CLUSTAL format seed alignment for MF_00018

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y049_YERPE            ----------MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIE
Y063_YERE8            ----------MEEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMQMAEYLIE
C4K7F9_HAMD5          ----------MKIWPGQLPPREKLLKFGASALTDSELLSIFLRTGTPGLHVSEMAEKLIV
D2C187_DICZ5          -----------MTWNDGGAPREKLMSLGVEALSDAELLAIFLRTGVEGMHVMELAQSLLA
C6CP17_DICC1          -----------MEWNNGCAPREKLMSLGVEALSDAELLAIFLRTGVEGIHVMELAQNLLQ
E0SLL9_DICD3          MISHRSGRRVAMAWNDGCAPREKLMALGAGALSDTELLAIFLRTGIAGTHVMQLAESLLM
C6C6Q8_DICP7          -----------MKWNDGCAPREKLMSFGVETLSDVELLAIFLRTGVEGIHVMELAQHLLQ
Y4100_PECCP           -----------MGWEKGLAPREKLVRLGAESLTDVELLAIFLRTGLPGVHVMQLAEDLLV
Y4842_SERP5           -----MSSQGITLWPDTLAPREKLLRYGASALSDAELLAIFLRTGFPGVHVMQLAEQLLE
S4YMV2_SERPL          -----MSSQVMTLWPGALAPREKLLRYGAAALSDAELLAIFLRTGFPGLHVMQLAEQLLG
H2IY88_RAHAC          ------MTKQQDPWPGVMPPREKLLQQGAKELTDQELLAIYLRTGCQGLHVMDLAKNLLD
YICR_ECOLI            ---------MKNNSQ-LLMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLE
D2TIW3_CITRI          ----------MERVE-RVLPREKLLEQGIETLTDAELLALFLRTGTPGKDVFTLAKEILE
YICR_SALAR            ----------MDTLD-ELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVITLAKEMLQ
S5NEC5_SALBN          ----------METFD-ELLPREKMLKSGIGSLNDVELLALFLRTGTPGKDVMTLAAEILQ
Y5095_CITK8           ----------MDAPE-RLMPREKMLKSGIGSLTDVELLALFLRTGVPGKDVMALAHETLQ
A0A0H3H5N8_KLEOK      ----------MEIQE-SLMPREKMQRYGIEVLSDIELLALFLRTGTRTQDVMTFSRELLQ
A0A0H3FNX5_KLEAK      ----------MDIQE-SLMPREKMLRDGIETLSDVELLALFLRTGTRTQDVLTFSHSLLQ
R4YGA4_KLEPR          ----------MDGME-NLMPREKMLQYGIETLTDVELLALFLRVGTRRQDVLSYAQALLQ
L0LX37_ENTBF          ----------MDSSG-ALMPREKMQKMGIESLSDVELLALFLRTGTRDKDVMTWSRDLLH
E3G8J9_ENTLS          ----------MESET-PLLPREKMQRDGIESLTDAELLALFLRIGTRHRDVMSYACDLLH
A0A198GVZ2_9ENTR      ----------MEHIS-PMLPREKMLNFGITSLTDDELLALFLRTGTPGKTVFTLARELLQ
A0A0H3CEX5_ENTCC      ----------MEDEDELLLPREKLLRYGVTLLKDEELLALFLRTGTPGKTVFTLAKDLIG
Y101_ENT38            ----------MDDEL-TLLPREKMLSFGITSLTDAELLALFLRTGTSGKSVFVLAQELLQ
