CLUSTAL format seed alignment for MF_00022

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYE_SORC5       ----MRLLFGDAAASARRPEEYEARYPRRALPKGAMVTRYAPSPTGFMHIGGIFVSLINK
SYE_HUNT2       MDYKKLADMLFPHITKSVSYYEDVVFPARNLSPGAKVTRLAPSPTGFIHLGNLYGAFVDE
SYE2_HELHP      ----------------------------M--------LRFAPSPTGDMHIGNLRAAIFNY
SYE2_SULNB      ----------------------------M--------LRFAPSPTGDMRTEQLRIAIFNY
SYE1_NEOSM      --------------------------MI---------TRFAPSPTGLIHLGNARTALIAY
SYE1_RICTY      ------------------------MTKVI--------TRFAPSPTGMLHVGNIRVALLNW
SYE2_JANSC      -----------------MSAPMSASTSVV--------TRFAPSPTGFLHVGNLRTALFNF
SYE_MYCPN       ------------------------MEKIR--------TRYAPSPTGYLHVGGARTAIFNF
SYE_GLOVI       ----------------MNFEQYESAYPPRALPPGAWVTRIGPSPTGKAHIGTALQAVINR
SYE_CUTAK       ---------------------MTDLHPAR--------TRVAPSPTGDPHVGTAYMALFDK
SYE_LACP7       ------------------------MAKVR--------TRFAPSPTGRMHVGNLRTALYEY
SYE_CHLT3       ----------------------MSEQTIR--------TRFAPSPTGYLHVGGLRTALYNF
SYE_PARUW       -------------------------MSVR--------VRIAPSPTGDPHVGTAYMALFNM
SYE_PELUB       ------------------------MSKVA--------TRFAPSPTGALHIGGVRTALFNW
SYE_RHOBA       --------------------------MIR--------TRFAPSPTGYLHIGGVRTALFNW
SYE_HERA2       --------------------MSDRPTPAR--------TRFAPSPTGYLHIGSLRTVLFSW
SYE_TROWT       ----------------------MRDPRVR--------VRFCPSPTGAPHLGLVRTALFNW
SYE2_ACIF5      ------------------MAQYYTTMNLK--------SRFAPSPTGYLHLGNARTALFAW
SYE_BDEBA       -------------------MSSKISPHVR--------VRFAPSPTGYLHVGGARTALYNY
SYE_PROMP       -------------------------MEKH--------LRLAPSPTGLLHIGTARTALFNW
SYE_SOLUE       --------------------------MHR--------VRFAPSPTGFLHIGSARTYIFNW
SYE1_LACBA      -----------------MSENSTVKKNVR--------VRYAPSPTGFLHIGNAQSALFNY
SYE_DESPS       ------------------------MTETR--------LRFPPSPTGYLHIGGARTALYNW
SYE_METI4       ----------------------MNKMIPR--------VRFAPSPTGFLHVGGARTALFNW
SYE_ENDTX       ------------------------MSGIR--------VRFAPSPTGDLHIGGVRTALFNW
SYE2_HELAH      ------------------------MSLIA--------TRFAPSPTGYLHIGGLRTAIFNY
SYE_MYXXD       -----------------------MPPALR--------VRFAPSPTGYLHIGGARTALMNF
SYE_ECOLI       -------------------------MKIK--------TRFAPSPTGYLHVGGARTALYSW
SYE_BUCBP       -------------------------MIIK--------TRFAPSPTGPLHIGSVRTALYAW
SYE_THEFY       ----------------------MTDKAIR--------TRFAPSPTGMFHVGGARSALFNW
SYE_SYMTH       -------------------------MTVR--------VRIAPSPTGPIHVGNVHTALFNW
SYE1_KORVE      ----------------------MSDKKVR--------ARFAPSPTGQLHVGNARTALFNW
SYE_LEPIC       ---------------------MNQSKEVR--------TRFAPSPSGFLHVGGARTALFNY
SYE2_PETMO      ----------------------MISNTVR--------TRFAPSPTGYLHVGGARTALFNY
                                                      *  ***:*  .       .   

SYE_SORC5       RLSLQS-EGVFYLRLEDTDVKRAIPGALDTIVDSLARFDLSPQEGVLRAPAKDGDASSRG
SYE_HUNT2       RLAHQS-NGVFILRIEDTDDKRKVEGAVETIISSLEFFNLKFDEGAGINGET--------
SYE2_HELHP      IIAKQQ-NQKFLIRIEDTDIARNIVDKDKEILNLLNLFGLLWDNL---------------
SYE2_SULNB      IVAKQK-EVNFIVRIEDTDKERNITGKDTEILQILEKFAITHDSV---------------
SYE1_NEOSM      FAARSS-GGEFILRIDDTDVTRIKSEYVNKIFTDLSWLGIKEDLC---------------
SYE1_RICTY      LYAKKH-NGKFILRFDDTDLERSKQKYKNDIERDLKFLNINCDQI---------------
SYE2_JANSC      LIAKKA-GGEFILRLDDTDPERSTQAFADAIQEDMEWLGLTWDRI---------------
SYE_MYCPN       LLAKHF-NGEFIIRIEDTDTERNVEGGIESQLENLRWLGIIPDES-----IYN-------
SYE_GLOVI       SLADGS-GGAFLLRIEDTDRERFVEGAIEDLLAALDWLGIRPDESV----AHG-------
SYE_CUTAK       AWAQRT-GGQFVLRIEDTDRTRLVADSEDQIYQTLEWLGLSPDESP----LVG-------
SYE_LACP7       LIAKHE-GGDFILRIEDTDQERLVEGATEIIYRTIAKTGLIHDEGP----DKD-------
SYE_CHLT3       LFAKKN-GGQFLLRLEDTDRARLVEGAVENLLSSLEWAGIIPDESP----KHG-------
SYE_PARUW       IFARHY-NGTFILRIEDTDRARSRPEYEENIYSALKWANIQWDEGP----DIG-------
SYE_PELUB       LYSKNK-NGTFHLRIEDTDKERSKDEHKIQIIKSLKWIGIDHDGDE--------------
SYE_RHOBA       LLAKQA-GGQFILRIDDTDAGRNVDAALKPILDGFRWLGMDWDEGP----DVG-------
SYE_HERA2       LWARHT-GGQFLLRIEDTDRKRFVEGAEEQLTSSLQAIGLMWDEGP----IVG-------
SYE_TROWT       VFARKH-GGGFIFRIEDTDATRNREESCSQLIDTLKWLGLDWDEGP----DKG-------
