CLUSTAL format seed alignment for MF_00017

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECR_HELPY      -------------------------------MNTYKNSLN----HFLNLVDCLEKIPNVG
RECR_HELPJ      -------------------------------MNTYKNSLN----HFLNLVDCLEKIPNVG
RECR_CAMJE      ----------------------------------MVKGLE----KFNELVESFANLPTIG
RECR_CHLMU      ----------------------------------MLKYPD----YISKLISFLKKLPGIG
RECR_CHLTR      ----------------------------------MLKYPD----YISKLISFLKKLPGIG
RECR_CHLPN      ----------------------------------MTRYPD----YLSKLIFFLRKLPGIG
RECR_ECOLI      -----------------------------------MQTSP----LLTQLMEALRCLPGVG
RECR_SALTY      -----------------------------------MQTSP----LLTQLMEALRCLPGVG
RECR_YERPE      -----------------------------------MQTSP----LLESLMEALRCLPGVG
RECR_VIBCH      -----------------------------------MRTSH----MLEHLMEALRCLPGVG
RECR_HAEIN      -----------------------------------MQSSP----LLEHLIENLRCLPGVG
RECR_PASMU      -----------------------------------MQTSP----LLEHLIESLRCLPGVG
RECR_PSEAE      -----------------------------------MSFSP----LIRQLIESLRILPGVG
RECR_RALSO      ----------------------------------MMRGGPGTPSALQMLIEALRVLPGVG
RECR_XYLFA      -----------------------------------MSTH-----LLEQLIDAFRILPGVG
RECR_NEIMA      -----------------------------------MSHKK--QDAFQGLIDALKVLPNVG
RECR_NEIMB      ----------------------------------MMSHKK--QDAFQGLIDALKVLPNVG
RECR_BRUME      ----------------------------------MSKRIAGP--EIERLIQLLARVPGLG
RECR_RHILO      ----------------------------------MSKRIAGP--EIERLIQLLAKVPGLG
RECR_RHIME      ----------------------------------MAKRVTGP--EIEKLIQLLAKVPGLG
RECR_RICCN      -----------------------------------MNETNDN--DIDQLIYLFSKLPGLG
RECR_RICPR      -----------------------------------MNKTND----IDQLIYLFSKLPGLG
RECR_BACHD      -----------------------------------MQYPE----PIAKLIEGFMRLPGIG
RECR_BACSU      -----------------------------------MQYPE----PISKLIDSFMKLPGIG
RECR_LISIN      -----------------------------------MHYPE----PITKLMDSFMKLPGIG
RECR_LISMO      -----------------------------------MHYPE----PITKLIDSFMKLPGIG
RECR_STAAM      -----------------------------------MHYPE----PISKLIDSFMKLPGIG
RECR_STAAN      -----------------------------------MHYPE----PISKLIDSFMKLPGIG
RECR_STRP1      -----------------------------------MLYPT----PIAKLIDSYSKLPGIG
RECR_STRTR      -----------------------------------MLYPT----PIAKLIDSFSKLPGIG
RECR_STRPN      -----------------------------------MLYPT----PIAKLIDSYSKLPGIG
RECR_LACLA      -----------------------------------MYYPE----PIARLIESFSKLPGIG
RECR_CLOAB      ----------------------------------MEFYPV----AIEKLIEEFAKLPGVG
RECR_CLOPE      ----------------------------------MEFYPV----AIEKLIEEFAKLPSIG
RECR_MYCLE      ------------------------------------MFEG----PVQNLIDELGKLPGIG