Y4094_CROS8           MAARHRAGKTIVKMD--NGPREKLMRYGAADLSDEELLAIFLRTGTPGMDVMTLAKRLLA
C9Y3A1_CROTZ          ----------MAKMD--YGPREKLMRYGAADLSDEELLAIFLRTGTPGMDVMKLAKRLLA
I2BEI5_SHIBC          ---------MKYDATMVMLPREKLLAFGPQALSDVELLALFLRTGRPGVHVLRFARQMLD
D4HU95_ERWAC          ----------MDENWLGLPPREKLLKCGASSLSDKELLAIFLRTGVRGVHVMTLAQQLLK
B2VF83_ERWT9          ----------MDKNWQGLPPREKLLKCGVSTLSDNELLAIFLRTGGRGVHVMSLAQRLLQ
E1SIT6_PANVC          --------------MKIRGPREKLQKLGAHSLSDTELLAIFLRTGSPGQNVLELAGQMLE
E6WAK0_PANSA          --------------MMELAPREKLALKGAEALNDEELLAIFLRTGSCGVSVMVLARQMLN
D4GE29_PANAM          ----MIQGATGRAAMNHFLPREKLKRLGADALSDAELLAIFLRTGSRGVPVMKLAQQMLQ
C5B9D5_EDWI9          ----MAQGKVEGGWPQGAPPREKLLALGAAALSDRELLALFLRTGLPGVHVIQLAERLLL
D3V735_XENBS          --MDVTVMEISDELHSNLAPREKLLAYGAVSLTDAELLAIFLRTGTRGIPVVQMAEHLLK
D3VGX9_XENNA          --MDTQAMEKHDELHLSLAPREKLLAYGAVSLTDAELLAIFLRTGTRGIPVVQMAEYLLK
C7BT25_PHOAA          --MVVDVAENTEEIYSNLAPREKLLAYGSVSLTDAELLAIFLRTGTRGVPVLRMAEFLLK
A0A140NMA9_PROSM      -----------MEYEENLQPREKLLAYGTVALTDVELLAIFLRTGRQGESVIELAERLLK
                                         ****:   *   *.* ***:::** *     *   :   : 

Y049_YERPE            TFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRES-VLLNPGITQK
Y063_YERE8            EFGSLYGLISADYQALCAQKGIGVSKYSQIQAIAELAGRCFSSHLMQES-VLQNPEITQK
C4K7F9_HAMD5          EFGSLYHLMSADYETLSAQKGMGKSKFTQIQAILELANRCFYSNLLHEN-VMLNSKITQK
D2C187_DICZ5          QFGSLYRLMTADWAAFNAVRGVGISKYAQLQAVAELARRLFSSHLARED-AMLNPDVTQQ
C6CP17_DICC1          QFGSLYQLMTADWAAFNGVRGVGISKYTQLQAVAELARRLFSSHLARED-AMLNSEVTQQ
E0SLL9_DICD3          QFGSLYQLMMADKDTFCNARGVGVSKYTQLQAVAELARRLFSSHLARED-AMLNPEVTQQ
C6C6Q8_DICP7          QFGSLYGLMTADWTAFNAVRGVGLSKYTQLQAVAELARRLFSCQLAQED-AMLSPEVTLQ
Y4100_PECCP           QFGSLYQLMTADQSAFRTAKGVGISKYTQIKAIAELSRRLFFSRLAKED-AMLNPQATGQ
Y4842_SERP5           QFGSLYHLMSADHSVFCSHKGLGNSSYSQLQAISELAFRFFSSHLAQEN-AMLNPRMTQH
S4YMV2_SERPL          QFGSLYHLMSADHQVFCSHKGLGNSSYAQLQAISELAFRFFSSHLAQEN-AMLNPKITQH
H2IY88_RAHAC          EFGSLSTLLMADFDAMARIKGMGVAKFSQLVAVSELSRRAYLRHLSAEN-AMLSPAVIRE
