYFPLPEQLT--ANDNTYALRIQGDSMIEAGIFDGDLVIVRQQQTADN---GDIIV
LEXA_BACSU        ENIEEYFPLPDRMVP-PDEHVFMLEIMGDSMIDAGILDKDYVIVKQQNTANN---GEIVV
LEXA_LISIN        ENIEEYFPLPEYMAA-GETNVFMLEIDGESMINAGILDGDKVIVRQQSSAIN---GEIVV
LEXA_LISMO        ENIDEYFPLPEYMAA-GETNVFMLEIDGESMINAGILDGDKVIVRQESSAIN---GEIVV
LEXA_CLOAB        ENIDDYLTIPLNFVR-NTNDLFILKISGNSMIEAGIYDGDLAIIEKTNYAQN---GDIVV
LEXA_CLOPE        ENIEDMFQMPINYVK-HNNDLFILKVTGDSMIEAGILDGDLAIIEQKNVATN---GDIVV
LEXA_CORGL        QNIEEYYPLPAEIV--GDGDLFMLQVVGESMRDAGILTGDWVVVRSQPVAEQ---GEFVA
LEXA_STRCL        ESVEDVFPLPRQLV--GDGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAEN---GDIVA
LEXA_STRCO        ESVEDVFPLPRQLV--GDGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAEN---GDIVA
LEXA_MYCLE        GTVEDIFPLPRELV--GEGTLFLLKVTGDSMVEAAICDGDWVVVRQQKVADN---GDIVA
LEXA_MYCTU        EAVEDVFPLPRELV--GEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADN---GDIVA
                                       : * : * **    :   *   :           * .  

LEXA_DEIRA        VLVPGDNAATLKRLYHF-GQDILLTSENPAMPRLSFPAE---QVQVQGRMVGRVGVGAPR
C1D2K8_DEIDV      VLLPGESTATLKRVEHQ-NSKITLHSANPDYPPMTFPAR---DVRIQGCLVAHIGQAALR
Q7V0J4_PROMP      ALV-PGLGTTLKYFFKR-NGKIYLEAANPAYDPIELNLN---EVTFQGKLLAVWRSVRN-
B0C8B3_ACAM1      ARV-EGEGTTLKRFHLE-RNEVTLEAANLKYQPIKVLAT---QVEIQGSLIGVWRKYF--
B1X0G0_CROS5      ARV-EGVGTTLKRFYQE-GEIVMLKPSNLNYQPIEVKAN---QIEVQGILVGVWRGY---
LEXA_XYLFA        ARI--DDEITVKLLKIS-KDRIRLLPRNPDFAPIEVRSDQ--DFAIEGLYCGLLRPNR--
LEXA2_XANAC       ARI--DEEITVKLLKIG-KDRIRLLPRNPDYAPIEVLPDQ--DFAIEGLYCGLLRPNR--
LEXA2_XANCP       ARI--DEEITVKLLKIG-KDRIRLLPRNPDYAPIEVLPDQ--DFAIEGLYCGLLRPNR--
LEXA_RALSO        ARL--GDDVTVKRFQRK-GRQVELIAENPDFEPIHVDLDRD-EFQLEGLAVGLIRPAAP-
LEXA_PSEAE        ARI--GEEVTVKRFKRE-GSKVWLLAENPEFAPIEVDLKEQ-ELIIEGLSVGVIRR----
LEXA1_PSEPK       ARI--GDEVTVKRFKRE-GSKVWLLAENPEFAPIEVDLKEQ-ELVIEGLSVGVIRR----
LEXA_PRORE        ARI--EDEVTVKRFKQQ-GNRVELIAENPEFEPIVVDLRQQ-NFTIEGLAVGVIRNSDWY
LEXA_PECCC        ARI--DDEVTVKRLKKQ-GNTVHLLAENEEFAPIVVDLRQQ-SFSIEGLAVGVIRNSDWS
LEXA_YERPE        ARI--DDEVTVKRLKKQ-GNIVHLLPENSEFQPIVVDLREQ-SFTIEGLAVGVIRNGDWI
LEXA_ECOLI        ARI--DDEVTVKRLKKQ-GNKVELLPENSEFKPIVVDLRQQ-SFTIEGLAVGVIRNGDWL
LEXA_SALTY        ARI--DDEVTVKRLKKQ-GNKVELLPENSEFTPIVVDLREQ-SFTIEGLAVGVIRNGEWL
LEXA_HAEIN        ARI--EDEVTVKRLEKK-GSIIYLHAENEEFDPIVVNLEEQKNFEIEGIAVGIIRNNAWM
LEXA_PASMU        ARI--EDEVTVKRLERK-GSVIYLHAENEEFAPIVVDLNQQPNFEIEGIAVGIIRNNAWM
LEXA_AERHH        ARL--DEDVTVKRFQRK-GSQVWLLPENEELSPIEVDLSCQ-QLTIEGLAVGVIRNADWM
LEXA_VIBCH        ARV--EDDVTVKRLERK-GSKVFLHAENEEFAPIEVDLAAQ-SLTIEGIAVGVIRNSTWM
B2VA45_SULSY      AVI-DGEETTLKKFYNLGNGYIKLVPANPDYEPMIYEAD---RVEIQGVLKGIVRSFKGL
D8K236_DEHLB      VWLKNEKEATLKKVFREANGKVRLQPANALMTPMYENAK---NVVIQGRVIGVIRKVA--
D2R3E9_PIRSD      AQS-PEGEATLKYWFPE-AKGVRLQPANSTMQPIYLK-----EANVVGIVVGVVRNMGK-
LEXA_RHOS4        ALV-ADHEATLKRYRRR-GGMIALEPANDSYETQVYPEQ---MVKVQGRLVGLIRSY---
LEXA_CAUVC        ALV--GEEATLKRLRKK-GGSIALEAANPKYETRIFGPD---QVEVQGKLVGLIRRYH--
LEXA_AGRFC        ALV-DDEEATLKRFRRK-GASIALEAANPAYETRIFGPD---RVKIQGKLVGLIRRYH--
LEXA_RHIME        ALI-DDEEATLKRFRRK-GASIALEAANPAYETRIFGPD---RVKIQGRLVGLIRRYH--
LEXA_BRUME        ALV-DEEEATLKRFRRE-GASIALEAANPAYETRIFGPD---RVHVQGKLVGLIRRY---
LEXA_RHILO        ALV-DEEEATLKRFRRK-GASIALEAANPAYETRIFGPD---RVKVQGKLVGLIRRY---
LEXA_THEMA        AMV--DGEVTLKKFYQR-GDTVELRPANREMSSMFFRAE---KVKILGKVVGVFRKL---
LEXA_THENE        AMV--EGEVTLKKFFQR-GEMVELRPANKEMSPMFFRAD---RVKILGKVVGVFRKI---
LEXA_STAAM        AMT-EEDEATVKRFYKE-KNRYRLQPENSTMEPIYLD-----NVAVIGKVIGLYREM---
LEXA_STAAW        AMT-EEDEATVKRFYKE-KNRYRLQPENSTMEPIYLD-----NVAVIGKVIGLYREM---
LEXA_STAAC        AMT-EEDEATVKRFYKE-KNRYRLQPENSTMEPIYLD-----NVAVIGKVIGLYREM---
LEXA_BACHD        AMT-EEDEATVKRFFRE-KDYIRLQPENSTMEPIILT-----TCTILGKVIGVFRTIH--
LEXA_BACSU        AMT-EDDEATVKRFYKE-DTHIRLQPENPTMEPIILQ-----NVSILGKVIGVFRTVH--
LEXA_LISIN        AMT-DENEATCKRFYKE-ANHFRLQPENDALEPIILN-----NVTILGKVIGLYRDIH--
LEXA_LISMO        AMT-DENEATCKRFYKE-ANHFRLQPENDALEPILLN-----NVTILGKVIGLYRDIR--
LEXA_CLOAB        ALI--ENDATIKRFFKE-KDKIRLQPENHTMDPIIVD-----NCEVIGKLAGIYRRY---
LEXA_CLOPE        ALI--ENEATIKRFFKE-NGFIRLQPENKNYEPIIVE-----DCSILGKLVGIYRAY---
LEXA_CORGL        AMI--DGEATVKEFHKD-SSGIWLLPHNDTFAPIPAE-----NAEIMGKVVSVMRKL---
LEXA_STRCL        AML--DGEATVKRFKRE-NGHVWLLPHNAAYQPIPGD-----DATILGKVVAVLRRV---
LEXA_STRCO        AML--DGEATVKRFKRE-DGHVWLLPHNSAYEPIPGD-----DATILGKVVAVLRRV---
LEXA_MYCLE        AMI--DGEATVKTFKRA-GGQVWLIPHNPAFDPIPGN-----DATVLGKVVTVIRKI---
LEXA_MYCTU        AMI--DGEATVKTFKRA-GGQVWLMPHNPAFDPIPGN-----DATVLGKVVTVIRKV---
                  .        * *           * . *                 . *            

LEXA_DEIRA        VSHRVTE--
C1D2K8_DEIDV      -SRRV----
Q7V0J4_PROMP      ---------
B0C8B3_ACAM1      ---------
B1X0G0_CROS5      ---------
LEXA_XYLFA        ---------
LEXA2_XANAC       ---------
LEXA2_XANCP       ---------
LEXA_RALSO        ---------
LEXA_PSEAE        ---------
LEXA1_PSEPK       ---------
LEXA_PRORE        ---------
LEXA_PECCC        ---------
LEXA_YERPE        ---------
LEXA_ECOLI        ---------
LEXA_SALTY        ---------
LEXA_HAEIN        ---------
LEXA_PASMU        ---------
LEXA_AERHH        ---------
LEXA_VIBCH        ---------
B2VA45_SULSY      KKGALYDEE
D8K236_DEHLB      ---------
D2R3E9_PIRSD      ---------
LEXA_RHOS4        ---------
LEXA_CAUVC        ---------
LEXA_AGRFC        ---------
LEXA_RHIME        ---------
LEXA_BRUME        ---------
LEXA_RHILO        ---------
LEXA_THEMA        ---------
LEXA_THENE        ---------
LEXA_STAAM        ---------
LEXA_STAAW        ---------
LEXA_STAAC        ---------
LEXA_BACHD        ---------
LEXA_BACSU        ---------
LEXA_LISIN        ---------
LEXA_LISMO        ---------
LEXA_CLOAB        ---------
LEXA_CLOPE        ---------
LEXA_CORGL        ---------
LEXA_STRCL        ---------
LEXA_STRCO        ---------
LEXA_MYCLE        ---------
LEXA_MYCTU        ---------