RECR_MYCTU      ------------------------------------MFEG----PVQDLIDELGKLPGIG
RECR_STRCO      ------------------------------------MYEG----VVQDLIDELGRLPGVG
RECR_SYNY3      MGKVAVNSPAHRPLVSTAVYLAPSVKFPLQKRGLGTIYTP----PLARLIEQLQRLPSVG
RECR_DEIRA      -----------------------------------MKYPP----SLVSLIRELSRLPGIG
RECR_TREPA      -------------------------------------MIP----AIEEVVEHLSRLPGIG
RECR_AQUAE      --------------------------MEDFWEDWDLAFEDVFPKSLKEALEGIKEIPTYG
RECR_MYCPU      ------------------------------------MKNQ----YIDNLILNLKKLPGVG
RECR_UREPA      -----------------------------------MSKPV----EFEMLVDALKSLPGVG
RECR_ANAMM      -----------------------------------M--------DITKLINLFAKLPSLG
                                                             .   :     :*  *

RECR_HELPY      KKSAFKMAYHLGLENPYLALKITHALENALENLKTCSSCNALSESE--VCEICSDESRQN
RECR_HELPJ      KKSAFKMAYHLGLENPYLALKITHALRNALENLKTCASCNALSETE--VSEICSDESRQN
RECR_CAMJE      KKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCEQCGALSENE--LCEICSDKERNK
RECR_CHLMU      FKSAEKIAFELLEWDPSQVEAMGLAMQEFSASHATCPDCFCLKTSKTSSCDFCS-ESRDS
RECR_CHLTR      FKSAEKIAFELLEWDPSQIEAMAQALQEFSTSHATCSNCFCLKISQTSPCNFCS-ESRDS
RECR_CHLPN      FKTAEKLAFELISWDSEQLKILGNAFHNVASERSHCPLCFTLKESKEADCHFCR-EERDN
RECR_ECOLI      PKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE--VCNICSNPRRQE
RECR_SALTY      PKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQD--VCNICSNPRRQE
RECR_YERPE      PKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE--HCTICLNPRRQQ
RECR_VIBCH      PKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQECRTFTEQD--VCHICSNPKRKE
RECR_HAEIN      PKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQCRDFTEED--TCNICNNPRRQN
RECR_PASMU      PKSAQRMAYHLLQRNRNGGMELARALTEAMSKIGHCSHCRTFTEEE--VCTICNNPRRQH
RECR_PSEAE      QKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRQCRTLSEEE--LCPQCADPRRDD
RECR_RALSO      PKSAQRMAYHLLQHDREGASRLAEALAEAAESIHHCSRCNTFTEQD--VCETCLDPRRDA
RECR_XYLFA      QKTAQRMAYHVLEREREGGQRLADVLSRAIEKIGHCTECRDFSETK--ICAICANYSRDR
RECR_NEIMA      PKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVDHCARCNTFCEGG--LCDICADETRDG
RECR_NEIMB      PKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHCAMCNTFCEGG--LCDICADETRDG
RECR_BRUME      PRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD--PCTICTDERRDP
RECR_RHILO      PRSARRAALHLIKKKEQLLSPLAAAMSEAADKVRICSTCGNVDTAD--PCMICTDPRRDA
RECR_RHIME      PRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKICSCCGNVDTID--PCTVCTDERRDQ
RECR_RICCN      IRSARRIALYLLQDKDIRLKSLINNLVEIDKKIVKCEICGNMDTEN--MCRICSSEYRDK
RECR_RICPR      IRSARRIVLYLLQDKDVRLKSLINHLIELDKKIVKCEICGNLDTKS--ICHICSSEYRDK
RECR_BACHD      PKTASRLAFFVLEMKEDDVLDFAKALVNVKRKLTYCSVCHNITDTD--PCRICEDSKRDE
RECR_BACSU      PKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVCGHITDQD--PCYICEDTRRDK
