CLUSTAL format seed alignment for MF_00023

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SSRP_ALBFT      -----------------------------MAKK-----------------PDTASRIAD-
SSRP_POLSJ      ------------------------------------------------------MRIAD-
SSRP_VEREI      -----------------------------MTKK-----------------PDPASRIAD-
SSRP_METPP      ------------------------------------------------------MAIAD-
SSRP_NITMU      ------------------------------------------------------MSIVQ-
SSRP_METFK      ------------------------------------------------------MSIAQ-
SSRP_AROAE      ------------------------------------------------------MSIID-
SSRP_DECAR      ------------------------------------------------------MSITV-
SSRP_PARXL      ------------------------------------------------------MSIID-
SSRP_RALSO      ------------------------------------------------------MTIAD-
SSRP_POLAQ      ------------------------------------------------------MSIVD-
SSRP_NEIG1      ------------------------------------------------------MAIAN-
SSRP_THIDA      ------------------------------------------------------MSIAD-
SSRP_CHRVO      ------------------------------------------------------MSIIQ-
SSRP_BORA1      ------------------------------------------------------MSIID-
SSRP_COXBU      --------------------------MNKQISK-----------------KPAQRTIAL-
SSRP_ALKEH      --------------------MRAVSKK----K------------------KTPENVIAL-
SSRP_HALHL      --------------------MRPVSKKAGKSK------------------KTEGNVIAL-
SSRP_NITOC      --------------------MAKSKKK---SS------------------GTSSNVIAL-
SSRP_ALCBS      --------------------MGKANKK----A------------------KAPSATIAQ-
SSRP_METCA      ----------------------MSSKK----S------------------APGSANIAQ-
SSRP_ACIAD      ----------------------MSKAVVV--K------------------KNNGGTIAQ-
SSRP_SACD2      ----------------------MSKANKK--K------------------KPQSSTIAQ-
SSRP_PSEE4      ----------------------MAKQK-----------------------KHPTGTIAQ-
SSRP_PSESM      ----------------------MAKLK-----------------------KHPTGTIAQ-
SSRP_PSEMY      ----------------------MAKQK-----------------------KHPQGTIAL-
SSRP_HAHCH      ----------------------MSQAK----N------------------KNTGSTIAL-
SSRP_MARN8      ----------------------MSKKKA---N------------------APTSNTIAL-
SSRP_CHRSD      ----------------------MAKKK----G------------------NLGSSTIAQ-
SSRP_PSYWF      ----------------------MAKKT----K------------------KPS-NQIAA-
SSRP_VESOH      ----------------------MAKKN----K------------------KISLNTIAF-
SSRP_HYDCU      ----------------------MAKKK----K------------------QNNPNSIAQ-
SSRP_HAEDU      -----------------------MAKKP----------------------KVPSNTIAL-
SSRP_PASMU      ----------------------MTKKKV----------------------KVGTNTIAL-
SSRP_ECOLI      ----------------------MTKKKAH---------------------KPGSATIAL-
SSRP_AERS4      ----------------------MSKKNSKN--------------------KAGSSTIAL-
SSRP_VIBVY      ----------------------MAKKNSKP--------------------KAGSNTIAL-
SSRP_ALIF1      ----------------------MAKKKSKD--------------------KAGSNTIAM-
SSRP_PHOPR      ----------------------MAKKPNKS-----------------------DNTIAK-
SSRP_SHESM      ----------------------MVKKNSKK---------------------AAPATIAR-
SSRP_SHEFN      ----------------------MVKKKS-A---------------------NASASIAR-
SSRP_SHEAM      ----------------------MVKKNSKK--------------------AAQPATIAR-
SSRP_SHELP      ----------------------MAKKNAKK--S-----------------KNPPATIAR-
SSRP_COLP3      ----------------------MAKKKSKS---------------------SNSNTIAL-