SYE2_ACIF5      LAARGA-GGTFILRLEDTDQQRSPEIYERALLEDLRWFGIDWDEGP----DRG-------
SYE_BDEBA       LFAKKN-GGEFILRIEDTDEARSTQESLRGVVDDLVWLGLKWDEGVDPVTLKD-------
SYE_PROMP       LYARKI-NGKFLIRIEDTDIVRSKSEYTTNILNGLNWLGLNWDEE---------------
SYE_SOLUE       LFARHH-GGTMILRIDDTDVGRNSDASETSIFDGLAWLGLDWDEQ---------------
SYE1_LACBA      LFARHY-HGTMVLRIEDTDVKRNVPHGEDSQIDNLHWLGIDWDEGP---DKPN-------
SYE_DESPS       LYAKQH-GGKLVLRIEDTDTERSTEESIKGIVDGLDWLGIDFDEG---------------
SYE_METI4       LYARHF-KGTFILRIEDTDQSRNTPQALSVIFDNLSWLGLDWDEGPLPDGSSK-------
SYE_ENDTX       LFAKNK-GGKFILRIEDTDETRSTGESAKVILDAMKWLELEWNEGP---GNEN-------
SYE2_HELAH      LFARAN-QGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEI--------------
SYE_MYXXD       LQARRQ-GGTFVLRMEDTDQGRSTPESVQAILDGLNWLGIDWDEGP----GKE-------
SYE_ECOLI       LFARNH-GGEFVLRIEDTDLERSTPEAIEAIMDGMNWLSLEWDEG---------------
SYE_BUCBP       LFAKSM-NGKFVLRIEDTDKRRSTNAFTSEIINNLEWLGLNWDEG---------------
SYE_THEFY       ALALQQPEGKFVLRIEDTDAARNRPEWTEGILRALSALGID-ERDP----HFE-------
SYE_SYMTH       LFARHH-GGKFILRFEDTDLERSRPEWEQVIFEDLKWLGIDWDEGP----DIG-------
SYE1_KORVE      LFARQQ-GGTMILRIEDTDLERSEARYEQQLLDDLKWMGINWDEGP----DVG-------
SYE_LEPIC       LYAKSQ-GGKFILRIEDTDQNRSTEDSFKIILESLKWLGVNWDEGP----EVG-------
SYE2_PETMO      LFSKKN-EGKFILRIEDTDIERSTKESEDQLINTLKWLNLNWDEGP----IIG-------
                  :       : .*::***  *            :    :  :                 

SYE_SORC5       EFVQQGSYGPYIQTER--VEIYRDYAIDLIRRGFAYPCFCTVEELDAIRQEQMALTVK--
SYE_HUNT2       -----GNYGPYFQSNR--AEIYQTVAKHLVEMGRAYPCFCSEEELEEIRKQQLAENVN--
SYE2_HELHP      ----------VYQSSN--FERHRQLAQHLISKDLAFYCYCSKEFLESKRLEAKEQKKP--
SYE2_SULNB      ----------FHQSEH--LNIHQTLAIRLLEEGKAFVCTCTPEAPESDKTPS--------
SYE1_NEOSM      ----------IKQSER--CELYANAVVKLKESGRIYPCYETPEELEIERRSLLARALP--
SYE1_RICTY      ----------FNQLSR--VSRYNEIKNLLINKKRLYACYETTEELELKRKFRLSKGLP--
SYE2_JANSC      ----------ERQSDR--FDRYAAAADELRAKNRFYEAWETPTELDLKRKKQLNMHQP--
SYE_MYCPN       ----PGNYGPYIQSQK--LATYKKLAYELVGKGLAYRCFCTKEKLEHERQLALEHHQT--
SYE_GLOVI       -----GAYGPYVQSER--LPIYQAAARQLVEVGHAYYCFCTPERLESVRMAQQAAGKP--
SYE_CUTAK       -----GPYEPYKQSER--LDTYKPLVEKLIESGHAYRCWCSQERLKQLREERAAAKSP--
SYE_LACP7       -----KGFGPYVQSERQATGIYLKYAKELVENGEAYYCFCTKERLETLKSAVGEEDGE--
SYE_CHLT3       -----GDFGPYVQSER--LDIYKQYVQQLLDEKKAYYCFATPDELEESRQLQIKQGVQ--
SYE_PARUW       -----GAYGPYRQSER--FDIYKQYAEELLSKGKAYKCFCTAAELDEMRELSAKQGGR--
SYE_PELUB       ----------YIQSTK--INDHVNVANELLKNGHAYKCYCSSAEIEEQKKRARQKKLP--
SYE_RHOBA       -----GPHGPYFQSER--GDQYRAAAEKLLADGHAYRDFAKPEELQTLREEAQKGGEA--
SYE_HERA2       -----GPHAPYKQSER--LEIYQAHAQALIDKGVAYRSYATADEIAAINAEREARGEP--
SYE_TROWT       -----GQFGPYYQSQR--GDIYQEVLDKLLAADLAYESFSTKEEIE---KRNLEAGRPIQ
SYE2_ACIF5      -----GDHGPYRQMER--LAVYGRYYAHLQSSGQAYACYCSADDLAAERAVQRSAGKA--
SYE_BDEBA       ----VGPNGPYRQSER--LHIYKEIADQLLKEGKAYYCFMTEEDIEKQKAAAGSF-----
SYE_PROMP       ---------PINQSKR--VSVHKNYIKRLLESGAAYRCFTSESEILDLREKQKKSGLP--
SYE_SOLUE       ----------YRQSER--LPLHRAMADAILTKGMAYRDFTPAQAGDSEKSGAQGT-----
SYE1_LACBA      -----PKYAPYHQTER--QDLYHRYITQLLDQGLAYKDYATEDELTTMRDQQRAAGEA--
SYE_DESPS       ---------PYFQTDF--ASDHKSAAQKLLDSGQAYKCFCSKESLDEKREAALAAKKS--
SYE_METI4       -----GQFGPYFQSQR--KEIYNEYCNRLIAKELAY------------------------
SYE_ENDTX       -----LKYSPYSQMKRKERGIYRKYADELVAKELAYPCYCTPEEIDVMRKKAKADKLP--
SYE2_HELAH      ----------LYQSKR--FEIYKECIQKLLNEDKAYYCYMSKDELDALREKQKVRKET--
SYE_MYXXD       -----GPYAPYFQMQR--LDTYRKHADQLIAEGKAYRCYCTKEDLDAQRQVAEKAGGA--
SYE_ECOLI       ---------PYYQTKR--FDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQMAKGEK--
SYE_BUCBP       ---------PYFQSDR--LEYYRNIIKKMVEAGLAYKCYCTNDRLLKLRKFQISLGKK--
SYE_THEFY       -----G---PYFQSAY--ADKHREVAEELYRKGRAYYCDCTREQIQERR------GNP-H
SYE_SYMTH       -----GPYGPYRQTER--LDLYRKYAQQLLESGHVYKCYCTKEEEDADRREAQAAGRP--
SYE1_KORVE      -----GPFPPYRQSDK--IDVYREHAERLVAEGKAYYCFCSQADLDAYREQALKDHRP--
SYE_LEPIC       -----GEYGPYIQSQR--LNIYKEYTEKLLKEKKAYRCFCTQEELEAKKKQSEAMGVP--
SYE2_PETMO      -----GDYEPYRQSER--LEIYQRRAKELIEKGKAYEAYISPEEIEEVKNQLISEGKPPH
                            *        :      :      :                        

SYE_SORC5       P----GVHGRWAK---WRDAPLARVKEALAGGTPFVLRLRAPDDVSGRVE-WKDGVKGVI
SYE_HUNT2       T----GYYGKWAV---HRNLTLEEVQKHLENNESFVIRFKSMGNPEETFE-IDDAIRGRL
SYE2_HELHP      F----RYDPS------WAEIEKS-------SNTKPVVRIRGA---SEAIS-FEDAIKGTL
SYE2_SULNB      -----RYNGK------CFNVDKEELKRLKEEKIPFVIRLKKP---EHDMI-IHDLYKGET
SYE1_NEOSM      P----VYRRK---------------NRPQHSTRLPYYRFELD---PDRVVIWEDKLRGKI
SYE1_RICTY      P----IYDRA------SLNLTEKQIQKYIEQGRKPHYRFFLN---DEPIS-WYDMIKGDI
SYE2_JANSC      P----VYDRA------ALALTDDQKEALRAERGQGVWRFKLD---HQRIE-WTDGILGDL
SYE_MYCPN       P----KYLGT------CRNLHSKHIQTNLDNQVPFTIRLKIN-Q-DAEFA-WNDQVRGKI
SYE_GLOVI       T----MYDRH------CRNLGREEVEKRLATGEKAVVRLKVP---DGTEIAFDDLARGRI
SYE_CUTAK       E---TGYDRM------CLGMSKEERAKLPGFTETPVVRMLIP-E-DVDLE-FDDLIRGTV
SYE_LACP7       SKEITKYDKH------CLHLSKEEVEANLAAGMPYVIRQNMP-T-EGTTS-FTDAIYGTI
SYE_CHLT3       P----KYNRKWLPEDMGGSMPQSEIQKRLDAGEPCVIRMKIP-D-HTRIR-HDDIIRGIV
SYE_PARUW       Q----GYDRR------CRHLTPDEIIEREQAELSYVIRLKVP-L-NGECV-YEDAIKKRM
SYE_PELUB       Y----VYNRK------CRDLQETNAP----TIIKPVIRFKIK-I-EGTSV-LKDLVQGDV
SYE_RHOBA       F----VYDRR------WMAEDEATAAKFEAEGRQGVVRLKMP-R-EGQCV-IQDLIRGEV
SYE_HERA2       -----KLLV-------FRNLPGIDDAAREAAGADYNVRLSLK-T-TGQTV-VQDLVRGQI
SYE_TROWT       L----GYDNY------DRTLSEQTKAAMREAGRTPIIRLRMD---DENIA-FEDLVKGEV
SYE2_ACIF5      P----RYGGR------CRHLDAAARAEREAAGLLPTLRFRVP-D-QGTLT-VPDLVWGER
SYE_BDEBA       A----HLVSP------YQDWTLDQALERLKTGDKAVVRFKTK-NLVKDYI-FTDLVRGEV
SYE_PROMP       P----KHDNR------HRNLTRKEIKEFISQGKSSVIRFKID-E-ETEIK-WEDQIRGEI
SYE_SOLUE       W----LFNAG------MRELSREESDRRAAAGEPFALRFRVPHDREGSVQ-FTDAVYGEQ
SYE1_LACBA      P----HYDGR------WYGRSVADQQAAEARGLKPSIRLHLP-A-NHEYA-WDDIIKGHV
SYE_DESPS       L----GYDGT------CRNLTAEQIAEKEAAGAPYVLRFRVP-E-CESVS-YEDKIAGTI
SYE_METI4       -----IKDEA--------------------------VYFRMP---RKRII-VSDLICGDI
SYE_ENDTX       P----KYDGK------CRHLTPGQRKQKEIEGKKAVVRFKMF-G-SGTTV-LNDIIRGRV
SYE2_HELAH      P----RYDNR------YRD-----FKGTPPKGIEPVVRIKIP-Q-NELIC-FNDGIKGEV
SYE_MYXXD       F----KYPGT------CRERTEPPAGR---NAADAVIRFKMP-AGDGSVS-FTDKALGTI
SYE_ECOLI       P----RYDGR------CRH-----SHEHHADDEPCVVRFANP-Q-EGSVV-FDDQIRGPI
SYE_BUCBP       P----KYDRK------CRYLVKKDI-----LSTDYVIRFCNP-D-FGCVT-FCDKIRGKI
SYE_THEFY       L----GYDGY------CRD-------RGLEPGPGRALRFRVP-E-GGPTV-VDDKIRGRV
SYE_SYMTH       Y----QYKGR------CRDLTPEQQAAFEAEGRKPVLRFRVP-R-GEVIR-FNDLVRGPI
SYE1_KORVE      P----IYPGT------CRSVDPAEAKRRRDSGEAGAIRLRIP---ERPIR-FHDIVHGDV
SYE_LEPIC       Y----VYDGL------HANMSDEEVQEKLKQGIPYSVRFKTP---SKTLI-INDIIQGKV
SYE2_PETMO      Y----TYDLI------SKYNTKERIEEYNYKGLKPVIFLKMP---QKDYE-LDDKIKGKV
                                                                     *      

SYE_SORC5       SMPVNDL---DTILLKSD-----GIPTYHFAHAIDDHLMRTTHVIRGDEWISSMPLHLQL
SYE_HUNT2       SMQVNF---QDIVLLKAN-----GIPTYHFAHVVDDHLMRVTHVVRGEEWLSTLPIHYEL
SYE2_HELHP      RFEAHEI--DSFVILKED-----GIPTYNFACAIDDMLYDISFIVRGEDHVSNTPRQILI
SYE2_SULNB      VTSADEV--DSFVILRAD-----ATPTENFASACDDMLSGIDFIIRSEEHLDETAKQEYV
SYE1_NEOSM      VIDLHST--SDPIVIREN-----GTYTYMLPSVVDDIECRISTIIRGEDHISNTAVQIQM
SYE1_RICTY      KYNGKAL--SDPIVIRAD-----GSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQIQM
SYE2_JANSC      SIDAASV--SDPVLIRAD-----GQVLYTIASVVDDTDMGVTHVVRGSDHVTNTATQIQI
SYE_MYCPN       TIPGNSL--TDIVLLKAN-----GIATYNFAVVIDDHDMEITDVLRGAEHISNTAYQLAI
SYE_GLOVI       AFESQTI--DDSVLLKSD-----GFPTYHLAVVVDDHLMRVNQIIRGEEWIPSTPKHVLL
SYE_CUTAK       --RAPRP--DDQVILKAD-----GFPTYHMAVVVDDHLMGIDTVVRGEEWISSTPKHLLL
SYE_LACP7       TVENSEL--DDMILIKSD-----GFPTYNFANVIDDHFMEITHVVRGNEYLSSTPKYTRL
SYE_CHLT3       WFDSSTV--DDQVLMKSD-----GFPTYHLASVVDDHLMNITHVIRGEEWLSSTPKHLLL
SYE_PARUW       TFPWADI--DDQVLLKSD-----GFPTYHLANVVDDYLMKISHVIRGDEWMSSTPKHILL
SYE_PELUB       EIENTTI--EDFIILRND-----GTPTYNLSATVDDHQMKMTHIIRGDDHKINTFKQMQI
SYE_RHOBA       VVEWASE--QDHVIARAD-----GSPLYHLASVVDDHELKITHVVRAAEHLPNTARQVFI
SYE_HERA2       VFDNAALKMPDPVLLKTD-----GFPTYALAAMVDDHLMGITHVLRADEWIPTWPIHHQI
SYE_TROWT       VFTDPI---PDFALTRAS-----GEPLYTLVNPVDDAFMKITHVLRGEDLLSSTPRQIAL