RECR_LISIN      PKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD--PCYICSDTSRDR
RECR_LISMO      PKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD--PCYICADTSRDR
RECR_STAAM      PKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND--PCYICEDKQRDR
RECR_STAAN      PKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND--PCYICEDKQRDR
RECR_STRP1      IKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD--PCHICTDTSRDQ
RECR_STRTR      AKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVCGRLTDDD--PCIICTDETRDR
RECR_STRPN      IKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD--PCSICTDPTRDQ
RECR_LACLA      QKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLSFCSICGNLTESD--PCAICTDPTRDR
RECR_CLOAB      YKTAQRLTMHVLNLPKEEVEGFADALKKARGTIKYCSVCGNYTDTD--PCAICSNPNRDK
RECR_CLOPE      KKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSVCGNFTDTD--PCAICSNPNREK
RECR_MYCLE      PKSAQRIAFHLLSVEPQDIDRLTAVLVKVRDDVRFCTVCGNVSDDE--RCRICSDTRRDA
RECR_MYCTU      PKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNE--RCRICSDIRRDA
RECR_STRCO      PKSAQRIAFHILQAEPVDVRRLAQALMEVKAKVRFCATCGNVAQEE--QCNICRDTRRDP
RECR_SYNY3      PKTAQRLALHLLKRPDAEVENLAQALLDAKKRVGQCQVCFHLSAEP--VCDICRHPQRDN
RECR_DEIRA      PKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNITDAE--KCDVCADPSRDQ
RECR_TREPA      VKLATRLAYHLLKRDPAEAQVLARGIACLHERVYRCVCCGAFCEGR--TCALCTDASRDR
RECR_AQUAE      ERGASRFMYNLLKLEKEKRKEIIEKVLEAVEVLRPCRECFLITDRE--VCPICSDEKRSK
RECR_MYCPU      TKQAEKISFFLLKQNENEVEQIINSIVDLKKNIKECQNCNFLQSNN--ICHFCMDKSRN-
RECR_UREPA      TKNANKWAFFLLQQDQKYIDDLIKRIKEAKTNILKCKYCANFTNKD--ECDICLNEYRDF
RECR_ANAMM      PASSRRIVLHLLRHRQDVMVPLAAGIRELEMHTKECTICHNLDTIS--PCSICSDKGRDQ
                   : .               :   .         *  *          .  *    *. 

RECR_HELPY      S-QLCMVLHPRDVFILEDLKDFLGRYYVLNSIEE---------VDFNALEKRLIE----E
RECR_HELPJ      S-QLCMVLHPRDVFILEDLKDFLGRYYVLNSIED---------VDFNALEKRLIG----E
RECR_CAMJE      N-ILCIVESPKDILTLEESQSYNGLYFVLDELNE---------EKLEKLKQIILK----L
RECR_CHLMU      S-FLCIVATPKDVFSFEKSKIFKGRYFVLGNLLSPITGKHLSLEKLNILKQRIED----F
RECR_CHLTR      S-SLCIVATPKDVFALEKSKIFKGHYFVLGNLLSPITGKHLSLEKLAILKQRIEA----C
RECR_CHLPN      Q-SLCIVASPKDVFFLERSKVFKGRYHVLGSLLSPITGKHIENERLSILKSRIET----L
RECR_ECOLI      NGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAE----E
RECR_SALTY      NGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAS----E
RECR_YERPE      NGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGPGDIGLDLLEKRLST----E
RECR_VIBCH      NGQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLDGIGPSDIGLDTLDYRLQR----G
RECR_HAEIN      SGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGPREIGLDLLQKRLVE----E
RECR_PASMU      SGLLCVVEQPSDIQAIEQTGQFSGRYFVLMGHLSPLDGIGPKEIGLHLLQKRLQE----E