YICR_ECOLI            NFGSLYGLLTSEYEQFSGVHGIGVAKFAQLKGIAELARRYYNVRMREES-PLLSPEMTRE
D2TIW3_CITRI          HFGSLYSLLTADYSQFVSVTGIGVAKYAQLKGIAELARRFYEAKIKEAN-PLLSPELTQN
YICR_SALAR            RFGSLYGLLSADFAQFRGINGIGLAKFAQLKGIAELARRYYSVRMNEED-ALLSPEMTLE
S5NEC5_SALBN          RFGSLYGLLSADFAQFRGVNGIGIAKFAQLKGIAELARRYYSVRMHEEN-ALLSPEMTRE
Y5095_CITK8           RSGSLYGLLSADFAQFRG-TGIGIAKYAQLKGIAELARRYYKARMMKEN-ALLSPEMTRE
A0A0H3H5N8_KLEOK      RFGSLYGLLSAEESQFAEVEGIGLAKYAQLKGIAELARRYFSLRMTEEP-SLVTPSMTRE
A0A0H3FNX5_KLEAK      RFGSLYGLLSAEIEQFADIDGIGIAKYAQLKGIAELARRYFSLRMREEP-SLVTPLMTRE
R4YGA4_KLEPR          RFGSLYALLSADKAQLIAVDGLGLAKYAQLKGIAELARRYFSSQLVEEA-ALVAPSMTRE
L0LX37_ENTBF          HFGSLYELLSASEQDITEQYGMGLAKCAQLKGIAELARRYFSLRVLAKN-ALLSPEMTRE
E3G8J9_ENTLS          RFGSLYSLLSAPEKELMRVEGIGIAKYAQLKGIAELARRFFSVRVIVER-SLDSSDATRE
A0A198GVZ2_9ENTR      HFGSLYGLLTADLAEFKHVEGIGVAKYAQLKGIAELARRFYSVRMLEED-SLLTPDMTRE
A0A0H3CEX5_ENTCC      HFGSLYGLMTAELAEFAHVEGIGVAKYAQLKGIAELARRFQCVRMQEED-PILTPAMTRE
Y101_ENT38            HFGSLHGLLNANLDEFRYVEGIGLAKYAQLKGIAELARRYHSVRVLGDN-PLLSPEMTKD
Y4094_CROS8           HFGSLYGLLSADIRPFRDIGGVGMAKYAQLKAIGELARRYYRSRPCEET-ALLSPTITRD
C9Y3A1_CROTZ          HFGSLYGLLSADIAPFRQIGGVGMAKYVQLRAIGELARRYYRSRPNEET-ALLSPTITRE
I2BEI5_SHIBC          HFGSLRALLSADLAAFEHIDGVGVATFAQLNAVGEMSRRYYAAQIKETC-LLTSPETTRE
D4HU95_ERWAC          EFGSLHRLMNAPHDRFQAICGVGMAKYAQLNAVAELARRCFSCQEALEDQVVSSVEQMLD
B2VF83_ERWT9          EFGSLYRLMNAPHKEFQAIHGVGIAKYTQLNAVAELARRCFSCQDAFGNQVVGGVQQMLD
E1SIT6_PANVC          GFGSLYQLMTSDKAAICKIKGVGDAKLAQLHAIAELAKRFFASKLARES-VMENPQITRQ
E6WAK0_PANSA          EFGSLYRIMSSSKEELVSIKGVGVAKMTQIQAVAELGRRFFASQLAREN-VMENPQVTRH
D4GE29_PANAM          ELGSLYNIVNASAEDFKGIKGAGEIKLIQLRAVAELAKRFFASQLAREN-TLDSPLATRQ
C5B9D5_EDWI9          RFGSLQGVLRADVDTFCASQGLGIAKFAQLQAVIELSRRVLRHRIGEES-AITSPDLTAL
D3V735_XENBS          SFGSLYHLLSADYADFCSHKGMGLCKYVQLQAVSELAKRFFSSQFIHED-VMSSPVATQN
D3VGX9_XENNA          SFGSLYHLLSADYADFCSHKGMGQCKYVQLQAVSELAKRFFSSQFIHED-IMSSPTMTQS
C7BT25_PHOAA          EFGSLYHLLSADYDTFCSHKGMGLAKYAQLQAIAELAKRFFSSQFIHED-IMSSPSVTRE
