CLUSTAL format seed alignment for MF_00016

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RUVB_CHLMU      ------------MTHKISVLHQ-------------------------DKKFDFSLRPKKL
RUVB_CHLTR      ------------MTHKISVLHQ-------------------------DKKFDFSLRPKKL
RUVB_CHLPN      ------------MTHQVAVLHQ-------------------------DKKFDVSLRPKGL
RUVB_BORBU      ----------MKDENSISFLSS--------------------NENYLYDKSENELRPKVF
RUVB_TREPA      ----------MDHTASLSPVRP--------------------EAQPTDDR-ERALRPRLL
RUVB_NOSS1      ------MAIISSKKQPPEPNGQPNKRPESAPSVPKEKVLQPEAAIDEQGKQEESIRPQRF
RUVB_SYNY3      ------MAIKRSGNNNLSPNVKSDL----LSPEVIP---QERSTSPELEQQEASLRPQRL
RUVB_RHIEC      ------------MSEPARLISP----------------------EKRGEDLDITLRPQSL
RUVB_RHIME      ------------MSEAARLIAP----------------------EKRGEDLDATMRPQTL
RUVB_RHILO      ------------MSLSPRLIAP----------------------EKRGEDADQTLRPQTL
RUVB_BRUME      ------------MSDRNPLIDA----------------------DRRAD-EDNTLRPQTL
RUVB_CAUVC      ------------MTRVISGEPQ----------------------HGDLAPADRALRPQTL
RUVB_RICCN      ---------------MTNILSP----------------------EKSENDQELPIRPSYL
RUVB_RICPR      ---------------MTNILSP----------------------EKSEHDQELPIRPSYL
RUVB_HELPY      ------------MKERIVNLET----------------------LDFEISQEVSLRPSLW
RUVB_HELPJ      ------------MKERIVNLET----------------------LDFETSQEVSLRPNLW
RUVB_CAMJE      -------------MDRIVEIEK----------------------YSFDETYETSLRPSNF
RUVB_BACHD      -----------MEERMVSAEA-----------------------QTEEAAVEQGIRPHSF
RUVB_BACSU      -----------MDERLVSSEA-----------------------DNHESVIEQSLRPQNL
RUVB_LISIN      -----------MDERIISSETV----------------------DAEEVSFETSLRPQTL
RUVB_LISMO      -----------MDERIISSETV----------------------DAEEVSFETSLRPQNL
RUVB_STAAM      -----------MNERMVDQSM-----------------------HSEETDFELSLRPTRL
RUVB_STRPN      -------------MSRILDNEM----------------------MGDEELVERTLRPQYL
RUVB_STRP1      -------------MARILDNNV----------------------MGNEEFSDRTLRPQYL
RUVB_LACLA      ------------MNDILNKEP-----------------------MEEDYGIEKSLRPQFF
RUVB_CLOAB      -----------MDDRILTSVN-----------------------LEEDS-AEYNLRPQKL
RUVB_CLOPE      -----------MSERLVTSNE-----------------------IGIDSTNEYSLRPEKI
RUVB_BURCE      ---------MIETDKLAA-----ER------------IIAATPASSHEEVFERALRPRQL
RUVB_RALSO      ---------MIETDKLAAKAVSAER------------LISASPASPNEEAFERALRPKLL
RUVB_NEIMA      ---------MLQTDNLTAAQ--PQR------------IVAAQTASAQEELLERALRPKTL
RUVB_NEIMB      ---------MLQTDNLTAAQ--PQR------------IVAAQTASAQEELLERALRPKTL
RUVB_ECOLI      ---------MIEADRLISAGT---------------------TLP--EDVADRAIRPKLL
RUVB_SALTY      ---------MIEADRLISAGA---------------------TIA--EDVADRAIRPKLL
RUVB_YERPE      ---------MIEADRLISAAV---------------------IND--EESIDRAIRPKLL
RUVB_VIBCH      ---------MIEADRLIAPIS---------------------NHFKDEEVIDRAIRPKKL
RUVB_HAEIN      ---------MIEADRIISGQA---------------------KVD--EDVIDRAIRPKLL
RUVB_PASMU      ---------MIEADRIISTSA---------------------KGD--EEYIDRAIRPKLL
RUVB_PSEAE      ---------MIEPDRLISAVS---------------------GRER-DEQLDRAIRPLKL
RUVB_XYLFA      ------------MDRIIDTA-----------------------ATSEDEAIEVSIRPKRL
RUVB_MYCLE      -------MSEDYLDRDVSPALT----------------------VG-EADIDVSLRPRSL
RUVB_MYCTU      --------MTERSDRDVSPALT----------------------VG-EGDIDVSLRPRSL
RUVB_STRCO      MNWDDTTDAEAAAERLVGAAAD----------------------GE-DQAVEAALRPKDL
RUVB_DEIRA      ---------------------M----------------------TA-PENLDAALRPKTL
RUVB_THETH      -------------------------------------------------MEDLALRPKTL
RUVB_THEMA      ---------------MSEFLTPE---------------------RTVYDSGVQFLRPKSL
RUVB_MYCGE      -------------------------------------------------MKLQIKPPNTF
RUVB_MYCPN      -------------------------------------------------MKLQIKPPNNF
RUVB_UREPA      ------------------------------------------------MKTNYEFRPQYL
RUVB_MYCPU      ------------------------------------------------MAKKQEIRPKNF
                                                                        *   