SSRP_PSET1      ----------------------MAKNKSSK---------------------STSNTIAL-
SSRP_PSEA6      ----------------------MKSKKSK----------------------STNNTIAL-
SSRP_IDILO      ----------------------MSKKKPQ----------------------QSSNTIAR-
SSRP_PSYIN      ----------------------MAKKNSKT--K------------------NNDNTIAR-
SSRP_LEGPA      ----------------------MTTKKQPD------------------------STIAL-
SSRP_XANC8      --------------MSKKPAKDKAKSA------------------------TATKTIAL-
SSRP_XYLFT      --------------MNNKHPKNKAKST------------------------TTPKTIAL-
SSRP_FRAP2      ----------------------MSKHK------------------------VSPATIAR-
SSRP_BAUCH      ----------------------MKNQTPCR--------------------VSKITTITQ-
SSRP_DICNV      ----------------------MSKKN------------------------TADNHIVT-
SSRP_DEIRA      -----------------------------------------------------MRRVYT-
SSRP_THET8      -----------------------------------------------------MAPVLE-
SSRP_AQUAE      ------------------------MG-----------------------KSDKIIPIAE-
SSRP_DESVV      -----------------------MSK-----------------------KAPGANVIAQ-
SSRP_OLEA2      ----------------------MTKK-----------------------KSSGGALIAQ-
SSRP_LAWIP      ----------------------MSAK-----------------------KNS--HLVFE-
SSRP_FERNB      ----------------------MRI-------------------------------IAT-
SSRP_THEM4      ----------------------MKI-------------------------------IAT-
SSRP_THEP1      ---------------------MVKV-------------------------------VAT-
SSRP_PSELT      ----------------------MQI-------------------------------VAT-
SSRP_PETMO      ----------------------MTT-------------------------------LAR-
SSRP_RUBXD      ----------------------MSD-------------------------------FAR-
SSRP_SYNFM      ----------------------MTKNKPS--------------------TAEKTRLICQ-
SSRP_MICAN      ---------------------MAN-QDDK------------------------IKIITD-
SSRP_SYNY3      ---------------------MAK-EKER------------------------IKVVSD-
SSRP_SYNE7      ---------------------MAD-SGG-------------------------IKVLSE-
SSRP_TRIV2      ---------------------MSD-KSES------------------------YKVITD-
SSRP_THEVB      -------------------------MGDS------------------------IKVLSE-
SSRP_ACAM1      -------------------------MSES------------------------YKVISD-
SSRP_TRIEI      ---------------------MAKKSGEG------------------------QKIISD-
SSRP_SYNSC      -----------MAKGGAKKAAAAAARAAA------------------------NRMLAD-
SSRP_SYNR3      -----------MAGKGKGAKAAAKKRLEA------------------------QKLLAD-
SSRP_PROMA      -----------MSKARN-NKKSKLSKAKS------------------------NRRLAE-
SSRP_PROMT      -----------MSKKGK-KQSKNNSSVDG------------------------NRRLAE-
SSRP_PROM2      -----------MAKTSN-KVKRNANKANI------------------------FKLLAD-
SSRP_PROMP      MFFGERFFTTAMAKVSN-KANKIIKKEAV------------------------FKRLSE-
SSRP_SYNJA      -----------------------MAVDPN------------------------VKTLVE-
SSRP_GLOVI      -----------------------MAGEKT------------------------RKILVD-
SSRP_DESRM      ---------------------------MA------------------------AKATSEK
SSRP_PELTS      ---------------------------MA------------------------VKVVTE-
SSRP_MOOTA      -------------------------MGRQ------------------------VKVVTD-
SSRP_CARHZ      ----------------------------M------------------------EKIIAE-
SSRP_SYMTH      ----------------------MARAKAE------------------------IQPVAE-
SSRP_ROSS1      ----------------------MARGNDI------------------------ERVVAD-
SSRP_CHLAA      ---------------------MTATKHKH------------------------PGVVAE-
SSRP_SYNWW      ----------------------MGKKGKG------------------------IKPVVD-