A0A140NMA9_PROSM      EFGSLYLLLQADYSKLSKCKGIGVCKFSQLQAISELARRFFAEQFLYED-VISDPNLLKM
                        ***  :: :    :    * *  .  *: .: *:. *    .       :        

Y049_YERPE            FLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVNAAALIL
Y063_YERE8            FLQNILSHREREIFLVMFLDNQHRVIRHEEMFTGTISSVEIHPREIVREALKVNAAALIL
C4K7F9_HAMD5          FLQNLLSHRDREVFLVLFLNNKNRVISYEELFSGTIDTVEVHPREVLRKALTVNAAAIIL
D2C187_DICZ5          YLQLLLAHQEREVFLVMFLDNQHRVICHQEMFAGTISRVEVHPREIVREALKVNAAALIL
C6CP17_DICC1          YLQLLLAHHEREVFLVMFLDNQHRVIRHQEMFAGTISSVEVHPREIVREALRANAAALIL
E0SLL9_DICD3          YLQLLLAHHEREVFLVMFLDNQHRVIRHQEMFAGTISSVEVHPREIVREALKANAAALIL
C6C6Q8_DICP7          YLQLLLAHQEREIFLVMFLDNQHHVIRYQEMFAGTINSVEVHPREVVREALKSNAAALIL
Y4100_PECCP           YLQLLLSRREREVFLVLFLDNQHHVIRHQEMFVGTINSVEVHPREIVREALKANAAALIL
Y4842_SERP5           YLQSLLVHHEREVFLVLFLDNQHRVIRHQEMFAGTISSVVVYPREIVREALKANAAAIIL
S4YMV2_SERPL          YLQSLLAHREREVFLVLFLDNQHRVIRHQEMFAGTISSVVVHPREIVREALKANAAAIIL
H2IY88_RAHAC          YLQNLLVFREREVFLVLFLDNQHRVIRHEEMFAGTIGHVEVYPREIVRGAMKVNAAALIL
YICR_ECOLI            FLQSQLTGEEREIFMVIFLDSQHRVITHRRLFSGTLNHVEVHPREIIREAIKINASALIL
D2TIW3_CITRI          FLQSQFAGEEREIFMVIFLDTQHKVIKHSRLFSGTLSHVEVHPREIIREAIKINASALIL
YICR_SALAR            FLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLSHVEVHPREIVREAIKLNASAVIL
S5NEC5_SALBN          FLQSQLTGEEREIFLVIFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVIL
Y5095_CITK8           FLQSQLTGEEREIFLVIFLDARHRVIKHSRLFSGTLNHVEVHPREIIREAIKLNASAVIL
A0A0H3H5N8_KLEOK      FLQSQLADEEREIFMVIFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAIKVNAAAVIL
A0A0H3FNX5_KLEAK      FLQSQLADEEREIFMAIFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAIKVNAAAVIL
R4YGA4_KLEPR          FLQSQLTEEEREIFMVIFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAIKVNAAAVIL
L0LX37_ENTBF          FLQSQLSDEMREIFIVIFLDNQNRVLKHSRLFAGTLSHVEVHPREIVREAIKVNAAAVIL
E3G8J9_ENTLS          FLQSQLAQEEREIFMVIFLDNQNRVLKHTRMFAGTLSHVEVHPREIVREAIKANAAALIL
A0A198GVZ2_9ENTR      FLQSQLTDAEREIFMAIFLDNKNRVLKHCHLFSGTLNHVEVHPREIVREAIKVNAAAVIL
A0A0H3CEX5_ENTCC      FLQSQLTDIEREIFMVIFLDNRNRVLKHSHLFSGTLSHVEVHPREIVREAIKLNAAGVIL