RUVB_CHLMU      TEFYGQKQLKERLDLFLRAAVQRKEVPGHCLFYGPPGLGKTSLAHIMANTVGKGLVIASG
RUVB_CHLTR      TEFCGQKQLKERLDLFLRAAVQRNEVPGHCLFYGPPGLGKTSLAHIMANTIGKGLVIASG
RUVB_CHLPN      EEFYGQHHLKERLDLFLCAALQRGEVPGHCLFFGPPGLGKTSLAHIVAYTVGKGLVLASG
RUVB_BORBU      EDFKGQVNVKETLSIFIRASKERDEALDHVFLSGPPGLGKTTLASIIAFEMNASIKITSA
RUVB_TREPA      KDFLGQEKTKRNLRLFIQAARDRNESLDHLFLIGPPGLGKTTLAHITACELGVECKVTGA
RUVB_NOSS1      ADYIGQKDLKDVLDIAIKAAKSRGEVLDHLLLYGPPGLGKTTMAMILASEMGVNYKITSA
RUVB_SYNY3      ADYIGQRDLKEVLRIAIQAAQGRQEAIDHLLLYGPPGLGKTTLALILAEEMQVRCKITAA
RUVB_RHIEC      DEFTGQAEARANLKVFIEAAKNRGEALDHVLFVGPPGLGKTTLAQIMAKELGVNFRSTSG
RUVB_RHIME      DEFTGQAEARANLKIFIEAARNRGEALDHVLFVGPPGLGKTTLAQIMAKELGVNFRSTSG
RUVB_RHILO      ADFVGQAAVRANLKVFIEAAKGRNEALDHVLFVGPPGLGKTTLAQIMARELGVNFRSTSG
RUVB_BRUME      DDFVGQAAARANLKVFIEAAKVRGEALDHVLFVGPPGLGKTTLAQIMAKELGVNFRSTSG
RUVB_CAUVC      AEFVGQEQAKGNLRVFIEAAKGRGEALDHVLLFGPPGLGKTTLAQIVARELGVNFRATSG
RUVB_RICCN      QEFVGQQQIKENLSVFIKAAKSRNEHLDHTLFYGPPGLGKTTLAKIISNEIGGNFKSTSG
RUVB_RICPR      KEFVGQQQIKENLLVFIKAAKSRNEHLDHTLFYGPPGLGKTTLAKIISNEIGGNFKSTAG
RUVB_HELPY      EDFIGQEKIKSNLQISICAAKKRQESLDHMLFFGPPGLGKTSISHIIAKEMETNIKITAA
RUVB_HELPJ      EDFIGQEKIKSNLQISICAAKKRQESLDHMLFFGPPGLGKTSISHIIAKEMETNIKITAA
RUVB_CAMJE      DGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAA
RUVB_BACHD      EQYIGQEKVKQNLKVFIEAAKMREEALDHVLLYGPPGLGKTTLSTIIANELGVQMRTTSG
RUVB_BACSU      AQYIGQHKVKENLRVFIDAAKMRQETLDHVLLYGPPGLGKTTLASIVANEMGVELRTTSG
RUVB_LISIN      SQYIGQDKVKNNLTVFIEAATLRNEALDHVLLYGPPGLGKTTLAMVIASEMGSEIKTTSG
RUVB_LISMO      SQYIGQDKVKNNLTVFIEAATLRNEALDHVLLYGPPGLGKTTLAMVIASEMGSQIKTTSG
RUVB_STAAM      RQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFGPPGLGKTTLSNIIANEMEVNIRTVSG
RUVB_STRPN      REYIGQDKVKDQLQIFIEAAKMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSG
RUVB_STRP1      HEYIGQDKVKEQFAIFIEAAKRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSG
RUVB_LACLA      NQYIGQDKVKEQLEIFIKAAKMREEVLDHVLLFGPPGLGKTTMAFVIANELGVNIKQTAG
RUVB_CLOAB      NEYIGQSKVKEKMDIFIRAAKKRGEALDHVLFYGPPGLGKTTLANIIAKEMGGNLKVTSG
RUVB_CLOPE      NEYIGQDKVKERLNIFIKAAQRREEALDHVILYGPPGLGKTTLANIIANEMGGNLKITSG
RUVB_BURCE      DDYVGQEKVRGQLEIFIEAAKRRSEPLDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSG
RUVB_RALSO      DEYVGQEKVRGQLDIFMTAAKKRREALDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSG
RUVB_NEIMA      DDYIGQHKAKEQLAIFIQAAKKRGEALDHVLLFGPPGLGKTTLAHIIAKELGVNLRQTSG
RUVB_NEIMB      DDYIGQDKAKEQLAIFIQAAKKRGEALDHVLLFGPPGLGKTTLAHIIAKELGVNLRQTSG
RUVB_ECOLI      EEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSG
RUVB_SALTY      AEYVGQPQVRSQMEIFIQAAKRRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSG
RUVB_YERPE      TEYVGQPHVREQMEIFIQAAKQRGDALDHVLIFGPPGLGKTTLANIIANEMGVNLRTTSG
RUVB_VIBCH      ADYQGQDHVRDQMEIFIQAAQMRQEALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSG
RUVB_HAEIN      ADYVGQPQVREQMDIFIKAAKLRQDALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSG
RUVB_PASMU      NDYVGQPHVCEQMAIFIQAAKLRQDALDHLLIFGPPGLGKTTLANIVAHEMGVNIRTTSG
RUVB_PSEAE      ADYIGQPSVREQMELFIHAARGRQEALDHTLIFGPPGLGKTTLANIIAQEMGVSIKSTSG
RUVB_XYLFA      ADYLGQQPVREQMDIYIQATKARAEALDHVLIFGPPGLGKTTLSHVIAYELGVKLRVTSG
RUVB_MYCLE      REFIGQPRVREQLQLVIEGAKNRGATPDHILLSGPPGLGKTSLAMIIAAELGSSLRMTSG
RUVB_MYCTU      REFIGQPRVREQLQLVIEGAKNRGGTPDHILLSGPPGLGKTSLAMIIAAELGSSLRVTSG
RUVB_STRCO      GEFIGQEKVREQLDLVLRAARARGATADHVLLSGAPGLGKTTLSMIIAAEMEAPIRITSG
RUVB_DEIRA      TEYVGQEKLKDKLGVYLQAARGRREALDHTLLFGPPGLGKTTLAHIIAYELGVNIRVTSG
RUVB_THETH      DEYIGQERLKQKLRVYLEAAKARKEPLEHLLLFGPPGLGKTTLAHVIAHELGVNLRVTSG
RUVB_THEMA      DEFIGQENVKKKLSLALEAAKMRGEVLDHVLLAGPPGLGKTTLAHIIASELQTNIHVTSG
RUVB_MYCGE      DEFVGKQEIISQIQLSIKASKLNKTQLDHILLYGPPGVGKTTLARLIANELKTKLQIIQG
RUVB_MYCPN      AEFVGKQEIINQIQLSIKASRINKAQLDHILLYGPPGVGKTTLARLIASEMNTKLQIIQG
RUVB_UREPA      KDFIGKEQLKNNLKVYLTASKRLENSFDHTLLHGLSGTGKTTLALIIANEMNVNCHITQG
RUVB_MYCPU      SDFVGQNKLKKLLKVMISSAQVQNRPLDHILFYGNPGTGKTSLASIISNSLNSRIKYAQG
                  : *:      : : : .:        * :: * .* ***::: : :  :        .

RUVB_CHLMU      PQLLKPSDLIGLLTGLQE-GDVFFIDEIHRMGKTAEEYLYPAMEDFKVDITLDSGPGARS
RUVB_CHLTR      PQLLKPSDLIGLLTGLQE-GDIFFIDEIHRMGKAAEEYLYPAMEDFKVDITLDSGPGARS
RUVB_CHLPN      PQLIKPSDLLGLLTSLQE-GDVFFIDEIHRMGKVAEEYLYSAMEDFKVDITIDSGPGARS
RUVB_BORBU      PAFDKPKDIIGILTGLDE-KSVLFIDEIHRLRPIIEEMLCIAMEDYELDWVIGQGANART
RUVB_TREPA      PALDKPKDLAGILTALSE-RSVFFVDEIHRLKPAIEEMLYIAMEDYELDWVIGQGPSART
RUVB_NOSS1      PALERPRDIVGLLVNLKP-GDILFIDEIHRLSRMTEEILYPAMEDYRLDITVGKGSSARI
RUVB_SYNY3      PALERPRDITGLLLALQP-GDILFIDEIHRLNRLTEELLYPAMEDFRLDITMGKGQSAKV
RUVB_RHIEC      PVIAKAGDLAALLTNLEE-RDVLFIDEIHRLNPAVEEILYPAMEDYQLDLIIGEGPAARS
RUVB_RHIME      PVIAKAGDLAALLTNLEE-RDVLFIDEIHRLNPAVEEILYPAMEDFQLDLIIGEGPAARS
RUVB_RHILO      PVIAKAGDLAALLTNLEE-GDVLFIDEIHRLNPAVEEILYPAMEDFQLDLIIGEGPAARS
RUVB_BRUME      PVIAKAGDLAALLTNLEE-RDVLFIDEIHRLSPAVEEILYPAMEDFQLDLIIGEGPAARS
RUVB_CAUVC      PVLNKPGDLAAILTNLEA-NDVLFIDEIHRLSSNVEEILYPAMEDHVLDLVIGEGPSARS
RUVB_RICCN      PAILKVADLAAILTNLEK-NDVLFIDEIHRLNTAVEEVLYPAMEDFELDIIIGEGSAARS
RUVB_RICPR      PAIIKAADLASILTNLEK-NDVLFIDEIHRLNTLVEEVLYSAMEDFELDIIIGEGSAARP
RUVB_HELPY      PMIEKSGDLAAILTNLQA-KDILFIDEIHRLSPAIEEVLYPAMEDFRLDIIIGSGPAAQT
RUVB_HELPJ      PMIEKSGDLAAILTNLQA-KDILFIDEIHRLSPAIEEVLYPAMEDFRLDIIIGSGPAAQT
RUVB_CAMJE      PMIEKSGDLAAILTNLSE-GDILFIDEIHRLSPAIEEVLYPAMEDYRLDIIIGSGPAAQT
RUVB_BACHD      PAIERPGDLAAILTALEP-GDVLFIDEIHRLNRMVEEVLYPAMEDYCIDIVIGKGPTARS
RUVB_BACSU      PAIERPGDLAAILTALEP-GDVLFIDEIHRLHRSIEEVLYPAMEDFCLDIVIGKGPSARS
RUVB_LISIN      PAIERPGDLATILTSLEP-GDVLFIDEIHRLSRAIEEILYPAMEDYCLDIVIGTGPTARS
RUVB_LISMO      PAIERPGDLATILTSLEP-GDVLFIDEIHRLSRAIEEILYPAMEDYCLDIVIGTGPTARS
RUVB_STAAM      PSLERPGDLAAILSGLQP-GDVLFIDEIHRLSSVVEEVLYPAMEDFFLDIIIGKGDEARS
RUVB_STRPN      PVIEKAGDLVAILNDLEP-GDVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRS
RUVB_STRP1      PAVEKAGDLVAILNELEP-GDILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAGDTSRS
RUVB_LACLA      PAIEKPGDLVAILNELEP-GDVLFIDEIHRMPMQVEEVLYSAMEDFYIDIMLGSGDGSRS
RUVB_CLOAB      PAIERAGDLAAILTGLSE-YDVLFIDEIHRLNRSVEEILYPAMEDYALDIIIGKGAAAKS
RUVB_CLOPE      PAIERAGDLAAILTTLNT-NDVLFIDEIHRLNRSVEEILYPAMEDYVLDIIIGKGAASKS
RUVB_BURCE      PVLERAGDLAALLTNLEA-NDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARS
RUVB_RALSO      PVLERPGDLAALLTNLEA-NDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARS
RUVB_NEIMA      PVLERAGDLAALLTNLDP-HDVLFIDEIHRLSPVVEEILYPALEDYRLDIMIGEGPAARS
RUVB_NEIMB      PVLERAGDLAALLTNLDP-HDVLFIDEIHRLSPVVEEILYPALEDYRLDIMIGEGPAARS
RUVB_ECOLI      PVLEKAGDLAAMLTNLEP-HDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARS
RUVB_SALTY      PVLEKAGDLAAMLTNLEP-HDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARS
RUVB_YERPE      PVLEKAGDLAAMLTNLEP-HDVLFIDEIHRLSPVVEEILYPAMEDYQLDIMIGEGPAARS
RUVB_VIBCH      PVLEKAGDLAALLTNLEE-NDVLFIDEIHRLSPMVEEVLYPAMEDYQLDIMIGEGPAARS
RUVB_HAEIN      PVLEKAGDLAAMLTNLEP-HDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARS
RUVB_PASMU      PVLEKAGDLAAMLTNLEP-HDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARS
RUVB_PSEAE      PVLERPGDLAALLTNLEA-GDVLFVDEIHRLSPIVEEVLYPAMEDFQLDIMIGEGPAARS
RUVB_XYLFA      PVIEKAGDLAALLTNLQP-YDVLFIDEIHRLSPVVEEVLYPAMEDFQIDIMIGEGPAARS
RUVB_MYCLE      PALERAGDLAVMLSNLVE-HDVLFIDEIHRIARPAEEMLYLAMEDFRVDVIVGKGPGATS
RUVB_MYCTU      PALERAGDLAAMLSNLVE-HDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVVGKGPGATS
RUVB_STRCO      PAIQHAGDLAAILSSLQE-GEVLFLDEIHRMSRPAEEMLYMAMEDFRVDVIVGKGPGATA
RUVB_DEIRA      PAIEKPGDLAAILTNSLEEGDVLFIDEIHRLGRVAEEHLYPAMEDFKLDIVLGQGPAART
RUVB_THETH      PAIEKPGDLAAILANSLEEGDILFIDEIHRLSRQAEEHLYPAMEDFVMDIVIGQGPAART
RUVB_THEMA      PVLVKQGDMAAILTSLER-GDVLFIDEIHRLNKAVEELLYSAIEDFQIDIMIGKGPSAKS
RUVB_MYCGE      GHLQKPSDFLNAISLIKK-GDVLFIDEIHAVAPNVMELMYPVMDVFKIQVLIGKDFNSKI
RUVB_MYCPN      GHLQRPSDFLNAVSLIKK-GDVLFVDEIHAVAPSVMELMFPVMDDFRVQVLIGKDFNSKM
RUVB_UREPA      NLLNKPIDIINLLSLIKE-NDVVFIDEIHACGLGAFETLYSVLEDFCIDINIGKDFNSKM
RUVB_MYCPU      NLLDKKTDILTLFASVEE-NDIIFVDEIHAINKNIEELLYSILEDFVVDIVIGVESNSKI
                  . :  *:   .       .:.*:****       * :   :: . ::  :.    :  

RUVB_CHLMU      VRLDLAPFTLVGATTRAGMLSEPLRTRFAFTGRVDYYNEEDLVAILSRSA-QLLSIEANK
RUVB_CHLTR      VRLDLAPFTLVGATTRAGMLSEPLRTRFAFTGRVDYYTDEDLVSILSRSS-QLLAIEANQ
RUVB_CHLPN      VRVDLAPFTLVGATTRSGMLSEPLRTRFAFSARLSYYSDQDLKEILVRSS-HLLGIEADS
RUVB_BORBU      VRMPLPKFTLIGATTKPGKVTSPLYARFGITARFELYSEIELVEIIKRNS-LILNIEIEE
RUVB_TREPA      VRIPLPPFTLIGATTRAGMVSSPLISRFGIVERFEFYTPEELAAIVQRSA-RLLDITLDA
RUVB_NOSS1      RSIPLSKFTLVGATTRVGALTSPLRDRFGLIQKLRFYEVDELSQIVLRSA-QLLQTQVTD
RUVB_SYNY3      RSLKLAHFTLVGATTKVGSLTSPLRDRFGLIQRLRFYEVDELQQIILRTA-GILSVSISP
RUVB_RHIEC      VKIDLSKFTLVAATTRLGLLTTPLRDRFGIPVRLTFYTVEELELIVRRGA-RLMNLPMTE
RUVB_RHIME      VKIDLAKFTLVAATTRLGLLTTPLRDRFGIPVRLNFYTVEELELIVRRGA-RLMGLGMTD
RUVB_RHILO      VKIDLARFTLVAATTRLGLLTNPLRDRFGIPVRLNFYTVEELEQIVRRGA-RILQMPLGD
RUVB_BRUME      VKIDLAKFTLVAATTRLGLLTTPLRDRFGIPVRLNFYTVEELEYIVRRGA-RIMQMGISS
RUVB_CAUVC      IRIDLAPFTLVAATTRAGMLATPLRDRFGIPIRLEFYTPAELRHVLQHAA-RKMGAPLTD
RUVB_RICCN      VKITLPKFTLIGATTRLGLLSNPLRDRFGIPMRLNFYNTGELKKVLNRAS-KLLDIDLTD
RUVB_RICPR      VKITLPKFTLIGATTRFGLISNPLRDRFGIPMRLNFYNTEELKQVLNRAS-KLLDIDLTD
RUVB_HELPY      IKIDLPPFTLIGATTRAGMLSNPLRDRFGMSFRMQFYNPSELALIIKKAA-VKLNQDIKQ
RUVB_HELPJ      IKIDLPPFTLIGATTRAGMLSNPLRDRFGMSFRMQFYSPSELSLIIKKAA-AKLNQDIKE
RUVB_CAMJE      IKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAA-LKLNKTCEE
RUVB_BACHD      VRLDLPPFTLVGATTRAGMLSSPLRDRFGVMARLEYYNVEELTTIIERTA-TIFDTELER
RUVB_BACSU      VRLDLPPFTLVGATTRVGLLTAPLRDRFGVMSRLEYYTQEELADIVTRTA-DVFEVEIDK
RUVB_LISIN      VRLDLPPFTLIGATTRAGLLSAPLRDRFGVIDHLEFYTEEQLTEIVLRTS-GILDTKIDD
RUVB_LISMO      VRLDLPPFTLIGATTRAGLLSAPLRDRFGVIDHLEFYTEEQLTEIVLRTS-NILDTKIDD
RUVB_STAAM      IRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLEYYNESDLKEIIIRTA-EVLGTGIDE
RUVB_STRPN      VHLELPPFTLIGATTRAGMLSNPLRARFGITGHMEYYAHADLTEIVERTA-DIFEMEITH
RUVB_STRP1      IHLDLPPFTLIGATTRAGMLSNPLRARFGITGHMEYYQEKDLTEIVERTA-TIFEIKIDH
RUVB_LACLA      VHLDLPPFTLVGATTRAGMLSNPLRARFGISSHMEYYQERDLEEIVKRTA-DIFEVEVID
RUVB_CLOAB      IRLDLPKFTLIGATTRVGLLTAPLRDRFGVLCPMEFYNDEELKEIIVRSS-SILDIDIDE
RUVB_CLOPE      IRLDLPKFTLIGATTRIGMLSSPLRDRLGVLCSMEYYTDEQLKEIIIRSA-EILGCHITE
RUVB_BURCE      VKLDLQPFTLVGATTRAGMLTNPLRDRFGIVARLEFYDAEQLSRIVRRSA-ALLNAQIDP
RUVB_RALSO      VKLDLQPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPTELARIVTRSA-GLLDARIAE
RUVB_NEIMA      VKIDLPPFTLVGATTRAGMLTNPLRDRFGIVSRLEFYENRDLATIVSRSA-QLLQLDMSE
RUVB_NEIMB      VKIDLPPFTLIGATTRAGMLTNPLRDRFGIVSRLEFYENRDLTTIVSRSA-QLLQLDMSE
RUVB_ECOLI      IKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSA-RFMGLEMSD
RUVB_SALTY      IKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQHIVGRSA-RHMGLEMSD
RUVB_YERPE      IKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVADLEHIVSRSA-KCLGLELTP
RUVB_VIBCH      IKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEYYKVADLQHIVQRSA-QCLGLSMDS
RUVB_HAEIN      IKLDLPPFTLVGATTRAGSLTSPLRDRFGIVQRLEFYSVEDLTSIVARSA-GCLNLELEQ
RUVB_PASMU      IKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYAVEDLTSIVARSA-NCLNLSISD
RUVB_PSEAE      IKLDLPPFTLVGATTRAGMLTNPLRDRFGIVQRLEFYNVEDLATIVSRSA-GILGLEIEP
RUVB_XYLFA      IKIDLPPFTLIGATTRTGLLTAPLRDRFGIVQRLEFYSPEDLARIVRRSA-GILNIDCTT
RUVB_MYCLE      IPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPTELEGVLARAA-GILGIELGV
RUVB_MYCTU      IPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPAELERVLARSA-GILGIELGA
RUVB_STRCO      IPLELPPFTLVGATTRAGLLPPPLRDRFGFTAHMEFYGPAELERVIHRSA-GLLDVEIDP
RUVB_DEIRA      IELPLPRFTLVGATTRPGLITAPMRSRFGIIEHLEYYTAEEIATNLLRDA-RLLGFGLDE
RUVB_THETH      IRLELPRFALIGATTRPGLITAPLLSRFGIVEHLEYYTPEELAQGVMRDA-RLLGVRITE
RUVB_THEMA      IRIDIQPFTLVGATTRSGLLSSPLRSRFGIILELDFYTVKELKEIIKRAA-SLMDVEIED
RUVB_MYCGE      VEMKVNPFTLIGATTQLGKIINPLEDRFGVILNINYYSNAEIEKMVSIYG-KQMKLELNS
RUVB_MYCPN      VEMKVNPFTWIGATTQFGKIINPLEDRFGMILNIDYYSNQEIERIVSIYG-EQMELELKP
RUVB_UREPA      TRLKIPHFTLIGATTIFGKIPKSLEERFGHIFHLNEYEPSEISAIILKNNQMHFQIDLNE
RUVB_MYCPU      MRLNLKPFTFIGATTQINRISKPLRDRFGLIGQISNYQVEDIEKIIKNNS-KKLNIQIDE
                  : :  *: :.***  . :  .:  *:.    .  *   ::   :       :      

RUVB_CHLMU      ETLLEIARRARGTPRLANNLLRWVRDFAQMREGNCINSVVAEKALAMLLIDNLGLNEIDI
RUVB_CHLTR      ETLLEIARRARGTPRLANNLLRWVRDFAQMREGNCINSAVAEKALAMLLIDNLGLNEIDI
RUVB_CHLPN      SALLEIAKRSRGTPRLANHLLRWVRDFAQIREGNCINGDVAEKALAMLLIDDWGLNEIDI
RUVB_BORBU      DAAFLLARSSRGTPRIANRLLRRIRDIAQVTGSLVITSDIVSIGLEMLRIDGEGLDEQDR
RUVB_TREPA      RAALALARCSRGTPRVANRLLRRIRDFAQVAGSAHISETIVRAGLAHLKIDELGLELHDI
RUVB_NOSS1      DGATEIARRSRGTPRIANRLLKRVRDYAQVKSCAEVSQNIAAEALQLFQVDPCGLDWTDR
RUVB_SYNY3      TGAEAIAMRARGTPRIANRLLKRVRDYAQVKQQPEIDPALASEALDLYQVDKRGLDWTDR
RUVB_RHIEC      EGAREIARRARGTPRIAGRLLRRVRDFAEVARAEAVTREIADEALTRLLVDNVGFDQLDK
RUVB_RHIME      EGAREIARRARGTPRIAGRLLRRVRDFAEVARAEAVTLKIADEALTRLLVDSMGLDQLDR
RUVB_RHILO      DGALEIARRARGTPRIAGRLLRRVRDFASVAGDGHVDRLIADEALTRLEVDALGLDALDR
RUVB_BRUME      DGAREVARRSRGTPRIVGRLLRRVRDFALVAGADIIDRRIADEALSRLEVDNRGLDQLDR
RUVB_CAUVC      DGADEIAKRARGTPRVAGRLLRRVRDFATADGADRIDRKAAAMALARLEVDESGLDSLDR
RUVB_RICCN      SGSEEIAKRSRGTPRIALRLLRRIRDFAAVDGKSRVDKEISDFGLNRLEVDRIGLDSNDY
RUVB_RICPR      SGSEEIAKRSRGTPRIALRLLRRIRDFAVVDGKSRIDKEICDFGLKRLTVDSIGLDSNDY
RUVB_HELPY      ESADEIAKRSRGTPRIALRLLKRVRDFALVKNSSLMDLNITLHALNELGVNELGFDEADL
RUVB_HELPJ      ESADEIAKRSRGTPRIALRLLKRVRDFALVKNSSLMDLSITLHALNELGVNELGFDEADL
RUVB_CAMJE      KAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDL
RUVB_BACHD      DASIEIARRSRGTPRIANRLLRRVRDFAQVSGDMRISSSRAIESLERLQVDRLGLDHIDH
RUVB_BACSU      PSALEIARRSRGTPRVANRLLRRVRDFAQVLGDSRITEDISQNALERLQVDRLGLDHIDH
RUVB_LISIN      LGAREIARRSRGTPRIANRLLKRVRDFAQVRGNGTVTEKLAKEALTLLQVDPRGLDTIDQ
RUVB_LISMO      LGAREIARRSRGTPRIANRLLKRVRDFAQVRGNGTVTEKLAKEALTLLQVDPRGLDTIDQ
RUVB_STAAM      ESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQIYIETTKHALGLLQVDQHGLDYIDH
RUVB_STRPN      EAASELALRSRGTPRIANRLLKRVRDFAQIMGNGVIDDVITDKALTMLDVDHEGLDYVDQ
RUVB_STRP1      EAARKLACRSRGTPRIANRLLKRVRDYAQIIGDGIITAQITDRALTMLDVDREGLDYIDQ
RUVB_LACLA      NAALEIALRSRGTPRIANRLLKRVRDFAQIMGDGRVDKAITDKALSILDVDAAGLDYIDQ
RUVB_CLOAB      DAALEIAMRSRGTPRIANRLLKRVRDYADVKGRGIVNLDSAKKALNLLEVDDEGFDSIDN
RUVB_CLOPE      EGAFEIAKRSRGTPRIANRLLKRVRDFAEVLYDNEITEEAAKKSLEILEVDGEGFDRIDN
RUVB_BURCE      NGALEIAKRSRGTPRIANRLLRRVRDYAEVKADGQITAAVADAALAMLDVDPVGFDLMDR
RUVB_RALSO      DGALEIAKRSRGTPRIANRLLRRVRDYAEVKADGVITRAVADAALAMLDVDAVGFDLMDR
RUVB_NEIMA      EGAEEIAKRSRGTPRIANRLLRRVRDFADVKNNGTIDGGIADAALSMLDVDVQGLDVMDR
RUVB_NEIMB      EGAEEIAKRSRGTPRIANRLLRRVRDFADVKNNGTIDGGIADAALSMLDVDAQGLDVMDR
RUVB_ECOLI      DGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDR
RUVB_SALTY      DGALEVARRARGTPRIANRLLRRVRDFAEVKHDGAISAEIAAQALDMLNVDAEGFDYMDR
RUVB_YERPE      EGAHQLARRSRGTPRITNRLLRRVRDFAEVRADGAINGEVAMKALDMLNVDAEGFDFMDR
RUVB_VIBCH      EGALEVARRARGTPRIANRLLRRVRDYAEVKGDGHICAQTADRALNMLDVDHQGFDYMDR
RUVB_HAEIN      QAAFEVARRSRGTPRIANRLLRRVRDYADVRNGGIISINVAKQALSMLDVDDAGFDYLDR
RUVB_PASMU      TACYEIARRSRGTPRIANRLLRRVRDFADVRHAGIISEESAKAALLMLDVDDAGFDYLDR
RUVB_PSEAE      QGAAEIAKRARGTPRIANRLLRRVRDFAEVRGQGDITRVIADKALNLLDVDERGFDHLDR
RUVB_XYLFA      EGAAEIAQRARGTPRIANRLLRRVRDYAEVKAGGQITIEVAQAAMQMLKVDQGGFDELDR
RUVB_MYCLE      EAGAEIARRSRGTPRIANRLLRRVRDFAEVRADGVITRDVAKAALAVYDVDELGLDRLDR
RUVB_MYCTU      DAGAEIARRSRGTPRIANRLLRRVRDFAEVRADGVITRDVAKAALEVYDVDELGLDRLDR
RUVB_STRCO      TGAAEIAGRSRGTPRIANRLLRRVRDYAQVKADGLITQEIAAAALAVYEVDARGLDRLDR
RUVB_DEIRA      EAGLEIGARSRGTMRIAKRLLRRVRDYADVAGETTIGLERAQSALDKLGLDSAGLDDRDK
RUVB_THETH      EAALEIGRRSRGTMRVAKRLFRRVRDFAQVEGEEVITRERALEALAALGLDELGLEKRDR
RUVB_THEMA      AAAEMIAKRSRGTPRIAIRLTKRVRDMLTVVKADRINTDIVLKTMEVLNIDDEGLDEFDR
RUVB_MYCGE      NEISAITEHSKQTPRIAIRIVRRIFEQKIV-----NKKIDLEGLFKNLMIYKNGLQSIDV
RUVB_MYCPN      EEITQITQHSKQTPRIAIRIVKRLFEQKIV-----NKKIDLAALFKSLMIYKNGLQSIDV
RUVB_UREPA      EEIDLIANNAKGIPRLANRLLKRVVDFKI------NGFNDIKNIFKKIQIYEFGLDEQDI
RUVB_MYCPU      KATNLIALYSQNIPRLAINLLKRTKDFCIYEECQIIDYKLVNKTLKQLGIYENGLNESQV
                     :   ::   *:. .: :   :                  :    :   *::  : 

RUVB_CHLMU      KLLSVMIDFYQGGPVGMKTLAMAVGEDVRTLEDMYEPFLILKGLVQRTARGRVATPLAYE
RUVB_CHLTR      KLLSVMIDFYQGGPVGMKTLAMAVGEDVRTLEDMYEPFLILKGLVQRTARGRVATPLAYE
RUVB_CHLPN      KLLTTIIDYYQGGPVGIKTLSVAVGEDIKTLEDVYEPFLILKGFIKKTPRGRMVTQLAYD
RUVB_BORBU      NILRSLILKFNGGPVGVDTLAISVGETADSLEDFYEPYLIMKGFISRTHRGRKATEFAYL
RUVB_TREPA      QLLRVMIEHFGGGPVGAETLAISLGESPETLEDYYEPYLIQIGLMQRTPRGRMATARAYA
RUVB_NOSS1      RMLSVIIEQFNGGPVGLETIAAATGEDTQTIEEVYEPYLMQIGYLSRTPRGRTATKAAYK
RUVB_SYNY3      LVLQTLIEQFQGGPTGLEAIAAATGEDAKTIEEVYEPYLLQIGYLARTSRGRIATTAAYE
RUVB_RHIEC      RYLNMIAVNFGGGPVGIETIAAGLSEPRDAIEDIIEPYMIQQGFIQRTPRGRVLTAIAWK
RUVB_RHIME      RYLTMIAQNFGGGPVGIETIAAGLSEPRDAIEDIIEPYLIQQGFIQRTPRGRVLTANAWK
RUVB_RHILO      RYLSMIARNFGGGPVGIETIAAGLSEPRDAIEDIIEPYLIQQGFIQRTPRGRMLTANAWR
RUVB_BRUME      RYLNIIARNFGGGPVGIETIAAGLSEPRDAIEDIIEPYLIQQGFLQRTPRGRVLTAVAWQ
RUVB_CAUVC      RYLRAMIENYGGGPVGVETIAYAIAEARDAVEDVIEPYLMQQGFIQRTPRGRMACGKAYL
RUVB_RICCN      RYLKFIADNYNGGPVGIETIAAALSEQRDALEETIEPYLIQIGLLQRTPRGRVITIAAFE
RUVB_RICPR      RYLKFIADNYHGGPVGIETIAAALSEQRDELEETIEPYLIKIGLVKRTPRGRVITIAAFE
RUVB_HELPY      AYLSLLANAQ-GKPVGLNTIAASMREDEGTIEDVIEPFLLANGYLERTAKGRIATPKTHE
RUVB_HELPJ      AYLSLLANAQ-GRPVGLNTIAASMREDEGTIEDVIEPFLLANGYLERTAKGRIATPKTHA
RUVB_CAMJE      RYLELLTAAK-QKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYS
RUVB_BACHD      KLIKGIMTKFNGGPVGLETISATIGEETDTIEEVYEPYLLQIGFLQRTPRGRVVTPLAYE
RUVB_BACSU      KLLMGMIEKFNGGPVGLDTISATIGEESHTIEDVYEPYLLQIGFIQRTPRGRIVTPAVYH
RUVB_LISIN      KLLHTIIQSFRGGPVGLDTIAASIGEERETIEDMQEPYLLQIGFLQRTPRGRIATETAYN
RUVB_LISMO      KLLHTIIQSFRGGPVGLDTIAASIGEERETIEDMQEPYLLQIGFLQRTPRGRIVTETAYN
RUVB_STAAM      KMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYEPFLIQKGFLERTPRGRKATPLAYE
RUVB_STRPN      KILRTMIEMYSGGPVGLGTLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRVATAKAYE
RUVB_STRP1      KILRTMIEMYQGGPVGLGTLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRVATQKAYR
RUVB_LACLA      KILRTMIEMYHGGPVGIGTLAVNIAEDRETVEDMYEPYLIQKGFLMRTKQGRKVTQRAYE
RUVB_CLOAB      KIIQAIVNNFAGGPVGIETLSYFVGEEIDTIEDVYEPYLLQKGFIMRTPRGRMATKKAYE
RUVB_CLOPE      KILEAIIDNFNGGPVGIETLAYFVGEELDTIEDVYEPYLLQKGFIVRTPRGRMATDKAYK
RUVB_BURCE      KLLEAILHKFDGGPVGIDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRVATLLTYR
RUVB_RALSO      KLLEAILHKFNGGPVGIDNLAAAIGEERDTIEDVLEPYLIQQGYLQRTPRGRVATASAYQ
RUVB_NEIMA      KFLEAVLHKFGGGPVGLDNVAAAIGESTDTIEDVIEPYLIQQGFLQRTPRGRMATERAYL
RUVB_NEIMB      KFLEAVLHKFGGGPVGLDNVAAAIGESTDTIEDVIEPYLIQQGFLQRTPRGRMATERAYL
RUVB_ECOLI      KLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWN
RUVB_SALTY      KLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATVRAWN
RUVB_YERPE      KLLLAVIDKFMGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFIQRTPRGRIATNHAYK
RUVB_VIBCH      KLLLAIMEKFSGGPVGIDNLAAAIGEEKDTIEDVLEPFLIQQGYLQRTPRGRIATDRAYL
RUVB_HAEIN      KLLSAVIERFDGGPVGLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSQTYR
RUVB_PASMU      KLLNAVIERFDGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATSRTYR
RUVB_PSEAE      RLLLTMIDKFDGGPVGIDNLAAALSEERHTIEDVLEPYLIQQGYIMRTPRGRVVTRHAYL
RUVB_XYLFA      RLLHTIVEYFDGGPVGIESLAASLSEERGTLEDVVEPYLIQQGFLVRTARGRMATDKAYQ