SSRP_SYNAS      ----------------------MAKKEKP------------------------EKIICQ-
SSRP_ALKMQ      ----------------------MAEK--------------------------GQKSLAV-
SSRP_ALKOO      ----------------------MASK--------------------------GTKLIAT-
SSRP_LACP7      ----------------------MAKE--------------------------GIKLIAN-
SSRP_CALS8      ----------------------MAEKNK----------------------QDDIKVIAT-
SSRP_CALS4      ----------------------MSKE------------------------KEEIKIIAQ-
SSRP_ACET2      ----------------------MAKE--------------------------EKRVVAQ-
SSRP_DESHY      ----------------------MASE--------------------------GIKVISD-
SSRP_CLOPS      ----------------------MAKR------------------------KDNK-TLAE-
SSRP_CLOB8      ----------------------MARK------------------------RNEN-SLAE-
SSRP_CLOBL      ----------------------MSKK------------------------KGSN-TLAE-
SSRP_CLOTE      ----------------------MVKG------------------------RSNK-TLAE-
SSRP_CLONN      ----------------------MGKKD-----------------------KKNN-TLAQ-
SSRP_CLOK5      ----------------------MSAKN-----------------------KSNNKTLAE-
SSRP_CLOAB      ----------------------MAKKN-----------------------TENN-TLAD-
SSRP_STAHJ      ----------------------MAKKK-----------------------TKSPGTLAE-
SSRP_CLOD6      -------------------MEQISSKEGEIY-------------------MAGKKILAT-
SSRP_GEOTN      ----------------------MPKG--------------------------EGKVIAQ-
SSRP_BACCN      ----------------------MPKG--------------------------SGKVIAQ-
SSRP_ENTHA      ----------------------MPKG--------------------------DGKLIAQ-
SSRP_LISW6      ----------------------MPKG--------------------------DGKLVAQ-
SSRP_HALH5      ----------------------MGET--------------------------EGKVIAQ-
SSRP_OCEIH      ----------------------MPKG--------------------------NGKVIAQ-
SSRP_STRPG      ----------------------MAKG--------------------------EGHILAQ-
SSRP_STRT1      ----------------------MPKG--------------------------EGNVVAQ-
SSRP_STRMU      ----------------------MVKA--------------------------QGNVVAQ-
SSRP_STRS2      ----------------------MAKG--------------------------EGNVIAQ-
SSRP_LACLA      ----------------------MVKNT-------------------------EDKPLAQ-
SSRP_LACJO      ----------------------MKQKA--------------------------DNLIAQ-
SSRP_LACDB      ----------------------MKQKAKD------------------------ENVLAQ-
SSRP_LEVBA      ----------------------MAKKKSKK---------------------TPDNVLAQ-
SSRP_LACPL      ----------------------MAKQHGK----------------------HPDTALAQ-
SSRP_LIMRD      ----------------------MAKKSHQE---------------------NNDNLIAQ-
SSRP_LIGS1      ----------------------MAK-SKP-----------------------KDNALAQ-
SSRP_PEDPA      ----------------------MAKKPKS-----------------------NDKALAQ-
SSRP_LACP3      ----------------------MAKKHRQ----------------------KPDNLLAQ-
SSRP_LATSS      ----------------------MAKKHPQ----------------------KPANLIAQ-
SSRP_LEUMM      ----------------------MAKKKQN-----------------------TENYLAQ-
SSRP_OENOB      ----------------------MAKKDK------------------------HDDALAR-
SSRP_GEOSL      ----------------------MGEK-----------------------------LICN-
SSRP_GEOUR      ----------------------MSEK-----------------------------LICN-
SSRP_PELPD      ----------------------MGEK-----------------------------LICN-
SSRP_SYNC1      ----------------------MGIK-----------------------------IIAN-
SSRP_TREDE      ----------------------MEKTP--------------------------VKIIAK-
SSRP_TREPA      ----------------------MRGTG--------------------------THLIAK-
SSRP_BORAP      -----------------------MNTN--------------------------TLLIE--