RECR_PSEAE      S-LLCVVEGPLDVFAVEQTG-YRGRYFVLKGHLSPLDGLGPEAIGIPELEARIRD----G
RECR_RALSO      S-VLCVVETPADQMMIEQTLTYRGQYFVLMGRLSPLDNIGPKEIHLERLLARATDPALGG
RECR_XYLFA      H-QLCVVESPPDRLAIEQATGYRGLYFILQGRLSPLDGIGPHELGLDHLGQRLAA----G
RECR_NEIMA      R-RLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGMDVSAIALDRLAQRLGG----G
RECR_NEIMB      R-RLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGMDVSAIALDRLAQRLGG----G
RECR_BRUME      A-TLIVVEDVSDLWALERADTMNVRYHVLGGRLSPLDGIGPDDLNIKGLVERVAS----G
RECR_RHILO      G-TIIVVEDVSDLWALERAAAMNVRYHVLGGTLSPLDGIGPDQLNIRSLIDRVAG----G
RECR_RHIME      A-VIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGIGPEDLNIRGLIDRVAK----G
RECR_RICCN      S-IIAIVETVAELWAMERSGNFKGLYHVLGHNLSATSRQNPSILRLPELLTRCFA----E
RECR_RICPR      S-TIAIVETVAELCAMERSGNFKGLYHVLGHNLSAASRQNPRILRLPELLKRCFV----E
RECR_BACHD      S-VICVVQDAKDVIAMEKMKEYHGKYHVLHGAISPMDGIGPEDIKIPELIKRLQ----DD
RECR_BACSU      S-VICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPEDIKIPELLKRLQ----DD
RECR_LISIN      S-VLCVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPEDINIPDLLKRLQ----DD
RECR_LISMO      S-VICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPEDINIPDLLKRLQ----DD
RECR_STAAM      S-VICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPEDINIPSLIERLK----SD
RECR_STAAN      S-VICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPEDINIPSLIERLK----SD
RECR_STRP1      T-TILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPDDINLKSLITRLM----DG
RECR_STRTR      T-KILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMNGVGPDDINLKSLITRLM----DS
RECR_STRPN      T-TILVLEDSRDVAAMENIQEYHGLYHVLHGLISPMNGISPDDINLKSLMTRLM----DS
RECR_LACLA      T-TILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPDEINVKTLITRLM----DS
RECR_CLOAB      S-LVCVVEEPKDIISMEKVREFNGVYHVLHGVISPMLGKGPDSIKLRELVSRM-----NG
RECR_CLOPE      D-IICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMQGRGPQDIRIRELVARM-----SG
RECR_MYCLE      S-VVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPEQLRIRELLSRIGERVDDV
RECR_MYCTU      S-VVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDV
RECR_STRCO      S-VICVVEEPKDVVAIERTREFRGRYHVLGGAISPIDGVGPDDLRIRELLARLA----DG
RECR_SYNY3      S-VICVVSDPRDVIALEKTREFRGKYHVLGGVISPMDGIGPEQLTIQPLLHRVS----QP
RECR_DEIRA      R-TICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLHIKPLLPRV------G
RECR_TREPA      G-IICVVERAQDVEMMAGVGEYRGLFHVLGGVIAPLEGVGPDQLRIAALLKRLQ----ES
RECR_AQUAE      K-FICVVEESQDAYAIEKLERYKGVYHVLQGHIAPLEGISAEDLTIDALMERIKK----Y
RECR_MYCPU      K-QLMIFETTSDALKFEKLGIYRGKYFIIKNLIENVKNANEPKWKDKLLH-------YAS
RECR_UREPA      T-KLMIVTTNEDLERIESANIYNGLYHITNGEISLRKNVVIEHTNIKTIKERV----LNG
RECR_ANAMM      S-IICVVEELGDLWAFERGRIYSGVYHVLGGALSALSGIGPEDLNLGGIVDRIRT----H
                   : :.    :   .         :.:                    :           

RECR_HELPY      NIKEIIFAFPPTLANDSLMLYIEDKLQHF--HLTFTKIAQGVPTGVNFENIDSVSLSRAF
RECR_HELPJ      NIKEIIFAFPPTLANDSLMLYIEDKLQHL--HLTFTKIAQGVPTGVNFENIDSVSLSRAF
RECR_CAMJE      NISELIFALTHSINSDATIFFIEDKFKGL--NLTFSKIAQGIPSGVNLENVDLISLNKAM
RECR_CHLMU      APKEMIIALDATLEGDATALFLKQEFSHL--PIKISRLALGMPVGLSFDFIDSNTLARAF
RECR_CHLTR      SPKEMIIALDATLEGDATALFLKQEFSYL--PIKISRLALGMPVGLSFDFVDANTLARAF
RECR_CHLPN      CPKEIILAIDATLEGDATALFLKQELQHF--SVNISRLALGLPIGLSFDYVDSGTLARAF
RECR_ECOLI      KITEVILATNPTVEGEATANYIAELCAQY--DVEASRIAHGVPVGGELEMVDGTTLSHSL
RECR_SALTY      KISELILATNPTVEGEATANYIAELCAEA--GVEASRIAHGVPVGGELEMVDGTTLSHSL
RECR_YERPE      AISEVILATNPTVEGDATANYIGQMCGQY--GILASRIAHGVPVGGELEMVDGTTLSHSL
RECR_VIBCH      DISEVILATNPTVEGEATAQYIAELCREH--QVTASRIAHGVPVGGELELVDGTTLSHSL
RECR_HAEIN      SFHEVILATNPTVEGDATANYIAEMCRQH--NIKVSRIAHGIPVGGELETVDGTTLTHSF
RECR_PASMU      SFHEVILATNPTVEGDATANYIAELCMQQ--NIKVTRIAHGIPVGGELEMVDGTTLTHSF
RECR_PSEAE      AFSEVILATNPTVEGEATAHYIAQLLAGR--GLTLSRIAHGVPLGGELELVDGGTLAHAL
RECR_RALSO      PCAEVILATNFTSEGEATAHYIGEMLKAR--GIKVSRLARGVPVGGELEYVDAGTIARAV
RECR_XYLFA      EVTELIIATNATVEGETTAHYLALLARQH--GIRPSRLAQGLPLGGELEYLDRGTLSHAF
RECR_NEIMA      EVEEIIIATAFTAEGNATAYVLSEFFKNL--PYKVSRLSQGIPLGGELEYVDAGTLAQAV
RECR_NEIMB      EVEEIIIATAFTAEGNATAYVLSEFFKNL--PYKVSRLSQGIPLGGELEYVDAGTLAQAV
RECR_BRUME      AIKEVILAVNATVEGQTTAHYITDQLSNF--DVRVTRLAHGVPVGGELDYLDEGTLAAAL
RECR_RHILO      EVKEIILAVNATVEGQTTAHYLTDQLSGF--DIKVTRLAHGVPVGGELDYLDEGTLAAAL
RECR_RHIME      GVRELIIAVNATVEGQTTAHYITDQLEGM--EVRITRLAHGVPVGGELDYLDEGTLAAAL
RECR_RICCN      NIKEVIIATNSTLEGQTTAYFITEYLKEH--PAKISRLASGIPIGGELDYLDEGTVSAAI
RECR_RICPR      NIKEVIIATNSTLEGQTTAYFIIEYLKEH--PAKISRLASGIPIGGELDYLDEGTLSAAI
RECR_BACHD      TIQEVIVATNPTIEGEATAMYISRLVKPT--GIKVTRIAHGLPVGGDLEYADEVTLSKAM
RECR_BACSU      QVTEVILATNPNIEGEATAMYISRLLKPS--GIKLSRIAHGLPVGGDLEYADEVTLSKAL
RECR_LISIN      TIEEVILATNPNVEGEATAMYISRLLRPS--GIKVTRIAHGLPVGGDLEYADEVTLSKAM
RECR_LISMO      TIEEVILATNPNVEGEATAMYISRLLKPS--GIKVTRIAHGLPVGGDLEYADEVTLSKAM
RECR_STAAM      EVSELILAMNPNLEGESTAMYISRLVKPI--GIKVTRLAQGLSVGGDLEYADEVTLSKAI
RECR_STAAN      EVSELILAMNPNLEGESTAMYISRLVKPI--GIKVTRLAQGLSVGGDLEYADEVTLSKAI
RECR_STRP1      KVSEVIVATNATADGEATSMYISRVLKPA--GIKVTRLARGLAVGSDIEYADEVTLLRAI
RECR_STRTR      EVDEVIIATNATADGEATSMYISRVLKPA--GIKVTRLARGLAVGSDIEYADEVTLLRAI
RECR_STRPN      EVSEVIVATNATADGEATSMYLSRLLKPA--GIKVTRLARGLAVGADIEYADEVTLLRAI
RECR_LACLA      EVKEVIIATNATSDGEATAMYLARMIKPA--GIKVTRLARGLAVGSDIEYADEITLSKAV
RECR_CLOAB      KVKEVIVATNPNVDGEATAMYISKILKPL--GVKVTRIAHGIPVGGDLEYADEVTLAKAL
RECR_CLOPE      DVKEVIVATNPTIEGEATAMYISKILKPL--DVKVTRIAAGIPVGGDLEYADEVTLSKAL
RECR_MYCLE      GITEVIIATDPNTEGEATATYLVRMLRDMP-GLTVTRIASGLPMGGDLEFADELTLGRAL
RECR_MYCTU      DVTEVIIATDPNTEGEATATYLVRMLRDIP-GLTVTRIASGLPMGGDLEFADELTLGRAL
RECR_STRCO      SVTELILATDPNLEGEATATYLARMIKPM--GLKVTRLASGLPVGGDLEYADEVTLGRAF
RECR_SYNY3      EIKEVILAISPSVEGETTTLYLGKLLQPF---TKVTRIAFGLPMGGDLEYADEVTLARAL
RECR_DEIRA      QGMEVILATGTTVEGDATALYLQRLLEPL--GAAISRIAYGVPVGGSLEYTDEVTLGRAL
RECR_TREPA      SVREVILALNPTVEGDTTALYVQKILANF--PVIVTRLASGIPVGGDLEYIDRTTLAHSL
RECR_AQUAE      QPKEVILATNPNVEGEATANYIAGLIRRKFPAVKITRTAYGFQFGSLIEFVDEYSLEKSM
RECR_MYCPU      NFEEIIIALNPTIEGQITSNYIKVILEEV--ALKVTKLAQGLPINSQIDYIDPITLNLSF
RECR_UREPA      SFKEIIIATSYTHDGEVTADYIIRMLEDIK-DLQIYRIGFGIPLNSSIDYADDETLKQSL
RECR_ANAMM      GVKEVIVATSNDMDGQVTCHYIAQMVKGT--DAKVTRLACGIPLGGEIDYLDEGTLRAAL
                   *:*.*      .:     :              . . *.  .  ::  *  ::  :.

RECR_HELPY      NSRIKA------------------------
RECR_HELPJ      NSRIKA------------------------
RECR_CAMJE      NFRTKI------------------------
RECR_CHLMU      SGRNCF------------------------
RECR_CHLTR      SGRNCF------------------------
RECR_CHLPN      SGRHSY------------------------
RECR_ECOLI      AGRHKIRF----------------------
RECR_SALTY      AGRHKIIF----------------------
RECR_YERPE      AGRNPIKY----------------------
RECR_VIBCH      LGRHKLF-----------------------
RECR_HAEIN      LGRRQID-----------------------
RECR_PASMU      LGRRQLG-----------------------
RECR_PSEAE      AGRRPIS-----------------------
RECR_RALSO      LDRRQL------------------------
RECR_XYLFA      GTRTEVV-----------------------
RECR_NEIMA      YERRLIKEGGA-------------------
RECR_NEIMB      YERRLIKEGGA-------------------
RECR_BRUME      RARTTL------------------------
RECR_RHILO      RSRTAF------------------------
RECR_RHIME      RARTVI------------------------
RECR_RICCN      NLRQPFE-----------------------
RECR_RICPR      SLRQPCE-----------------------
RECR_BACHD      EGRREL------------------------
RECR_BACSU      EGRREL------------------------
RECR_LISIN      EGRREV------------------------
RECR_LISMO      EGRREV------------------------
RECR_STAAM      TGRTEM------------------------
RECR_STAAN      AGRTEM------------------------
RECR_STRP1      ENRTEL------------------------
RECR_STRTR      ENRTEL------------------------
RECR_STRPN      ENRTEL------------------------
RECR_LACLA      ENRLEI------------------------
RECR_CLOAB      EGRREI------------------------
RECR_CLOPE      EGRTVI------------------------
RECR_MYCLE      TGRRTMV-----------------------
RECR_MYCTU      AGRRVLA-----------------------
RECR_STRCO      EGRRLLDV----------------------
RECR_SYNY3      EGRREL------------------------
RECR_DEIRA      TGRQTVSKPQPPQRPGDEDGADGAAVPASR
RECR_TREPA      RGRRPLDCSEA-------------------
RECR_AQUAE      ENRK--------------------------
RECR_MYCPU      ENRK--------------------------
RECR_UREPA      INKRKIRN----------------------
RECR_ANAMM      SSRYVIT-----------------------
                  .