SYE2_ACIF5      HYALADL--GDFVIRRSD-----GSPAFFFANAVDDALMEVNLVLRGEDHLTNTPRQILI
SYE_BDEBA       KFPSDMV--GDFVLLRSD-----GMPVYNFCCVVDDHLMKMTHVFRAEEHLPNTLRQLMI
SYE_PROMP       KWQGKDLG-GDLVLSRRALGDEIGNPLYNLAVVVDDNFMNITHVVRGEDHISNTAKQILI
SYE_SOLUE       AKGYGDI--EDFALLRSD-----GMPTYHLANCADDADLRISHIIRGQEHLSNAFKHKLI
SYE1_LACBA      AFNSDNMG-GDFIIEKSN-----GMPTYNFAVVIDDYLMDITDVLRGDDHIANTPKQIAV
SYE_DESPS       RVARSEI--DDFVIVRSN-----GAPLYLLCNVVDDIRDRISHVIRGQDHMTNTIKQILL
SYE_METI4       YFDCSLE--KDFVIRRKD-----GSFVFHLVNVVDDLEMQISHVIRGEDHLSNTPKHIAL
SYE_ENDTX       KFDNSLL--DDFVIMKAS-----GVPAYNFACVVDDYLMEITHVLRGDDHISNAPRQMHI
SYE2_HELAH      RVNTNEL--DDFIIARSD-----GTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVL
SYE_MYXXD       TKTHSDL--DDWVMMRAD-----GIPVYNFGCVIDDHLMDITLVARGQEHVNSTFPQLML
SYE_ECOLI       EFSNQEL--DDLIIRRTD-----GSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINI
SYE_BUCBP       SIENKEL--DDLVIQRAD-----GIPTYNFCVVIDDRDMNITHVIRGEDHISNTPRQINI
SYE_THEFY       EFDHSAI--EDFVIARSD-----GSPLFVLANVVDDVEMAITHVVRGEEHLSNTPKQQLL
SYE_SYMTH       EVPTDSI--GDFIIMRAN-----GMPLYNFAVVVDDVTMNITHVLRGEGHIPNTPVQILI
SYE1_KORVE      EFSNEVV--SDPIILRSS-----GVPVYNYVVVVDDAEMQITHVIRGDDHLSNTPKQVAL
SYE_LEPIC       KFETKLI--GDFIIVKSD-----GFPSYNYAVVVDDALMKITHVIRGVGHLSNTPRQILL
SYE2_PETMO      IFKKGSI--GDFIILRSN-----GIPTYNFAVVVDDIEMKITHVIRGDDHLPNTLRQMAI
                          .  : .       .          **       : *.            :

SYE_SORC5       FRTL-----GFR-PVEYAHVPPIQKLDRVEEVDPETGETKVSDARRKLSKR-K-------
SYE_HUNT2       FTTL-----GWD-LPVYCHTAHLMKID--------------NGVKRKLSKR-K-------
SYE2_HELHP      HRAL-----GYDKVLGYAHLPIILG----------------ES-GSKMSKR-D-------
SYE2_SULNB      KKQL-----GYEEETTYAHLPVILN----------------EE-GQKMDEK-D-------
SYE1_NEOSM      FEAL-----GCTEIPKFAHMPLLKL----------------QT--GKMSKR-A-------
SYE1_RICTY      FEAL-----NKI-PPVFAHLSLIIN----------------KE--EKISKR-V-------
SYE2_JANSC      MEAL-----GKS-APSFAHHSLLTG----------------PQ-GEALSKR-L-------
SYE_MYCPN       NQAL-----GYQRIPRFGHLSVIVD----------------KS-GKKLSKRDT-------
SYE_GLOVI       YQYF-----GWP-MPRIAHTPILRD----------------MS-RRKLSKR-S-------
SYE_CUTAK       YKWL-----GWE-APKFAHMPLLRN----------------TD-KSKISKR-K-------
SYE_LACP7       YKAF-----GWE-EPVYIHCPLITN----------------EE-HQKLSKR-S-------
SYE_CHLT3       YDFF-----GWE-KPEFAHLPLLLN----------------PD-RSKLSKR-Q-------
SYE_PARUW       YESF-----GWT-PPTFLHMPLLLG----------------KD-GKKLSKR-K-------
SYE_PELUB       YLAM-----SWD-LPNFAHIPLIHT----------------IE-GKKLSKR-D-------
SYE_RHOBA       AQSL-----GYE-LPIYAHLPYVAE----------------PGGSAKLSKR-KLDKYKKN
SYE_HERA2       YEAF-----GWE-QPVWVHVPQVLG----------------SD-GKKLSKR-H-------
SYE_TROWT       YKALITIGITDY-VPFFGHLPIVMG----------------EG-NRKLSKR---------
SYE2_ACIF5      LQAL-----GLP-VPAYGHLPLLLG----------------AD-GQPLSKR-Y-------
SYE_BDEBA       YEAM-----NWP-TPEFGHMALILD----------------ED-RQKLSKR-K-------
SYE_PROMP       YKAL-----NFK-LPIFAHTPLILN----------------SE-GKKLSKR---------
SYE_SOLUE       FDAA-----GAE-SPTFAHLPLLMA----------------PD-GMKLSKRVH-------
SYE1_LACBA      YEAL-----GLK-HPNFGHITLIYN----------------PKTRKKLSKRDK-------
SYE_DESPS       YEAL-----DAP-IPVFAHMPLTLD----------------NK-RAKISKRSH-------
SYE_METI4       FEAL-----GMS-PPLYAHIPLILN----------------PS-GTKMSKR-D-------
SYE_ENDTX       YNAL-----GWE-MPEFAHMSMILG----------------AG-GARLSKR-H-------
SYE2_HELAH      YKAL-----NFK-IPNFFHVPMILN----------------EE-GQKLSKR-H-------
SYE_MYXXD       YQAL-----GWT-PPDFAHLPLILG----------------PD-REKLSKR-K-------
SYE_ECOLI       LKAL-----KAP-VPVYAHVSMING----------------DD-GKKLSKR-H-------
SYE_BUCBP       LRAL-----NAN-IPIYAHVSMVLS----------------ED-KQKLSKR-N-------
SYE_THEFY       WEAL-----GQT-PPVWAHLPVIVN----------------EK-RQKLSKR-R-------
SYE_SYMTH       YQAL-----GFP-VPEFGHLGHMTN----------------PE-RGKLSKR-K-------
SYE1_KORVE      YEAL-----GWA-VPEFAHLSTILG----------------PD-RERLSKR-H-------
SYE_LEPIC       YEAL-----GYN-IPEFAHASEIVG----------------MD-GKKLSKR-A-------
SYE2_PETMO      YEAF-----EVE-PPIFAHVSMILG----------------PD-GKKLSKR-H-------
                                  *                            :.:.         