Y101_ENT38            FLQSQLSDAEREVFMVIFLDNQHRVVKHSRMFSGTLRHVEVHPREIVREAIKVNAAAVIL
Y4094_CROS8           FLESQLAEQEREVFLVIFLDSQNRIIRQNTLFTGTLSHVEVHPREIVREAVRLNAAGIIL
C9Y3A1_CROTZ          FLESQLAEQEREMFLVIFLDSQNRIIRQNTLFTGTLSHVEVHPREIVREAVRLNAAAIIL
I2BEI5_SHIBC          FLCAELAGEQREIFIVIFLDNQHRVITWSRMFSGTLAHVEVHPREIIREALRHNAAAVIL
D4HU95_ERWAC          FLNGSLAHREREIFQVIFFDNQHRVIHTSEMFSGTLNSVEVHPREIVREALKRNAAALIL
B2VF83_ERWT9          YLNSSLAHREREIFQVIFFDNQHRVIHTSEMFSGTLNSVEVHPREIVREALKRNAAALIL
E1SIT6_PANVC          YLQSLLAHQEREIFMALFLDNQHRVLRAQNMFSGSINSVEVHPREIVREALKLNAAALIL
E6WAK0_PANSA          YLQSVLAHQEREIFMALFLDNQHHVLQAQKMFSGSINSVEVHPREIVREALKLNAAAVIL
D4GE29_PANAM          YLQTLLAEQEREIFIVMFLDNQHRVITARQMFSGSINSVEVHPREIVREALKINAAALII
C5B9D5_EDWI9          YLQNLFVSLEREIFVVLFLDNQHRVIRSEQMFSGTINCVDVYPREIVREALKLNAVALIL
D3V735_XENBS          YLQDLLSWQDREVFVVLFLTNQNKVICHDEMFKGTINKVEVHPREIVKQAVKVNAASIIL
D3VGX9_XENNA          YLQDLLSWQDREVFVVLCLTNQNKVICHDEMFKGTINKVEIHPREIVKLAVKVNAASIIL
C7BT25_PHOAA          YLQNLLSGRDREIFVVLFLNNQNKVICHEEMFKGTINKVEVHPREIVRSAIKVNASSIIL
A0A140NMA9_PROSM      RLVELFSGQEREVFTVLFLNNQHQIISYEELFRGTINRVEVHPREIIRFAMKMNASAIIL
                       *   :    **:* .: :  :::::    :* *::  * ::***::: *:  ** .:*:

Y049_YERPE            AHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
Y063_YERE8            AHNHPSGKAEPSQADRLMTTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
C4K7F9_HAMD5          AHNHPSGEPEPSQADRLITTQIIEASALLDIRVLDHIVIGHGKCVSFAERGWI
D2C187_DICZ5          AHNHPSGRAEPSQADRSITEKIVQACQLMEIRVLDHLVIGRGEYVSFAERGWL
C6CP17_DICC1          AHNHPSGRAEPSKADRSITGKIVQACQLLDIRVLDHLVIGRGEYVSFAERGWI
E0SLL9_DICD3          AHNHPSGRAEPSQADRSITGKIAQACQLLDIRVLDHLVIGRGEYVSFAERGWI
C6C6Q8_DICP7          AHNHPSGRAEPSQADRRITEHIVNACRLLEIRVLDHLVIGRGEYVSFAERGWI
Y4100_PECCP           AHNHPSGKAEPSQADRAITEQIVKACLLMEIRVLDHLVIGHGEYVSFAERGWI
Y4842_SERP5           AHNHPSGKAEPSHADRLITEQVVNACLLLEIRVLDHLVIGRGECVSFAERGWL
S4YMV2_SERPL          AHNHPSGKAEPSHADRLITEHVVNACLLLEIRVLDHLVIGRGECVSFAERGWL
H2IY88_RAHAC          AHNHPSGRAEPSLMDRKVTEQIIRACQLLEIRVLDHLVVGHGETVSFAERGWI