RUVB_MYCLE      AVLSALTRSFGGGPVGVSTLAVAVGEEATTVEEVCEPFLVRAGMVARTPRGRVATAQAWT
RUVB_MYCTU      AVLSALTRSFGGGPVGVSTLAVAVGEEAATVEEVCEPFLVRAGMVARTPRGRVATALAWT
RUVB_STRCO      GVLEALLKLFGGGPVGLSTLAVAVGEERETVEEVAEPFLVREGLLARTPRGRVATPAAWA
RUVB_DEIRA      KYLETLIHRFAGGPVGVDTLATAISEDALTLEDVYEPYLIQLGFIKRTPRGRVATAHAYD
RUVB_THETH      EILEVLILRFGAGPVGLATLATALSEDPGTLEEVHEPYLIRQGLLKRTPRGRVATELAYR
RUVB_THEMA      KILKTIIEIYRGGPVGLNALAASLGVEADTLSEVYEPYLLQAGFLARTPRGRIVTEKAYK
RUVB_MYCGE      QYLEVLNRQ--NEPQGIKSISSMLGIDRHTIENKIEPFLLRENMIQKTKKGRIITNSGRE
RUVB_MYCPN      QYLKALNGQ--YEPQGIKSICSMLGIDKSTVENKIEPFLLRENMIQKTKKGRIITRTGRN
RUVB_UREPA      NYLNVLYRQ--DNEIGLKSIAQILRLDQYTIETKIEPYLIQHHFINKNLRGRKITIEGID
RUVB_MYCPU      KYLRSLSETFYKKAVSLDLIVGFLSLQKETIISEIEPLLISNNLIVKTPRGRKITQKGIS
                  :  :         .   :          :    ** ::    : :.  **        

RUVB_CHLMU      HLNRNPKDK-----------------
RUVB_CHLTR      HLNRNPKDRWGEE-------------
RUVB_CHLPN      HLKRHAKNLLSLGEGQ----------
RUVB_BORBU      HLNLEMKEDGLNENQRVSF-------
RUVB_TREPA      HLGLPVPEARTLTPHSPEQGTLL---
RUVB_NOSS1      HMGFTPPNEQLSLL------------
RUVB_SYNY3      HLGLTPPTPLLPWKES----------
RUVB_RHIEC      HLGMQPPKE-MEAAQFRLFQEDD---
RUVB_RHIME      HLGLNPPRD-VEASQFRLTLEDD---
RUVB_RHILO      HLGLDAPKD-LAQQQINLFQEE----
RUVB_BRUME      HLGLPAPAEIIQQSQYGLFMEDE---
RUVB_CAUVC      HLGLTPPAAPPGQAQGALFDEG----
RUVB_RICCN      HLKMPVPNQ--SHHQFNIFNENE---
RUVB_RICPR      HLKMPIPNK--SQNQLNILNENE---
RUVB_HELPY      LLKIPTLNPQTLF-------------
RUVB_HELPJ      LLKIPTLNPQTLF-------------
RUVB_CAMJE      ALKLNYEKTLFEE-------------
RUVB_BACHD      HFNMEVPNK-----------------
RUVB_BACSU      HFQMEAPRYD----------------
RUVB_LISIN      HLGISYEKEV----------------
RUVB_LISMO      HLGISYEKEV----------------
RUVB_STAAM      HFAKSNEERG----------------
RUVB_STRPN      HLGYEYSEK-----------------
RUVB_STRP1      HLGYPYQNT-----------------
RUVB_LACLA      HLGYVYNEED----------------
RUVB_CLOAB      HLKVPFNMKKNGTVNNDQCSFFKKEK
RUVB_CLOPE      HLGRVRFNESK--IDSKQCTLFEK--
RUVB_BURCE      HFGLSAPAAGSAEGSMWNTPDGA---
RUVB_RALSO      HFGLGAPKTGPARDLWDNNA------
RUVB_NEIMA      HFGLPVEK------------------
RUVB_NEIMB      HFGLPVEK------------------
RUVB_ECOLI      HFGITPPEMP----------------
RUVB_SALTY      HFGITPPEMP----------------
RUVB_YERPE      HFGITREE------------------
RUVB_VIBCH      HFGIEK--------------------
RUVB_HAEIN      HFGLQKLSD-----------------
RUVB_PASMU      YFGLEKLTE-----------------
RUVB_PSEAE      HFGLNIPKRLGPGVTTDLFTSEDGN-
RUVB_XYLFA      HLALQPRERVSAFTDPEDLF------
RUVB_MYCLE      YLCMTPPVGVTGLS-QPGLFES----
RUVB_MYCTU      HLGMTPPVGAS----QPGLFE-----
RUVB_STRCO      HLGLTPPRPQSSGNGQPDLFGA----
RUVB_DEIRA      HLGLPPGGIDDGNGIFLN--------
RUVB_THETH      HLGYPPPVGPLLEP------------
RUVB_THEMA      HLKYEVPENRLF--------------
RUVB_MYCGE      YLVNF---------------------
RUVB_MYCPN      YLTSC---------------------
RUVB_UREPA      FLKNNQLIK-----------------
RUVB_MYCPU      YLERI---------------------
                 :