SYE_SORC5       --------------------------DPEANIAYYR-EIGVPETGTIEYLLNIANSAFED
SYE_HUNT2       --------------------------DPELGLEYYM-QLGYHPAAVREYLMTILNSNFEE
SYE2_HELHP      --------------------------NAS-SVAWLL-EEGFLPQAIMNYLISMGNHTP--
SYE2_SULNB      --------------------------DAF-TVKWLF-EEGYIPDAIANYLISLGNTTP--
SYE1_NEOSM      --------------------------GGN-EIQTFR-ENYIEPEVICLYLLNLGSKS---
SYE1_RICTY      --------------------------GGF-EIAYLKNEVGLEAMTITSFFSLLGSSLHI-
SYE2_JANSC      --------------------------GTL-ALRDLR-EAGMEPMALLSHMARIGSSQPV-
SYE_MYCPN       --------------------------KTIQFIEQFK-QEGYLPEAVVNFLALLGWNSDFN
SYE_GLOVI       --------------------------GDT-SITGYR-VQGYLPEGLRNFLTRIIWPHPEG
SYE_CUTAK       --------------------------NPAARLMWFR-EQGYLPEALRNFLQLLAYPTVAE
SYE_LACP7       --------------------------GHS-SFEDLI-EQGFVTEAIVNFIALLGWSSTTN
SYE_CHLT3       --------------------------GDV-AVEDYM-AKGYSKDALVNFVALLGWNEGEG
SYE_PARUW       --------------------------NPT-SIFFYR-DSGYLSEAFINFLTLMGYSMTGD
SYE_PELUB       --------------------------NAS-TLDDYS-KIGIMPDALRNYLLRLGWSYQD-
SYE_RHOBA       RDFAVLLAHGEKIAERCNMQVDADTFNPV-LVDFYR-EIGFLPDALLNYLLLLGWSLDGE
SYE_HERA2       --------------------------GDT-SVTEYI-DLGFVPEAIINYLALIGWSYDDK
SYE_TROWT       --------------------------NPESDFYFYK-ARGFIREGLLNYLSLLGWSISNS
SYE2_ACIF5      --------------------------GAA-SLRDLR-KDGYLAAALRNYLARLGHHYSA-
SYE_BDEBA       --------------------------GAV-ACGQLK-DEGYLASAVLNFIALLGWSDPQG
SYE_PROMP       --------------------------DSVTSIDEFK-EMGYLPEALANYMAFLGWSIKSP
SYE_SOLUE       --------------------------GPVVSVTTYR-DAGFLPQAFINFLSLLGWSPKND
SYE1_LACBA      --------------------------ETLQFISQYK-NQGYLSEAIFNFIAFLGWSPEGE
SYE_DESPS       --------------------------GEIVAVQFYR-DHGFLPWALNNFLAMLGWSAGDD
SYE_METI4       --------------------------KGS-SVQEYI-DEGFLPQAFRNYLCLLGWSLKEN
SYE_ENDTX       --------------------------GHT-SVLEYR-KEGYLREALINYLALLGWSTEDS
SYE2_HELAH      --------------------------GAT-NVMDYQ-EMGYLKEALINFLARLGWSYRD-
SYE_MYXXD       --------------------------HPEADVMVHK-RNGVMPEALLNFVIRLGWSHGN-
SYE_ECOLI       --------------------------GAV-SVMQYR-DDGYLPEALLNYLVRLGWSHGD-
SYE_BUCBP       --------------------------NTITSISEYR-LCGYLPESLLNYIVRLGWSHGN-
SYE_THEFY       --------------------------DKV-ALEDYL-AEGYLPEAMVNYLMLLGWGPGDD
SYE_SYMTH       --------------------------GEA-AIRDYR-EQGYLPEAMLNFMSLLGWTPPGA
SYE1_KORVE      --------------------------GAT-SIATFR-EMGVLPEALVNYIALLGWAPTGG
SYE_LEPIC       --------------------------GAT-SILAFR-DLGYLPETFRNYMALLGWTSTDG
SYE2_PETMO      --------------------------GAT-SVEEFM-VQGYLPEAVDNYLALLGWSHPEG
                                                                ..  :       

SYE_SORC5       ---WRKANPDKPYSAFPLKLNKLAPGGALSD----------------------------M
SYE_HUNT2       ---WRIQNPDSDINDFPFSLNKMSNSGALFD----------------------------L
SYE2_HELHP      ---TEVFKLQDAYNWF--DIKNIAKSPVKFD----------------------------I
SYE2_SULNB      ---TDIFTLPEAIEWF--NITKLSGSPVKFN----------------------------I
SYE1_NEOSM      ---RSTFKNYKDYSNF--NLENYSSSSSVTV----------------------------L
SYE1_RICTY      ---FPYKSIEKLVAQF--EISSFSKSPTIYQ----------------------------Q
SYE2_JANSC      ---ELAGSVEELAEGF--DLNHFGSAPTKFD----------------------------V
SYE_MYCPN       ---REFFTINQLIESF--TVNRVVGAPAFFD----------------------------I
SYE_GLOVI       ---KDVYDHEEFVRLF--KAEDLPNTGPIVD----------------------------P
SYE_CUTAK       G--QEMEDFDSFVSRF--DWGNVSTGGPVFD----------------------------V
SYE_LACP7       ---EEIFSLEELVREF--DYTHINKSPSVFD----------------------------M
SYE_CHLT3       VE-QEVYSMNELIEKF--TLEKVGKSGAVFN----------------------------V
SYE_PARUW       ---QEIYSLDDIIREF--DYKRIGVSGAIFD----------------------------V
SYE_PELUB       ---KEIFTLKESIELF--NLEGIGKSPSKLD----------------------------M
SYE_RHOBA       ---TEKFTIAEMIEKF--TLDRVNKAPASFD----------------------------P
SYE_HERA2       ---TEFMTLEELIERF--DLNRIRPSGGVFD----------------------------R
SYE_TROWT       ---RDTFSLSEMIHAF--DVRDVRGNPARFD----------------------------Y
SYE2_ACIF5      ---TGFLDSRALAQGF--ALNQISRAPSHFD----------------------------M
SYE_BDEBA       ---REILSVKDMLEVF--DISRLNPSGAIFD----------------------------R
SYE_PROMP       E--SEILSLSEISKVF--NLSDVNKAGAKFN----------------------------W
SYE_SOLUE       ---REKLSREEMVELF--TLEGINRANAVVN----------------------------F
SYE1_LACBA      ---DELFSREELIERY--DPARMSKSPAYFD----------------------------Q
SYE_DESPS       ---KEFYTKEELLKAF--SLERINKSSSIFN----------------------------Y
SYE_METI4       ---REIFGIEEAIAKF--DLPQIHRSNARFN----------------------------H
SYE_ENDTX       ---QQIFTIEELKQKF--SVERCGISPSIFD----------------------------P
SYE2_HELAH      ---KEIFSMQELLELF--DPKDLNSSPSCFS----------------------------W
SYE_MYXXD       ---DEVISREQMLEWF--DFSDVGTTSGVWN----------------------------P
SYE_ECOLI       ---QEIFTREEMIKYF--TLNAVSKSASAFN----------------------------T
SYE_BUCBP       ---QEIFSISEMIKYF--TLESLNKSSSCLN----------------------------K
SYE_THEFY       ---REIMPFSEMVPLF--RLEDVNSSSAFFD----------------------------E
SYE_SYMTH       ESGREFLTKEELIREF--DLSRVTKASSVFD----------------------------R
SYE1_KORVE      T--REIFRPEELVKEF--DLRRVTPSPAIFD----------------------------F
SYE_LEPIC       ---REFLPGDELEKIF--DVHRCSKSPSTFDVFKKPKGSDEEVVTNFSDLTQIAEAMNPK
SYE2_PETMO      ---KEILPLSEIIDNF--TLDRVNSSPAIFD----------------------------E
                               :                                            

SYE_SORC5       V----------KLKSVSQAV-VSRMSAEDVYAQGLDW---------AREHDKELAALMER
SYE_HUNT2       D----------KLNDVSKNV-LAKIPAEEIYEFLLKW---------AKEYKKEIVNLLEE
SYE2_HELHP      K----------RLRFLNREH-LKMLNEQEFALLLDSK-----------DSSIGALG----
SYE2_SULNB      E----------ELRLLNRKH-LEKMDDKRLSSLF----------------GFADA-----
SYE1_NEOSM      ED---------EIYSLNADF-LRLSNYEDLARRLGGV----------------SKTF---
SYE1_RICTY      Y----------DLERLNHKL-LISLDYHEVKERLKEI-----------NADYIDENF---
SYE2_JANSC      E----------DLWPLTASV-LHGTAFEDVAGEIAAL---------GVPADIAPAF----
SYE_MYCPN       K----------KLQWINAHY-IKELSDNAYFNFIDNY----------LTIDFDYLKN---
SYE_GLOVI       Q----------LLDFINGQY-LRRLSSAELYTATVEYLKFLL----GLHQDIIFETYHPS
SYE_CUTAK       T----------KLDWLNGQY-IRSLDAEVLTDRVLDYADQMCQARHVLGRDLTQEDR---
SYE_LACP7       N----------KLRWMNGEY-IKRMDSEKYYEYALPQ-----------IKKVVTKDY---
SYE_CHLT3       E----------KLNWIQKQH-LKLVSHEDLAKQAKAI---------LVEKLKERESMMPS
SYE_PARUW       Q----------KLDWVNQQYLIKNIPVEQLWDRIKEW-------------SFNDE-----
SYE_PELUB       S----------RILSLNEHY-IKTINENELYDHLVKY------------CEIYKEKIKPE
SYE_RHOBA       A----------KLQSFQGDA-FAELSDEKRTELVRPF---------AVAAGFVADGDAD-
SYE_HERA2       D----------KLLHFNGVY-LRNMAPAELAQRVAPY---------LSKAGLISAEPTAA
SYE_TROWT       K----------KCLAINAYH-LRELNVEDFFLRLVPF---------VEEMLGIPLSFEQK
SYE2_ACIF5      V----------QLQHWQHEA-VQSLDDAAVWNWLAPL-----------LRGKVPMG----
SYE_BDEBA       V----------KFKWMNAQH-LRALPNAELWQAVAPF---------LARENM-DLPTDP-
SYE_PROMP       E----------KLNWINSQY-IKKMELTQLCKFIKKY---------WEEMGWESPSS---
SYE_SOLUE       TEEEPFDA---KALWLNAEH-IRAMPAADLARELLPF---------------VPVDL---
SYE1_LACBA      S----------KLDWINAAY-IKRLDLDDMTDRVLE----------LVDEGQTDVARQVK
SYE_DESPS       RKGDPKFFTDPKAISMNEHY-IRNMDITELGKLVQKE---------LEADGLWDTAYADE
SYE_METI4       Q----------KLLWINGEY-MRSLPLDELYPHAFFW---------LKKAGLIDQNTDC-
SYE_ENDTX       A----------KLLWLNGEK-IRSKTPQQVYELFIDW---------LKYTGN-EKLTETW
SYE2_HELAH      H----------KLNWLNAHY-LKTQSTQELLKLLKPF----------NFSDLSHLNP---
SYE_MYXXD       E----------KLLWLNQQW-MKQLPVETVVERLLPF---------LEAKGIQAKGD---
SYE_ECOLI       D----------KLLWLNHHY-INALPPEYVATHLQWH---------IEQENIDTRNG---
SYE_BUCBP       K----------KLLWLNRFY-INNLPETVIKKHLQYQ---------FNKNNIDYKND---
SYE_THEFY       K----------KLRAFNGEY-IRALDTTEFVERCAPW----------LGSEKAPWPAENF
SYE_SYMTH       N----------KLNWMNGVY-IRKKSLEEFAELALPF---------VVSAGLCTEEQARA
SYE1_KORVE      E----------KLYWLNRHY-IKEAATYRIAKLARHYWDRMMIDKIAHRVGMPKLDPIHV
SYE_LEPIC       S----------KLNWLSNRT-IRDLNISKVLENLLPF---------LMDRKDIPAEVKNV
SYE2_PETMO      K----------KLKWMNGQY-LRNKPLEEIYQLAEPF---------VTGSKLLSKEQYEV
                                     .                                      