SSRP_DEHM1      ------MHYARIVSNLHLGYDIIHMAE--------------------------YVTLTT-
SSRP_CHLMU      ----------------------MSVK----------------------------EIVSN-
SSRP_CHLPN      ----------------------MAQK----------------------------EIVSN-
SSRP_PARUW      ----------------------MKDKH--------------------------SDLVSN-
SSRP_KORVE      -----------------MTRNPQPDRSKT-----------------------APKNAKRD
SSRP_SOLUE      ----------------------MADKKDF-----------------------AFKILSD-
SSRP_ACIC1      ----------------------MARES-------------------------GRKLIAS-
SSRP_SACEN      ----------------------MAKEQ-------------------------GRKLIAQ-
SSRP_FRACC      ----------------------MPRET-------------------------GRRLIAQ-
SSRP_THEFY      ----------------------MARKKKQDKGQ-------------------GPKTIAQ-
SSRP_SALTO      ----------------------MPREK-------------------------GRKVVAS-
SSRP_COREF      ----------------------MAKKKKKVDENNQ--------------------VLAT-
SSRP_CORDI      ----------------------MAKKKK-AKNSNP--------------------VIAS-
SSRP_CORJK      ----------------------MAAKKSTPTDSGKSKGKKNKAQKGAGQKGAGQIVVAT-
SSRP_MYCUA      ----------------------MAAQSKQAKPSGKQGG---------------KKIIAT-
SSRP_MYCPA      ----------------------MAKGSGRAKAAGGKGGS--------------KQIIAT-
SSRP_MYCS2      ----------------------MTKKSASSN----------------------NKVVAT-
SSRP_RHOJR      ----------------------MKEKG--------------------------RKVIAT-
SSRP_ARTS2      ----------------------MPKES-------------------------GRKVVAT-
SSRP_RENSM      ----------------------MPKES-------------------------GRKVVAT-
SSRP_CLAMS      ----------------------MPRER-------------------------GEKVVAT-
SSRP_LEIXX      ----------------------MAKER-------------------------GQKVVAT-
SSRP_STRCO      ----------------------MAKEK-------------------------GRKLIAQ-
SSRP_NOCSJ      ----------------------MAKEQ-------------------------GRKLIAQ-
SSRP_KINRD      ----------------------MPRET-------------------------GRKVIAS-
SSRP_BIFLO      ----------------------MPKET-------------------------GEKLIVQ-
SSRP_CUTAK      ----------------------MPREQ-------------------------GVRVVAR-
SSRP_TROWT      -------MHRRSSKSYSSRNSKIPERSKI-----------------------PDCVIAS-
SSRP_SALRD      ----------------------MAEGTE---------------------------VVAR-
SSRP_ANADE      ------------------------MKGKAGGKAADA----------------AEKVAAS-
SSRP_ANADF      ----------------------MSAKGAGGARGRGAE---------------GEKIVAT-
SSRP_MYXXD      ----------------------MTSGGKSKGVGSEP----------------GVRVIAE-
SSRP_BDEBA      ----------------------------------MSE---------------NILIVHE-
SSRP_SORC5      ----------------------MPKEKARPG----------------------ETLIAR-
SSRP_PELUB      ----------------------MNK-KANPG----------------------LKIICL-
SSRP_LEPIC      ----------------------MVKKKEESG----------------------HSPLV--
SSRP_GLUDA      --------------------------------------------------MISTGIAAQ-
SSRP_GLUOX      ---------------------------------------MAGKK--TKSGMISHGMAAQ-
SSRP_GRABC      --------------------------------------MAETKS--GKSGLISHGVAAQ-
SSRP_ACICJ      ----------------------------------------MAEP--RKSGLISHGIAAQ-
SSRP_MAGSA      -------------------------------------------------MVLPGHVAAQ-
SSRP_RHORT      ----------------------------------------MARA--GNSLISHGRVAE--
SSRP_AGRFC      ---------------------------------------MAPK----GSQRVVNKIVAE-
SSRP_SINMW      ---------------------------------------MAPK----GSERTVKKVVAE-
SSRP_CHESB      -----------------------------------------------MAKNTNITTVAD-
SSRP_RHILO      ---------------------------------------MNQV----RKADPNNKTVAE-
SSRP_BARBK      ----------------------------------------MRK----KKNVLIRKIIAE-
SSRP_BRUA4      ----------------------------------------MNK----PKNSPVRKIIAE-
SSRP_RHOPB      ---------------------------------------MAEK----NER--PIKVIAE-
SSRP_AZOC5      --------------------------------------MMAEK----KKKELPRKVVAD-
SSRP_SPHEL      --------------------------------------MARPR----PATFDKVKTVAE-
SSRP_RHIWR      --------------------------------------MARPR----PAEFEKKKVVAE-
SSRP_NOVAD      --------------------------------------MARPV----HPEFDKKKVVAE-
SSRP_SPHAL      --------------------------------------MVRPQS---AAEFDKKKVVAE-
SSRP_ERYLH      --------------------------------------MARPK----PETFDKQKTVAE-
SSRP_ZYMMO      --------------------------------------MAAFR----PPQFKKSKILAE-
SSRP_CAUSK      --------------------------------------MTKP--------------IAE-
SSRP_HYPNA      -------------------------------------MATKKNE---QIKGRTDGLVAE-
SSRP_MARMM      --------------------------------------MSKPKS---E-----TAPVAV-
SSRP_DINSH      --------------------------------------MAKPK----TPEEKNYKVIAE-
SSRP_JANSC      --------------------------------------MAK------KPDNPNYKVIAE-
SSRP_PARDP      --------------------------------------MATK-------SDPNYKIIAE-
SSRP_ROSDO      --------------------------------------MAQVKS--SSKSDPNYKVVAE-
SSRP_CERS5      --------------------------------------MVKH-------SDPNSKLIAE-
SSRP_PARL1      --------------------------------------MSSKSGGAKKKAGDGRKIIAD-
SSRP_RICCK      -------------------------------------------------MTRYKKVIAQ-
SSRP_ORITB      -------------------------------------------------MENYCKIVAQ-
SSRP_ANAMM      -----------------------------------------------------MEIVAE-
SSRP_ANAPZ      -----------------------------------------------------MDIVAE-
SSRP_EHRCJ      -----------------------------------------------------MDVIIE-
SSRP_WOLTR      -----------------------------------------------------MEVIAE-
SSRP_NEOSM      -----------------------------------------------------MKVIAI-
SSRP_PHOV8      -----------------------------------------------MK---PTPINIK-
SSRP_PARD8      -----------------------------------------------MKEKISNNIQIK-
SSRP_PORGI      -----------------------------------------------MKEKIQKNILIK-
SSRP_FLAJ1      ---------------------------------------------------MLKSVNIL-
SSRP_FLAPJ      ---------------------------------------------------MLKTVNIL-
SSRP_GRAFK      ---------------------------------------------MYFCGYMKNSINIK-
SSRP_CYTH3      ----------------------------------------------MSTKEIVKNVNIK-
SSRP_CHLL3      --------------------------------------------MAKKQQTRSYTEAIQ-
SSRP_CHLPM      --------------------------------------------MAKKQQTKTYTQAIQ-
SSRP_CHLPD      --------------------------------------------MSKKQQPQTFVQAIH-
SSRP_CHLTE      --------------------------------------------MSKKQGKPEYVTAIS-
SSRP_CHLCH      --------------------------------------------MSKQPQQR-YAEAIV-
SSRP_DESPS      ---------------------------------------------------MGIKIVCK-
SSRP_RHOBA      -------------------------MTEAGAKKAAGKKSGKGKGKNAKKNQPNITPVAE-
SSRP_ACHLI      -----------------------------------------------------MKIITQ-
SSRP_FUSNN      ------------------------------------------------------MIIAN-
SSRP_MYCMS      ---------------------------------------------------MSEHLIVK-
SSRP_MESFL      ---------------------------------------------------MGEHVIAL-
SSRP_UREP2      -------------------------------------------------------MIVS-
SSRP_MALP2      -----------------------------------------------------MKILVV-
SSRP_MYCFP      -----------------------------------------------------MKIISD-
SSRP_MYCPU      ----------------------------------------------------MAKLITK-
SSRP_MESH2      -----------------------------------------------------MEILIK-
SSRP_MESM1      -----------------------------------------------------MKIIIK-
SSRP_ONYPE      -----------------------------------------------------MKTIIT-
SSRP_MYCGE      -----------------------------------------------------MLILVN-
SSRP_MYCPN      -----------------------------------------------------MRVLVN-
SSRP_MYCGA      -----------------------------------------------------MRLLVN-
SSRP_CAMC5      -----------------------------------------------------MKDLAK-
SSRP_CAMFF      ----------------------------------------------------MSKDLAR-
SSRP_CAMHC      -----------------------------------------------------MKELTK-
SSRP_CAMJR      -----------------------------------------------------MKIIAR-
SSRP_WOLSU      ---------------------------------------------------MARKVIAN-
SSRP_ALIB4      ---------------------------------------------MANKKDTKKNLVFK-
SSRP_HELAH      -----------------------------------------------------MKLIAS-
SSRP_HELHP      ---------------------------------------------------MPIRVIAK-
SSRP_NITSB      -----------------------------------------------------MKVIAT-
SSRP_SULDN      ----------------------------------------------------MGENIAK-
SSRP_SULNB      ---------------------------------------------------MAINIVAQ-
SSRP_BUCAI      --------------------MLQKKKYQ-----------------------KKSSKIII-
SSRP_BUCAP      --------------------MSYKKKRC-----------------------LKSSIICK-
SSRP_BUCBP      ----------------------MKRNSN-----------------------RKPNEICI-
                                                                            

SSRP_ALBFT      -----------NKKAAYNYFF-EERFEAGLVLEGWEVKSLRE-GKVQITDGYVVIR-NGE
SSRP_POLSJ      -----------NKKAIFNYHI-EERFEAGMVLEGWEVKSVRE-GKVQLTDGYVVIR-GGE
SSRP_VEREI      -----------NKKAAHDYFL-EERYEAGMVLHGWEVKALRA-GKAQLTDGYVLIR-DGE
SSRP_METPP      -----------NKKARFNYTI-EEQFEAGMVLEGWEVKAIRA-GQVQLTDGYVVVK-DGE
SSRP_NITMU      -----------NKKAFHDYFI-EEKHEAGAVLEGWEVKAIRA-GRAQLKEAYVIIR-NGE
SSRP_METFK      -----------NKKAFHDYFI-EEKYEAGIVLEGWEVKAIRE-NRVQLKEAYVIIQ-RGE
SSRP_AROAE      -----------NRKAFHDYFI-EETYEAGLVLEGWEVKAIRA-GRANIKEAYVILR-GEE
SSRP_DECAR      -----------NKKAFHDYFV-EEKYEAGISLEGWEVKAIRA-GRMNIKESYVIIK-GGE
SSRP_PARXL      -----------NRKAFYDYSV-EERYEAGLVLEGWEVKALRA-GRGQIKEGYVVIK-NNE
SSRP_RALSO      -----------NKKAFFDYFV-EERYEAGIALEGWEVKAIRA-GRVQIKEGYVVIR-DAE
SSRP_POLAQ      -----------NKKAFFDYFI-EERFEAGLVLEGWEVKAIRA-GRVHVKEAYVVIR-KAE
SSRP_NEIG1      -----------NKKAFHDFFI-EDRIEAGLVLEGWEVKAIRA-ARVQLKESYIYWK-KDA
SSRP_THIDA      -----------NKKAFHDYFI-EERFEAGLVLEGWEVKAIRA-GRVQLKEAYVVVK-NGA
SSRP_CHRVO      -----------NRKAFHDYFI-EEKLEAGLVLEGWEVKAIRA-GRVQLKESYVDWK-NGA
SSRP_BORA1      -----------NRKASHDYFI-EDRYEAGLVLQGWEVKSIRA-GRVQLKESYVIVR-DGE
SSRP_COXBU      -----------NKKALHDYYV-EQRFEAGLVLEGWEVKSIRA-GRVQLRDSYVVFK-GGE
SSRP_ALKEH      -----------NRKARFEFHI-EETMEAGLALEGWEVKSLRA-GRVNLQEAYVLIR-RGE
SSRP_HALHL      -----------NRKAGFDFFV-EERLEAGLALEGWEVKALRA-KRVNLTESHVLVR-RGE
SSRP_NITOC      -----------NRKARHDYFI-EERYEAGLVLEGWEVKSLRA-GRVQLNEGYCLLK-GGE
SSRP_ALCBS      -----------NRKARHEYHL-EEHFEAGLVLEGWEVKSLRA-GKGNLTEAYVLLK-NGE
SSRP_METCA      -----------NRQATHEYFI-EERLEAGLVLEGWEVKSLRA-GKAQLKESFVMLK-NGE
SSRP_ACIAD      -----------NKRARHDYFI-EEKFEAGMSLQGWEVKSLRA-GRMSLTESYIIFK-NGE