YICR_ECOLI            AHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI
D2TIW3_CITRI          AHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLVIGRGEYVSFAERGWI
YICR_SALAR            AHNHPSGCAEPSKADKHITDRVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI
S5NEC5_SALBN          AHNHPSGCAEPSKADKLITERVVKCCQFMDIRVLDHLVIGRGEYVSFAERGWI
Y5095_CITK8           AHNHPSGCAEPSKADKLITERVVKCCQFMDIRVLDHLVIGRGEYVSFAERGWI
A0A0H3H5N8_KLEOK      AHNHPSGSPEPSKADRLITERVIKCCRFMDIRVLDHLVIGRGAYVSFAERGWI
A0A0H3FNX5_KLEAK      AHNHPSGSPEPSKSDKLMTDRVVKCCRFMEIRVLDHLIIGRGAYVSFAERGWI
R4YGA4_KLEPR          AHNHPSGSPEPSQADRLITERVIKCCRFMEIRVLDHLVIGRGAYVSFAERGWI
L0LX37_ENTBF          AHNHPSGSAEPSKSDRLITERVVKSCQFMDIRVLDHLVIGRGEYVSFAERGWI
E3G8J9_ENTLS          AHNHPSGSAAPSRSDRMVTDKVIKCCQFMEIRVVDHFVIGRGESFSFAEHGWI
A0A198GVZ2_9ENTR      AHNHPSGCAQPSRADKEITARITKCCQFMDIRVLDHLIIGRGEYVSFAEHGWI
A0A0H3CEX5_ENTCC      AHNHPSGCAEPSRADKEITDRIVKCCQFMDIRVLDHLIIGRGEYLSFAEHGWI
Y101_ENT38            AHNHPSGCAEPSKADKDITERIIKCCQFMDIHVLDHFIIGRGEYVSFAEQGWI
Y4094_CROS8           AHNHPSGRAEPSRADKMVTERIVKSCQLVDIRVLDHLVIGRGEYVSFAERGWI
C9Y3A1_CROTZ          AHNHPSGHAEPSRADKMVTERIVKCCQLVDIRVLDHLVIGRGEYVSFAERGWI
I2BEI5_SHIBC          AHNHPSGKAEPSKADHFITRQIVHTCQSLDIRVLDHLVIGHGECVSFAERGWI
D4HU95_ERWAC          AHNHPSGLAEPSRADRDITLQIVRACSLMNIRVLDHMVIGRGEYVSFAERGWM
B2VF83_ERWT9          AHNHPSGLAEPSRADRDITQQIVHACALMNIRVLDHMVIGRGEYVSFAERGWM
E1SIT6_PANVC          AHNHPSGMAEPSRADREVTHKVSEACQLFDIRLLDHLVIGHGEYVSFAERGWL
E6WAK0_PANSA          AHNHPSGVAEPSRADREITDKISKACSLMNIRLLDHLVIGHGEFTSFAERGWL
D4GE29_PANAM          AHNHPSGRAEPSQADRDITVKICEACRLVNIRVLDHLVIGRGESVSFTERGWL
C5B9D5_EDWI9          AHNHPSGNPEPSVADRLLTDRVAKACALVDIQVLDHMVIGHGQRVSFAERGWI
D3V735_XENBS          AHNHPSGNPEPSLADKLVTEKIIDACELVGVKVLDHIVIGKQHCVSFVERGWI
D3VGX9_XENNA          AHNHPSGNPEPSLADKVVTEKIIEACDLVGVKVLDHIVIGKQYCVSFMERGWI
C7BT25_PHOAA          AHNHPSGHAEPSLADKIVTDKVIDACNLVGIQVLDHLVIGRQCCVSFAERGWI
A0A140NMA9_PROSM      AHNHPSGNPEPSDADRQVTFRIKEACTLMGIKLLDHFVVGHKNCVSFLERGWL
                      ******* . **  *: :* ::   .  . ::::**:::*:    ** *:**: