CLUSTAL format seed alignment for MF_00020

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACKA_BACSU       --MSKIIAINAGSSSLKFQLFEMPSET-------VLTKGLVERIGIADSVFTISVN--GE
ACKA1_LACSS      --MEKILAINAGSSTLKWQLFEMPSET-------VIAKGMIDRLGLSDSVFTAKYGD-NQ
ACKA_CLOAB       ---MKNLVINCGSSSIKYQFIDMKDET-------VLAKGLVERIGIKGSVITHKVN--GE
ACKA_THETC       ---MKILVINCGSSSLKYQLIESKDGN-------VLAKGLAERIGINDSLLTHNAN--GE
ACKA_ACET2       ---MNILVINTGSSSLKYQLIDMTNES-------VLAKGVCDRIGLEHSFLKHTKTG-GE
ACKA_METTE       ---MKVLVINAGSSSLKYQLIDMTNES-------ALAVGLCERIGIDNSIITQKKFD-GK
ACKA_THEMA       ---MRVLVINSGSSSIKYQLIEMEGEK-------VLCKGIAERIGIEGSRLVHRVG--DE
ACKA_SYNY3       ---MKFLILNAGSSSQKSCLYELTGDRLPETIPEPLWEAFIDWTVLANQGRLTVETA-GQ
ACKA_BORBU       ---MKILIINTGSSSLKFAIYQYENS-------KKIISGIVEKIKSQKSIIKIVNTDGST
ACKA_TREPA       ---MIILTLNCGSSSVKYQVYNWTER-------AVIAVGVVERVTQAGSVITHEVHGREN
ACKA_MYCGE       MQSHKILVVNAGSSSIKFQLFNDKK--------QVLAKGLCERIFIDG-FFKLEFN--QK
ACKA_MYCPN       MNDNKILVVNAGSSSIKFQLFDYHK--------KVLAKALCERIFVDG-FFKLEFN--EQ
ACKA_MYCCT       ----MILVINSGSSSIKFKLFDTSKA------IEPILDGLAERIGIDG-FLKFEHN--NQ
ACKA_ECOLI       MSSKLVLVLNCGSSSLKFAIIDAV-------NGEEYLSGLAECFHLPEARIKWKMDGNKQ
ACKA_HAEIN       -MSKLVLILNCGSSSLKFAILDPA-------TGEEKLSGLAEAFFLPEARIKWKLNGEKG
ACKA_BUCBP       MFNKLVLILNCGSSSLKFSVVSSD-------NYTTKLSGIVEFLNLSQIRFFWKIKKKEY
ACKA_CORGL       --MALALVLNSGSSSIKFQLVNPENSA----IDEPYVSGLVEQIGEPNGRIVLKIEGEKY
ACKA_MYCTU       -MSSTVLVINSGSSSLKFQLVEP---V----AGMSRAAGIVERIGERS------------
ACKA_HELPJ       ---MEILVLNLGSSSIKFKLFDMK-------ENKPLASGLAEKIGEEIGQLKIKSHLHHN
ACKA_RHIML       --MDALLVVNAGSSSLKFQVFGIVGMD-----LTRQIRGKVDGIGTRPRLQATAADGTQL
ACKA_RICPR       -MKDVILIANAGSSSLKISIFAIQ---------NKRVNDKIYNIFLEKNNNKILFYINQQ
                       :  * ***: *  .                                        

ACKA_BACSU       KNTEVTDIPDHAVAVKMLLNKL--TEFGIIKDLNEIDGIGHRVVHGGEKFSDSVLLTDET
ACKA1_LACSS      KFKEVQDVTTHEMAATLLLTRL--KELGIVSHLDEITGVGHRVVGGGEAFSDSMVINPVA
ACKA_CLOAB       KYVTETPMEDHKKAIKLVLDALLNDEYGVIKNIDEISAVGHRIVHGGEKYANSVLIDEDV
ACKA_THETC       KIKIKKDMKDHKDAIKLVLDALVNSDYGVIKDMSEIDAVGHRVVHGGEYFTSSVLITDDV
ACKA_ACET2       TVVIEKDLYNHKLAIQEVISALTDEKIGVIKSMSEISAVGHRIVHGGEKFKESAIIDEDV
ACKA_METTE       KLEKLTDLPTHKDALEEVVKALTDDEFGVIKDMGEINAVGHRVVHGGEKFTTSALYDEGV
ACKA_THEMA       KHVIERELPDHEEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEV
ACKA_SYNY3       KQVIILETGDRQQGIARMLDTLVTGDDAVLKSLAEIDLVGHRVVHGGTDHAEATLITPEV
ACKA_BORBU       TERFEKGIENHQKAIEKMFKILTNSDLKILKTLSEIKIIGHRVVHGGSSLKNSVILNNSI
ACKA_TREPA       HVR-ESPCPTHTEAVQLIISTLTDAHVGVISDMSLIKAVGHRVLHAADRFVKSVVVTPDV
ACKA_MYCGE       KIEEKVQFNDHNLAVKHFLNALKK--NKIITELSEIGLIGHRVVQGANYFTDAVLVDTHS
ACKA_MYCPN       KVEEKVAFPDHHAAVTHFLNTLKK--HKIIQELSDIILVGHRVVQGANYFKDSVIVDAEA
ACKA_MYCCT       KYKFEDPLPDHEHAIQLILNKLLE--LKIISNIDEIKGVGFRVVHGGE-ISHSSIINEEV
ACKA_ECOLI       EAALG---AGAAHSEALNFIVNTILAQKP-ELSAQLTAIGHRIVHGGEKYTSSVVIDESV
ACKA_HAEIN       NADLG---AGAAHTEALNFIASNILND---ELKNSIAAIGHRIVHGGEKYTQSVIVTDEV
ACKA_BUCBP       VRVIN---KSKSYDYALNYILTKILKEES-KIFNNIACVGHRVVHGGVNLNKSVLITQEI
ACKA_CORGL       TL----ETPIADHSEGLNLAFDLMDQHNCGPSQLEITAVGHRVVHGGILFSAPELITDEI
ACKA_MYCTU       -------SPVADHAQALHRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTV
ACKA_HELPJ       DQELKEKLVIKDHAIGLLMIRENLTKMGIIKDFNQIDAIGHRVVQGGDKFHAPVLVDEKV
ACKA_RHIML       IDQ----TYDAKAVRDLPAAITEARRWLLTLEGFELQAVGHRVVHGGPDYTRPVLIDATV
ACKA_RICPR       KES----TTSIKD-DPIEMMINLFEEWWKKQSALNLIATGHRIVHGGKNFNKPVVVNKKV
                                                    :   *.*:: ..     . :     

ACKA_BACSU       IKEIEDISELAPLHNPANIVGIKAFKEVLP--NVPAVAVFDTAFHQTMPEQSYLYSLPYE
ACKA1_LACSS      LDEINRLAEYAPLHNPTQAYYIKIFTALLP--GVPQVAVFDTSFYSTLAPENYLYSIPQE
ACKA_CLOAB       MKSIEDCVSLAPLHNPPHIIGINACKELMP--NVPMVAVFDTAFHQTIPDYAYMYAIPYE
ACKA_THETC       LKAITDCIELAPLHNPANIEGIKACKQIMP--DVPMVAVFDTAFHQTMPDYAYLYPIPYE
ACKA_ACET2       MKAIRDCVELAPLHNPSNIIGIEACKQILP--DVPMVAVFDTAFHQTMPRHAYIYALPYE
ACKA_METTE       EKAIKDCFELAPLHNPPNMMGISACAEIMP--GTPMVIVFDTAFHQTMPPYAYMYALPYD
ACKA_THEMA       LKAIEEVSPLAPLHNPANLMGIKAAMKLLP--GVPNVAVFDTAFHQTIPQKAYLYAIPYE
ACKA_SYNY3       QQAIADLIPLAPAHNPAHLEGIEAISALLVLGEVPQIAVFDTAFHRTIPTPAAEYPIP-Q
ACKA_BORBU       LNKLKQISELAPLHNPNAITAIEAVLKILPHAK--QVLCFDTSWHQTIKEHAFLYAIPYS
ACKA_TREPA       LETFRSVQDLGPLHNPANIRGIEAAQAVIPSVP--HCAIMDTAWHQTMPEASFMYAVPRQ
ACKA_MYCGE       LAKIKEFIKLAPLHNKPEADVIEIFLKEIKTAK--NVAVFDTTFHTTIPRENYLYAVPEN
ACKA_MYCPN       LAKIKEFIKLAPLHNKPEADVIEIFFKEVPSAK--NVAVFDTTFHTTIPQENYLYAVPRS
ACKA_MYCCT       LQKIQESVKLAPLHNPAAIIAIKAVKKLMPNTS--MIACFDTAFHQTMPQVNYLYSVPYK
ACKA_ECOLI       IQGIKDAASFAPLHNPAHLIGIEEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYN
ACKA_HAEIN       VKGIEDAAQFAPLHNPAHLIGIREAFKAFPHLKDKNVVVFDTAFHQTMPEEAFLYALPYS
ACKA_BUCBP       IKLITDACSFAPLHNPINLLGIKASHAVLPHLKEKNVAVFDTSFHSSIPKFAYLYAIPYK
ACKA_CORGL       VEMIRDLIPLAPLHNPANVDGIDVARKILPDVP--HVAVFDTGFFHSLPPAAALYAINKD
ACKA_MYCTU       IGKLEELSALAPLHNPPAVLGIKVARRLLANVA--HVAVFDTAFFHDLPPAAATYAIDRD
ACKA_HELPJ       MREIGNLSILAPLHNPANLAGIEFVQKAHPHIP--QIAVFDTAFHASMPSYAYMYALPYE
ACKA_RHIML       LDHLAGYQDLAPLHQPNNLAPIRLAMEINPDVP--QVACFDTAFHRGHAKHTDCYALPRS
ACKA_RICPR       IKELRVLIPLSPLHQPYNLQVLDLFFQKYKAIS--HIICFDTSFHCTNSPITKAFGLPKQ
                    :      .* *:      :                 :** :.         : :  .

ACKA_BACSU       YYEKFGIRKYGFHGTSHKYVTERAAELLGRPLKDLRLISCHLGNGASIAAVEGGKSIDTS
ACKA1_LACSS      YYQTFGARKYGAHGTSHRYVAHRAAEILGTPLESQKMITLHLGSGASITAVQDGHAVDTS
ACKA_CLOAB       YYDKYKIRKYGFHGTSHKYVSRTAAEFIGKKVEDLKMVVCHMGNGASITAVENGKSVDTS
ACKA_THETC       YYTKYKIRKYGFHGTSHKYVSQRAAEILNKPIESLKIITCHLGNGSSIAAVKNGKSIDTS
ACKA_ACET2       IYEKYKLRKYGFHGTSHKYVAHRAAQMLGKPIESLKLITCHLGNGASICAVKGGKSVDTS
ACKA_METTE       LYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETS
ACKA_THEMA       YYEKYKIRRYGFHGTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTS
ACKA_SYNY3       AWTNLGIRRYGFHGTSHKYCAQKTAEILGKPLADLKLITCHIGNGASLTAIKNGVSIDTT
ACKA_BORBU       WYKNHNIRKYGFHGLSYSYITKRSSEILNKKIDSLNLIILHLGNGASINAVKNGKSYDTS
ACKA_TREPA       WYEEYAVRRYGFHGTSFLYTAKRASVILKKRAEDTNIIIAHIGNGASMCCVKNGVSFDTS
ACKA_MYCGE       WEKNNLVRRYGFHGTSYKYINEFLEKKFNKK--PLNLIVCHLGNGASVCAIKQGKSLNTS
ACKA_MYCPN       WEQKHLVRRYGFHGTSYKFINNYLEKHLNKQ--NLNLIVCHLGNGASVCAIKNGKSFNTS
ACKA_MYCCT       WYEEFGVRKYGFHGISYEYIVNKCEEILNKKKEHLNLIVCHLGNGASISCIKDGKSYDTS
ACKA_ECOLI       LYKEHGIRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTS
ACKA_HAEIN       LYKEHGVRRYGAHGTSHYFVSREVAKYVGKPADQVNAIICHLGNGGSVSVVRNGQCIDTS
ACKA_BUCBP       FYKKFGIRKYGAHGISCQYSVCRSSELLQIELTSLNIIICHLGGGASVSVVKNGVCVDTS
ACKA_CORGL       VAAEHGIRRYGFHGTSHEFVSKRVVEILEKPTEDINTITFHLGNGASMAAVQGGRAVDTS
ACKA_MYCTU       VADRWHIRRYGFHGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASASAIARGRPVETS
ACKA_HELPJ       LYEKYQIRRYGFHGTSHHYVAKEAAKFLNIPYEEFNAISLHLGNGSSAAAIQNGKSVDTS
ACKA_RHIML       FYDE-GVRRYGFHGLSYEYIAERLREVASRAA-KGRVVVAHLGSGASMCGLRDGRSIEST
ACKA_RICPR       YYDK-GIMRYGFHGLSYQYVSSHFKEITMEDL-PPKAIIAHLGSGSSLCAIKNGLSLTSS
                         :** ** *  :                . :  *:*.*.*   :  *    ::

ACKA_BACSU       MGFTPLAGVAMGTRSGNIDPALIPYIMEKTGQTADEVLNTLNKKSGLLGIS-GFSSDLRD
ACKA1_LACSS      MGFTPLAGITMGTRSGDIDVSLVAFLAKKLEITMPEMIDILNHKSGLLGIS-ELSPDMRD
ACKA_CLOAB       MGFTPLGGLAMGTRSGDMDPAVVTFLMDKLNINASEVNNLLNKKSGIEGLS-GISSDMRD
ACKA_THETC       MGFTPLEGLAMGTRSGSIDPSIISYLMEKENISAEEVVNILNKKSGVYGIS-GISSDFRD
ACKA_ACET2       MGFTPLQGLCMGTRSGNVDPAVITYLMEKEKMNINDINNFLNKKSGVLGIS-GVSSDFRD
ACKA_METTE       MGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVS-GLSNDFRD
ACKA_THEMA       MGFTPLEGLVMGTRSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRD
ACKA_SYNY3       MGFTPLEGLMMGARSGSIDPAILLFLQETQGLTPAEINTTLNKKSGLLGVS-GLSADLRT
ACKA_BORBU       MGITPLEGLAMGTRSGDIDPSIINLMSTILNKTTKQIEEILNKESGILGIS-EKSNDMRD
ACKA_TREPA       MGITPLEGLIMGTRCGDCDPALAFYIMRKTGMSVSDIDTTLNKQSGLLGIT-GKYVDRRD
ACKA_MYCGE       MGFTPLEGLIMGTRSGDIDPAIVSYIAEQQKLSCNDVVNELNKKSGMFAIT-GSS-DMRD
ACKA_MYCPN       MGFTPLEGLIMGTRSGDLDPAIIGYVAEQENMSASDVVNALNKKSGMLALT-GAS-DMRD
ACKA_MYCCT       MGLTPLAGLMMGTRSGDIDVSICEYVAKQTNSDIFAITQILNKQSGLLGLS-QTSADMRD
ACKA_ECOLI       MGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDAINKLLTKESGLLGLT-EVTSDCRY
ACKA_HAEIN       MGLTPLEGLVMGTRCGDIDPAIVFYLYKTLGMSMDQIEETLVKKSGLLGLT-EVTSDCRY
ACKA_BUCBP       MGLTPLEGLIMGTRSGDIDPSVIFFMNKQLNLSISTINNILINKSGLLGLS-GVSSDFRN
ACKA_CORGL       MGMTPLAGLVMGTRSGDIDPGIVFHLSRTAGMSIDEIDNLLNKKSGVKGLS-GV-NDFRE
ACKA_MYCTU       MGLTPLEGLVMGTRSGDLDPGVISYLWRTARMGVEDIESMLNHRSGMLGLA-GE-RDFRR
ACKA_HELPJ       MGLTPLEGLIMGTRCGDIDPTVVEYIAQCANKSLEEVMKILNHESGLKGIC-GD-NDARN
ACKA_RHIML       MLHRPSTGCRWDT-PGQLDPGVVLYLILQKGMKAQAVSDLLYHDAGLKGLS-GLSNDMRD
ACKA_RICPR       MGFSVLDGVMMATRPGNLDPGVVLYLINNEKMTINEITELLYKKSGLLGMS-GESSDMRT
                 *      *    :  *. *  :   :          :   : : :*: .:      * * 

ACKA_BACSU       IVEATKE-GNERAETALEVFASRIHKYIGSYAARMS--GVDAIIFTAGIGENSVEVRERV
ACKA1_LACSS      LEETAAT-R-PQSALALSIFVNRVVKYVGSYVALMN--GIDTLVFTAGSGENGSELRADI
ACKA_CLOAB       IKKGNYVDKDPKAMLAYSVFNYKIKQFIGSYTAVMN--GLDCLVFTGGIGENSFENRREI
ACKA_THETC       LEDAAFKNGDKRAQLALNVFAYRVKKTIGSYAAAMG--GVDVIVFTAGIGENGPEIREFI
ACKA_ACET2       VQDAAEK-GDDRAQLALDIFCYGVRKYIGKYIAVLN--GVDAVVFTAGIGENNAYIRREV
ACKA_METTE       LDEAASK-GNRKAELALEIFAYKVKKFIGEYSAVLN--GADAVVFTAGIGENSASIRKRI
ACKA_THEMA       IEEAALK-GDEWCKLVLEIYDYRIAKYIGAYAAAMN--GVDAIVFTAGVGENSPITREDV
ACKA_SYNY3       ILQAKAE-GNEQAQLAYVMYIHRFRSCLGQMIASLE--GLDTLVFTAGVGENAATVRADV
ACKA_BORBU       IWNKIE-EGEYQSKLAVEIMTYRIKKYIGSYIAALD-FNVDAIVFTGGIGVTDYGIRALA
ACKA_TREPA       VCAAMK-NGDALARLAFDMEVHRIRKYFGAYVAALG-KQPDALVFTAGVGEMCCDVRAAA
ACKA_MYCGE       IFDKPE-IND----IAIKMYVNRVADYIAKYLNQLS-GEIDSLVFTGGVGENASYCVQLI
ACKA_MYCPN       VFAKPQ-ENA----VAIKMYVNRVADYIAKYLNQLE-GNIDGLVFTGGIGENASDCVELF
ACKA_MYCCT       VLEQYD-RNDKKAIIAVEKYVQVVADFIVKYANYLD--SIDAVVFTAGIGENADVIRDLI
ACKA_ECOLI       VEDNY--ATKEDAKRAMDVYCHRLAKYIGAYTALM-DGRLDAVVFTGGIGENAAMVRELS
ACKA_HAEIN       AEDNYDDESKPETRRALNVYSYRLAKYIGAYMAVLGDDHLDAIAFTGGIGENSAHVRELA
ACKA_BUCBP       LESEY--NSNIRIKLAIDMFCYRLSKYISGYMSVV-KGKLHGIVFTGGIGENSSLVRSIV
ACKA_CORGL       LREMID-NNDQDAWSAYNIYIHQLRRYLGSYMVAL--GRVDTIVFTAGVGENAQFVREDA
ACKA_MYCTU       LRLVIE-TGDRSAQLAYEVFIHRLRKYLGAYLAVL--GHTDVVSFTAGIGENDAAVRRDA
ACKA_HELPJ       IEVRKE-KGDKQAKLAFEMCVYRIKKYIGAYMVVL--KKVDAIIFTGGLGENYSALRESV
ACKA_RHIML       LLASDD----PHAALSVAHFVYRCVLNGGMLAAALG--GIDAFVFTAGVGENSPPIRARI
ACKA_RICPR       LIASNS----HDSKFAVDLFVYRIVLEIGKLIAALE--GIDCLIFTAGVGQNSPVIREMI
                                                   :     . . **.* *          

ACKA_BACSU       LRGLEFMGVYWDPALN--NVRGE-EAFISYPHSPVKVMIIPTDEEVMIARDVVRLAK---
ACKA1_LACSS      CKQLACFGVKLDEEKN--NVRSQ-ERIISADDSKVKVLIVPTNEELMIARDVMRLK----
ACKA_CLOAB       CKNMDYLGIKIDDKKND-ETMGI-PMDISAEGSKVRVLVIPTNEELMIARDTKDIVGKLK
ACKA_THETC       LDGLEFLGFKLDKEKN--KVRGE-EAIISTADSKVNVMVVPTNEEYMIAKDTEKIVESLK
ACKA_ACET2       LKDMDFFGIKIDLDKN--EVKGK-EADISAPDAKVKTLVIPTNEELEIARETLRLVKNL-
ACKA_METTE       LTGLDGIGIKIDDEKN--KIRGQ-EIDISTPDAKVRVFVIPTNEELAIARETKEIVETEV
ACKA_THEMA       CSYLEFLGVKLDKQKNEETIRGK-EGIISTPDSRVKVLVVPTNEELMIARDTKEIVEKIG
ACKA_SYNY3       CQAFEFLGLKLDPELN--NRSPR-DTVISHSDSLVTVLIVHTEEDWAIAQDCWHWWHSQG
ACKA_BORBU       LKGFEKIGIELDLEKNEMAQSKYLESEISTINSKLKILAIPTNEESTILEDIYNLIPKNL
ACKA_TREPA       CAGLEHLGIRLDARKNELARTRNAETEISTDDSPVRILVIPTDEELVMTEDTYALMQGTY
ACKA_MYCGE       IEKVASLGFKTNSNLF-GNYQDS--SLISTNESKYQIFRVRTNEELMIVEDALRVSTNIK
ACKA_MYCPN       INAVKSLGFATDLKLF-VKYGDS--CVVSTPQSKYKIYRVRTNEELMIVEDSIRLTQK--
ACKA_MYCCT       CKRVKLLGLQIDQEKNESKYSDY--KLISSEKSKIPVYAIRTNEEKMICLDTLNLIK---
ACKA_ECOLI       LGKLGVLGFEVDHERN-LAARFGKSGFINKE-GTRPAVVIPTNEELVIAQDASRLTA---
ACKA_HAEIN       LNHLKLFGIKIDNERN-LATRFGKDGVITTDDSAFKAIVLPTNEELVIAQDTAKLCF---
ACKA_BUCBP       ISKLAFLNFKLNSDIN-MLMKSGKEGFINIK-NTFPILVIPANEELIIAKESFSEIN---
ACKA_CORGL       LAGLEMYGIEIDPERN-ALPNDGPR-LISTDASKVKVFVIPTNEELAIARYAVKFA----
ACKA_MYCTU       LAGLQGLGIALDQDRN-LGPGHGAR-RISSDDSPIAVLVVPTNEELAIARDCLRVLGGRR
ACKA_HELPJ       CEGLENLGIALHKPTN-DNPGSALV-NLSQPNTKIQILRIPTDEELEIALQAKEMVEKIK
ACKA_RHIML       VEGLAWLGAELDPAAN-----EAGAALISTATSRVAVHVLPTDEELMIARHTLALISAPN
ACKA_RICPR       SKKLSWLGIKIDYEKN-----QKNEHRISTKGSKIKVFVVPTNEELIIAEEVMKFL----
                    .   .   .               :.          : ::*:  :            

ACKA_BACSU       --------------------------------------------
ACKA1_LACSS      --------------------------------------------
ACKA_CLOAB       --------------------------------------------
ACKA_THETC       --------------------------------------------
ACKA_ACET2       --------------------------------------------
ACKA_METTE       KLRSSIPV------------------------------------
ACKA_THEMA       R-------------------------------------------
ACKA_SYNY3       QRKQS---------------------------------------
ACKA_BORBU       --------------------------------------------
ACKA_TREPA       DVHTRFTYSFQDPTYVNKARAAGLKRDLEKNPALATIVVPRLDT
ACKA_MYCGE       K-------------------------------------------
ACKA_MYCPN       --------------------------------------------
ACKA_MYCCT       --------------------------------------------
ACKA_ECOLI       --------------------------------------------
ACKA_HAEIN       --------------------------------------------
ACKA_BUCBP       --------------------------------------------
ACKA_CORGL       --------------------------------------------
ACKA_MYCTU       A-------------------------------------------
ACKA_HELPJ       VV------------------------------------------
ACKA_RHIML       A-------------------------------------------
ACKA_RICPR       --------------------------------------------