SSRP_SACD2      -----------NKRARHDYFL-ETKFEAGVALLGWEVKALRA-QRGQMTESYVLVQ-NGE
SSRP_PSEE4      -----------NKKARHDYFI-EHKFEAGLVLSGWEVKSLRA-GKAHLTDSYVLLK-DGE
SSRP_PSESM      -----------NKKARHDYFI-EHKFEAGLVLSGWEVKSLRA-TKVQLVDSYVLLK-DGE
SSRP_PSEMY      -----------NKKALHDYFV-EQKFEAGVALAGWEVKSLRA-GKAQLVDSYVLLK-DDE
SSRP_HAHCH      -----------NKKARFDYHI-VEKFEAGLALTGWEVKSLRA-GKCQLVDSYVLLK-DSE
SSRP_MARN8      -----------NKKAKHEYHI-EERFEAGLALLGWEVKSLRA-GKAQLVDAYVLLK-DGE
SSRP_CHRSD      -----------NKKARFEYHI-DETFEAGLSLAGWEVKSLRA-GKAQLTDTYILIK-NGE
SSRP_PSYWF      -----------NKKARHEYFI-EETYEAGLVLQGWEVKAIRA-GKMSITEAYVVFR-GNE
SSRP_VESOH      -----------NKKARHVYFI-EQTLEAGLSLEGWEVKSLRD-SKVQIKESYVILR-SNE
SSRP_HYDCU      -----------NKKARFDYFI-EETFEAGLALEGWEVKSLRQ-GKVQINESYILLK-NNE
SSRP_HAEDU      -----------NKRARHEYFI-EDEIEAGLALQGWEVKSLRA-GKANIGDSYVTFR-HGE
SSRP_PASMU      -----------NKRARHDYFI-EDEMEAGLELQGWEVKSMRA-GKANISDSYIIFK-QGE
SSRP_ECOLI      -----------NKRARHEYFI-EEEFEAGLALQGWEVKSLRA-GKANISDSYVLLR-DGE
SSRP_AERS4      -----------NRTARHEYFI-EERVEAGLSLQGWEVKSLRA-GKANISEAYVIFM-QGE
SSRP_VIBVY      -----------NKKARHEYFI-EDEIEAGMELQGWEVKALRQ-GKANISESYVFMR-DGE
SSRP_ALIF1      -----------NKQARHEYFI-DDEIEAGIELQGWEVKSLRS-GKVNIAESYVYVR-DGE
SSRP_PHOPR      -----------NRTARHEFAI-QDDYEAGLQLQGWEVKAIRN-GKVNIAESYVFLR-DGE
SSRP_SHESM      -----------NKRATFEYRF-EEKMEAGISLMGWEVKSIRM-GKVNLSDCYVFLK-NGE
SSRP_SHEFN      -----------NKRATFEYRI-EDKIEAGLQLMGWEVKSIRM-GKVNLSDCYVYIK-EGE
SSRP_SHEAM      -----------NKRATFEYKF-DEKFEAGLSLMGWEVKSIRA-GKINISESYVMLK-NGE
SSRP_SHELP      -----------NKRANFDYKF-EEKFEAGLSLMGWEVKSIRV-GKVNLSESYVFLR-DGE
SSRP_COLP3      -----------NKKARHNYSL-TDKFEGGMSLQGWEIKSIRS-GKVNISDCYVHIK-DRE
SSRP_PSET1      -----------NKKARHEYFL-HDKFEAGVELQGWEVKSIRA-GKVNITETYIHLK-NGE
SSRP_PSEA6      -----------NKKARHDYIL-QDKIEAGIELQGWEVKSIRS-GKVNLSDSYVTLH-KGE
SSRP_IDILO      -----------NKKARHEYFL-EDKFEAGVSLQGWEIKSIRA-GKVNISDSYVIIK-NGE
SSRP_PSYIN      -----------NKRASHDYHL-EERFEAGLELQGWEVKSLRA-GKANIADSYIFLK-NGE
SSRP_LEGPA      -----------NRKAGFDYFI-EDQYEAGLVLEGWEVKSLRA-GKINLSDSHVIIK-YGE
SSRP_XANC8      -----------NKRARHEYHL-EERYEAGLALQGWEVKAIRA-GRANIVDGYAYVR-SGE
SSRP_XYLFT      -----------NKRARHEYHL-IERHEAGLELQGWEVKAIRA-GRANLGDGYAYVR-DGE
SSRP_FRAP2      -----------NKRAFHDYTI-LEKFEAGIVLQGWEVKSIRA-GKVQMIDSHVHIK-RGE
SSRP_BAUCH      -----------NKRVRYEYFI-EQEFEAGISLLGWEVKSLRA-GIVHINDSYILLK-DSE
SSRP_DICNV      -----------NKKVFHDYFL-EEHFEAGIALEGWEVKAVRA-GRIQIKESYILVK-DQQ
SSRP_DEIRA      -----------NRRAHHEYEL-LERFEAGISLTGSEVKSVRA-GGVDFRDAFARIN-GSD
SSRP_THET8      -----------NRRARHDYEI-LETYEAGIALKGTEVKSLRA-GKVDFTGSFARFE-DGE
SSRP_AQUAE      -----------NKEAKAKYDI-LETYEAGIVLKGSEVKSLREKGTVSFKDSFVRIE-NGE
SSRP_DESVV      -----------NKKARHIYEL-SDNHEAGISLTGSEVKSLRA-GHVNFRDSYVDFR-NGE
SSRP_OLEA2      -----------NKKARHLYEL-LEFFEAGIALAGTEVKSLRA-GQVSFTDSYVTIH-NNE
SSRP_LAWIP      -----------NRKARHLYDL-LDFLEAGIVLTGPEVKSLRS-GHASFQDSYVDFK-QGE
SSRP_FERNB      -----------NKKAYTDYII-DETYEAGIVLVGTEVKSLRE-HGASFKDSFCRVK-EGE
SSRP_THEM4      -----------NKKAFSDYII-LETYEAGIELRGTEVKSLRE-SGANFKDSFCRIK-NGE
SSRP_THEP1      -----------NKKAYTDYEI-LETYEAGIVLTGTEVKSLRN-GSVNFKDSFCRFK-NGE
SSRP_PSELT      -----------NKK-IRDYEI-LETYEAGIELKGTEVKSLRE-RNVSFKDAFCRVR-DNE
SSRP_PETMO      -----------NKKATHDYEI-IETFEAGISLLGTEVKSSKA-GKINFKDSFCKIE-KGE
SSRP_RUBXD      -----------NRKALHDFDI-EETYEAGIALTGPEVKSVRE-GRANLRESYVRVR-NGE
SSRP_SYNFM      -----------NKKAYHDYDI-LEKFEAGIVLLGTEVKSLRE-GRANLKDSYARVR-KGE