SYE_SORC5       DP--------E-------------YTKRALGIERGGKKSNKRITTWPDLRPQL--FFFYD
SYE_HUNT2       HK--------D-------------SVIKLLSVGRNSEKPRKDLIYCEQIFEFIK-YFFDE
SYE2_HELHP      ------------------------------------KLHLQEASTLNEIRSKIERIFSPK
SYE2_SULNB      ------------------------DIGKLA------KLYINEAATINELDARIK-AIFSP
SYE1_NEOSM      ------------------------W-----------DAVKNNVKSIPEVNYWWE-ICTTE
SYE1_RICTY      ------------------------W-----------LSVRANLQKLSDIKDWWDICYQTP
SYE2_JANSC      ------------------------W-----------EVARANIGKRAEIADWWA--LFRD
SYE_MYCPN       ------------------------KRKEVS------LLFKNQLAFGIEINQLIK-ETFAP
SYE_GLOVI       APIKQTLTRAELGSFYSAFTANPTYTERVL------TLEPERYKRLSDIVVSTG--FFFP
SYE_CUTAK       ----------C-------------VIHAAM------PLVRERLTLLSEALPKLA-FLLTD
SYE_LACP7       ------------------------DLKFIA------DLVKTRIETFLDIAEMID--FFDE
SYE_CHLT3       EKITDD----A-------------YLLNVV------ELMHDRVNFVHEFVTFSE-YFFFE
SYE_PARUW       ------------------------FMQRLM------PLCHSRIKTFGDFMDLFN-FLFIN
SYE_PELUB       KE--------T-------------KIKPSL------IFLKNKAKTLEDIFNNAK-YIIFD
SYE_RHOBA       ----------E-------------TLKAVL------AAAGDRLKMAGDIVDFD--YCFVD
SYE_HERA2       EL--------A-------------KITEYL------PLVQDRLKLLSEAPELLD-FFFVD
SYE_TROWT       NS-----------------------LRAIC------PFVQGRVQLLTEAAEMVR-FLLVD
SYE2_ACIF5      ------------------------LEMPFV------AAVRANILLPGDALDWAERCFGAP
SYE_BDEBA       ----------A-------------WQSKSL------DLFKPYMEILADAIELYR-PLNDK
SYE_PROMP       ----------E-------------WDLKLT------NLIQDSMILLKDAIDQSKPFFILS
SYE_SOLUE       ----------E-------------KMLQIT------PLIQERIKLLRDVQSVAD-FFFVK
SYE1_LACBA      ALQLPDLR--T-------------LTSQVC------KIYQTEIHQLSEIMDKV--LFYVT
SYE_DESPS       KA--------D-------------WYLATI------DMIRARFHTLKDFATLGR-AYFGE
SYE_METI4       ----------S-------------FLKQAV------GIVREKVKTGKELVEWMK-PLLSD
SYE_ENDTX       DV--------E-------------LLKKAL------ILEHDKIKLLKDIPSLVD-FFFTK
SYE2_HELAH      ----------T-------------QLDRLF------DALKERSQTLKELALKID-EVLIA
SYE_MYXXD       ----------P-------------RLETLV------RTLRERSNTLEDIATTAANVYFRS
SYE_ECOLI       ----------P-------------QLADLV------KLLGERCKTLKEMAQSCR-YFYED
SYE_BUCBP       ----------S-------------DLLKLV------KLLGSRYYTLQEIVDYSR-CFYNK
SYE_THEFY       DA--------Q-------------VFEAVA------PLAQTRISVLSEIVSYVD-FLFLD
SYE_SYMTH       RW--------D-------------WFKEVM------AQVHERVETLAEIPQHVD-IFLKD
SYE1_KORVE      AQWGASNEVDE-------------WLSKVT------ALVVPSVNKLDELPERGK-VFFDY
SYE_LEPIC       NN--------P-------------ILTSIV------ESVRVYLDNLTQAPDYVA-EFFVT
SYE2_PETMO      NK--------K-------------WVIKAL------ETILSSVEILSEIPEKME--VFLK
                                                               :            

SYE_SORC5       ELYDRVDALDFPENVP----EGDRQPLLRQMLDTFDPADSKEA-WFEKIRQIAVASGYAG
SYE_HUNT2       YF--AIVDKYPDNVD-----EEEAKKILKAYLETYDHNDDQTQ-WFEKIKVIATENGYAA
SYE2_HELHP      CIAQNEEGENFENE------CKILYDILHQMIESYDE--------SLNDYDTFKNA----
SYE2_SULNB      K---DFDGK-----------WGEQMRMLEKIIAEAPM---------FATFEAFESH----
SYE1_NEOSM      AK--LYPG------------IGCNAQLVRDAISVLPQ----EE-VSRETYRRWVEL----
SYE1_RICTY      KIGN----------------LNLDKEYLKQASELLPL----GK-ITKDSWSIWTKE----
SYE2_JANSC      GATPLV--------------ADEDREFVAQAFAMLPD----LP-YDETTWSNWTSA----
SYE_MYCPN       KL--GVQHLSVKHREL----FKELQSALQQLSEQLQA---LPD-WTKDNVKSTLTQ----
SYE_GLOVI       ALFTPADPKLLAKPLGS---PEKAGALLGEYLRLYRP-----D-AAQAEWEQSVRE----
SYE_CUTAK       DDALVFDEDSVAKL------KAGADDIQHAAVEVLKG---LDD-FSADAIQAALRA---R
SYE_LACP7       LP--EYDIAMYTHKKM----KTDSENSLKVLQDVLPRFEELTC-YSVSSIESVLMG----
SYE_CHLT3       PE--AYEEAAIKKRW-----KENTNDLLSEFKGILAG---LDN-FNSAAIEEALAK----
SYE_PARUW       HL--HYNDAIFVVKDLS---KEQICYLIQSLIWRLDE---LEN-WNGTGVNQASRE----
SYE_PELUB       DV--KFEDKDLELI------DDKAKSIIKEFKEKLIS---INT-LNKETLEPIVND----
SYE_RHOBA       DY--SVDEKAYEKRLAK---ADGAKELLAKLNETLKA---ATE-FDAANVETTVKS----
SYE_HERA2       PQ--GYDPALLVPKKGD---PAQTVEILGQVKASFEA---VET-WDAPSLDKLLHD----
SYE_TROWT       NI--SVDFAVTDKEI----------DVLRHCLALLNL---LDT-WESAQIASCIKQ----
SYE2_ACIF5      AL--AADAVEAI--------TGVSPEFWSVAQATLQA--------SGGDYRRWTKA----
SYE_BDEBA       SYVILPEADETLK-------WESTKAVLTSWKNLLQA-HPSDY-MTEEEFLKMQDE----
SYE_PROMP       QM--KKEGEEFLES------KKEVKESLKYILFYLKE-ANITK-VNKDNAREIINK----
SYE_SOLUE       QL-PPYDSAELIPKKGD---AAMAKNVLIKACDVLAT----AE-FTHDGLEVALRA----
SYE1_LACBA      ILQEPLDYDQLRQFD-----RTATLAVLTAFRKHVQA--LPVD-VATPDFKKMIQT----
SYE_DESPS       DY--VVEEKPLKKNVLK---FEGLKEWLPLLGERYAS---LDD-FSAEETERVARE----
SYE_METI4       TL--QYDEAVVQQYL-----DDKGKEILREALPYLEE---VSS-FQAKELEAIIKN----
SYE_ENDTX       NV--DYKEEAVKKTLLSEKSKDIAKLVLIESAARLPN---QLD-FSAISLEQYARN----
SYE2_HELAH      PI--EYEEKVLKKLD-----QVLVTPLLEKFKLELNQ----ADFNDENALENAIHK----
SYE_MYXXD       GI--TLDEKAATKHL-----SGESLNLLRKVRETLTA---LPE-WSVEALDGVVKQ----
SYE_ECOLI       FA--EFDADAAKKHL-----RPVARQPLEVVRDKLAA---ITD-WTAENVHHAIQA----
SYE_BUCBP       SI--CFNSNIMSKHL-----DNSSKLILKKIYDKFLD---LEV-WNVEVIRSLLNS----
SYE_THEFY       RP--VEDEKSWAKAMK----PGVGEEMLTAALERFSD--PNLE-WRAEPLKAALEE----
SYE_SYMTH       EI--EMDEKAARKFL-----TEAVKPFFQRVSEGLRS----VE-WSVPAIEQLVRS----
SYE1_KORVE      DAAAALANPDNAEVLA----APKTTDVLAAFTTRIAN--ESAP-LTAERFKAIVNE----
SYE_LEPIC       DL--KIQSEETIGFLK----DGEGPKVVNEFYEILKN---SDP-KTDEDYKNLMSK----
SYE2_PETMO      DVYPDTNDPEFKEYFD----KRGVKEAINLIYKYFNE----DDRWDTQTITENLKN----
                                                                            

SYE_SORC5       EVKQYKASPESWKGHVGDVSMLLRVA-VCGTRNSP-DLTEVMAVLGE----------PRV
SYE_HUNT2       KPKDYKKNPDMYKGHVGDVSTVIRIA-IVGRSSSP-DLWEIQQIMGE----------EKV
SYE2_HELHP      LMAKSSLKG-------KKFFKPLRIL-LTGQTQGL-ELSEIYPYL------------RFF
SYE2_SULNB      LMKESGLSG-------EYFSKPLRVL-LTGAEQGP-ELSDIYPYI------------KSY
SYE1_NEOSM      IVENYRYDK-------REVHINLRLA-LTGKVGGP-EMAAILPFISR----------ERI
SYE1_RICTY      ITNATGRKG-------KELFLPIRLA-LTGRKSGP-EIAGILPLLKR----------EEI
SYE2_JANSC      VKEATGRKG-------KGLFMPLRKA-VTGRERGP-EMADVMRLMQV----------KPT
SYE_MYCPN       IGEQFNLKG-------KKLFMPLRLI-FTNKEHGP-DLAGIMVLHGK----------TQV
SYE_GLOVI       LAHEAGVKD-------GKLFMTLRVA-VTGREQTP-PLFEVLTILGG----------DEV
SYE_CUTAK       LCDEMGIKP-------RLAFAPVRVA-VTGSRVSP-PLFEAMEILGK----------EST
SYE_LACP7       YIAENGIKN-------GQGLWPVRTA-VSGKQSTPGGAYEIMSILGK----------EES
SYE_CHLT3       YAELKGVKN-------AALIHPIRLA-VSGVSFGP-SLYHLMEVIGK----------EAC
SYE_PARUW       IAEIFGVNH-------KKIVMPILFASLMSKTQGP-PLFDSVNLLGK----------DRT
SYE_PELUB       LIKKYETNF-------KGVGQPLRIA-LTGSKFGP-GLYDIIISLGN----------EEV
SYE_RHOBA       FCESEGIKI-------GQIIHALRVA-TTGAASGF-GMFDTLAVLGK----------DKV
SYE_HERA2       FVNQLGLKI-------PQVFMPIRVA-ISGRTTSP-GLFETLAVLGK----------AVT
SYE_TROWT       AIEQFDLQP-------KRIFSILRLA-ITGRRVSP-PLFESMQILGR----------SAS
SYE2_ACIF5      LQQASGRRG-------KALFMPLRAA-LTGLTHGP-ELAALLPLIGE----------ERA
SYE_BDEBA       VKNQTGSKG-------KHLFMPIRVA-VIGKPHGA-ELKTLVPLMKK----------SSL
SYE_PROMP       IIVNHSIKK-------GILMKSLRVA-FFGCLSGP-DLIQSWELFSE----------NKI
SYE_SOLUE       ASAELGIKA-------GQMFEPVRVA-VCGRKTAP-PLFGTLEVLGR----------EAC
SYE1_LACBA      VSQETGVTG-------RNLYFPLNVA-FTGDHSAP-QIDEVLRLFAN----------STI
SYE_DESPS       LADELELKP-------GVIINGMRTA-VTGQLAGP-SMFDIVTTLGQ----------ERM
SYE_METI4       LSLKMGRKT-------ADYIHRLRVA-LTGRTVGP-SLYPMLEVLGK----------QKV
SYE_ENDTX       LAAEKNIKT-------GQVFHPIRVA-ISGRMQGP-GLFQMMEVMGK----------EDV
SYE2_HELAH      IIEEEKIKV-------GSFMQPLRLA-LLGKGGGI-GLKEVLFILGK----------TES
SYE_MYXXD       VSEASSVGM-------GKVAQPIRVA-LTGNTTSP-GIGETLVLVGR----------DES
SYE_ECOLI       TADELEVGM-------GKVGMPLRVA-VTGAGQSP-ALDVTVHAIGK----------TRS
SYE_BUCBP       SVCELQISF-------KKVSMTIRIA-VTGHVFSP-NLCSVICFLGK----------NKF
SYE_THEFY       VAAAQGLKL-------GKAQAPVRVA-VTGRTVGL-PLFESLELLGR----------SRV
SYE_SYMTH       IQEEMGLTP-------KESFQPIRVA-ITGRTASP-GLFETIYLIGR----------ERV
SYE1_KORVE      VKTETGVKG-------KDLFHPIRIA-VTGTHSGP-EFDKLVPLIEEGASLNLPIAVKSV
SYE_LEPIC       VGEVTGQKG-------KTLYMPIRAA-TTGKSAGL-ELPILFPLLGK----------EKL
SYE2_PETMO      AMNEANPQK-------KPFYMSLRKI-LTDSFHGP-DLINTIFLLGR----------NTV
                                      :      .                              

SYE_SORC5       RARIARFL------------------------------
SYE_HUNT2       RERIQRLL------------------------------
SYE2_HELHP      LRDIVRLSK-----------------------------
SYE2_SULNB      LLEVAS--------------------------------
SYE1_NEOSM      LIRLNDSLS-----------------------------
SYE1_RICTY      IKRLVAIT------------------------------
SYE2_JANSC      L-------------------------------------
SYE_MYCPN       LALLQEFIHATNLF------------------------
SYE_GLOVI       QRRLELAAAMPVSL------------------------
SYE_CUTAK       LRRMQRFEAEIDQK------------------------
SYE_LACP7       LRRIRIAIDKLSSSL-----------------------
SYE_CHLT3       LRRIERAVDKLDYQEA----------------------
SYE_PARUW       RARLLKAMEYLGGISNKKMASLKKAWQEKSGQPLMIKD
SYE_PELUB       ERRLGNKIII----------------------------
SYE_RHOBA       TARIEKTIAGLS--------------------------
SYE_HERA2       LARISTAAAALSSASV----------------------
SYE_TROWT       LNRVETFVTN----------------------------
SYE2_ACIF5      LARLHAAARRPSTPIETTL-------------------
SYE_BDEBA       VARAEQALAKV---------------------------
SYE_PROMP       DIPLIERCFN----------------------------
SYE_SOLUE       LARIGQAIEKL---------------------------
SYE1_LACBA      IELLTKAIAHV---------------------------
SYE_DESPS       VKRLREAGRLFA--------------------------
SYE_METI4       LNRLYKVVGPKE--------------------------
SYE_ENDTX       VRRINVAI----NKFFQK--------------------
SYE2_HELAH      IKRIEKFLKN----------------------------
SYE_MYXXD       LLRIDAALTRG---------------------------
SYE_ECOLI       IERINKALDFIAERENQQ--------------------
SYE_BUCBP       LLRIKEALLYIKNMCFEV--------------------
SYE_THEFY       QERLRAALEKLKAAGE----------------------
SYE_SYMTH       LERMAPYC------------------------------
SYE1_KORVE      KERVAEFASARN--------------------------
SYE_LEPIC       LQRIEKTSKETGISLSN---------------------
SYE2_PETMO      LERLQRVIEI----------------------------