SSRP_MICAN      -----------NRQARHLYEI-LETFEAGVQLLGTEVKSVRA-GKVNLRDGYVLVR-NGE
SSRP_SYNY3      -----------NRQARFLYEI-LETYEAGIELQGTEVKSIRA-GKVNLRDGFALLR-DGE
SSRP_SYNE7      -----------NRQARFQYEI-LETFETGIELLGTEVKSIRA-GKVNLRDGFALVR-NGE
SSRP_TRIV2      -----------NRQARYLYEI-LETFEAGIQLTGTEVKSIRA-GKVNLQDGYALLR-DGE
SSRP_THEVB      -----------NRQARFQYEI-LETYECGLVLLGTEVKSIRA-GKVNLRDGFARIR-NGE
SSRP_ACAM1      -----------NRQARFQYEI-LEVFEAGLALTGTEVKSIRA-GKVNLRDGFAQIR-NEE
SSRP_TRIEI      -----------NRQARFNYHI-IETYEAGVALQGTEVKSIRE-GKVNLRDGYALIR-NNE
SSRP_SYNSC      -----------NRQARHQYEI-LETLETGIELVGTEVKSIRN-GKANLRDGFCLIR-NGE
SSRP_SYNR3      -----------NRQARHQYEI-LDTLETGIELLGTEVKAIRA-GKANLRDGFCLIR-QGQ
SSRP_PROMA      -----------NRYARHQYEI-LEDIEAGIELLGTEVKSIRA-GNVNLRDGFCLIR-EGS
SSRP_PROMT      -----------NRQARYEYEI-LETLETGLELLGTEVKSIRA-GKVNLKDGFCLIK-KDQ
SSRP_PROM2      -----------NRYAKFQYEI-SETIEAGIELLGTEVKSIRN-GKANLRDGYCSFR-DNE
SSRP_PROMP      -----------NRYAKFQYEI-LETIEAGIELLGTEVKSIRN-GSVNLRDGYCSFR-DGE
SSRP_SYNJA      -----------NRRARFEYEI-LETYEAGIQLTGTEVKSIRA-GKANLQDAFALFR-DGE
SSRP_GLOVI      -----------NRKARFEYEI-LETYSAGLALLGTEVKAIRA-GRANLNDAFARIH-HGE
SSRP_DESRM      GFKTITD----NRRARHEYHV-IETYEAGIALSGTEVKSLRA-GKANLQDAFARVE-NGE
SSRP_PELTS      -----------NRRARHEYHI-LETFEAGLALRGTEVKSLRA-GKASLQDSFARVE-NGE
SSRP_MOOTA      -----------NRRARHDYFI-EETYEAGIALTGTEVKSLRN-GRANIKDSYARVE-NGE
SSRP_CARHZ      -----------NRKAYHDYHI-LEKYEAGIALKGTEVKSIRL-GRVNLRDSFARIE-NGE
SSRP_SYMTH      -----------NRKARHDYFV-EETYEAGIVLVGSEVKSCRA-GRVNLRDAYAQIK-DGE
SSRP_ROSS1      -----------NRKARHDYFI-EETYEAGIALTGSEIKSIRA-GQVNLRGGYVRIV-DGE
SSRP_CHLAA      -----------NRKARHDYDI-EETIEAGIVLSGSEIKSVRA-GRVNLRGSFARVI-DDE
SSRP_SYNWW      -----------NRRARYEYHI-KENLEAGLVLVGTEVKSLRM-GKANLRDAYAVVK-DGE
SSRP_SYNAS      -----------NKTARINYFI-EDTYEAGIVLAGTEVKALRD-GKGNLKDSYVAVK-DEE
SSRP_ALKMQ      -----------NKKARFDYLI-EDTFEAGMVLVGTEVKSIRQ-GKINIKEGYARIE-NSE
SSRP_ALKOO      -----------NKKARHDYFI-EETFETGIVLVGTEVKSIRQ-GKLNIKDGYARVE-NSE
SSRP_LACP7      -----------NKKARFDYFI-EETYEAGVVLHGTEVKSLRM-GKCSIKESFMRIE-NGE
SSRP_CALS8      -----------NRKAYHDYFI-EETIEAGIELKGTEVKSVRL-GHVNLKDSFARVE-NGE
SSRP_CALS4      -----------NRKAFHDYFI-EETYEAGIELVGTEVKSVRQ-GKVNLKDSFARVE-NNE
SSRP_ACET2      -----------NRKARHDYFI-EQTIEAGIVLSGTEVKSIRA-GKVSLKDSYANVK-NGE
SSRP_DESHY      -----------NRKAYHDYFV-EEKLEAGVILTGTEIKSIRN-GRVNLKDSYARIE-NGE
SSRP_CLOPS      -----------NRKARHDYFV-DEAMEAGIALVGTEVKSIRN-GRVNLKDCYADIN-NGE
SSRP_CLOB8      -----------NRKARHDYFV-EEAMEAGLVLVGTEVKSIRN-GRVNLKDCYADIY-NGE
SSRP_CLOBL      -----------NRKARHDYFI-EETYEAGIELVGTEVKSIRQ-GKANLKDSYAEIR-NGE
SSRP_CLOTE      -----------NRKARHDYFV-EEAYEAGIELVGTEVKSIRE-GKANLKDSYAEIR-NGE
SSRP_CLONN      -----------NRKAYHDYFI-EETFEAGIALVGTEVKSIRG-GKANLKDSYASIR-NGE
SSRP_CLOK5      -----------NRKARHDYFI-EESMEAGIQLVGTEVKSIRA-GKSNLKDSYGEII-NGE
SSRP_CLOAB      -----------NRKAWHDYFI-EETYECGVELVGTEVKSIKN-GKANLKDSYAEIR-NGE
SSRP_STAHJ      -----------NRKARHDYNI-EDTIEAGIALKGTEIKSIRR-GSANLKDSYAQVK-RGE
SSRP_CLOD6      -----------NKRARHEYFI-EETYECGIELKGTEVKSIRQ-GKVNLSDGFASVD-NSE
SSRP_GEOTN      -----------NKKARHDYFI-EETYEAGLVLQGTEIKSIRN-GRVNLKDSFAKVE-KGE
SSRP_BACCN      -----------NKKAFHDYFI-DETYEAGLVLQGTEIKAIRA-GRVNLKDAFARVH-NGE
SSRP_ENTHA      -----------NKKARHDYSI-IDTMEAGMVLQGTEIKSIRN-SRINLKDGFVRIR-NGE
SSRP_LISW6      -----------NKKARHDYAI-EETFEAGIVLQGTEIKSVRN-ARVNLKDSYARID-KGE
SSRP_HALH5      -----------NKKARHDYFI-EETFEAGMVLQGTEIKSIRA-GRANLKDSFARVS-NGE
SSRP_OCEIH      -----------NKKASHDYFI-EDTYEAGIVLHGTEIKSIRN-GRVNIKDSHARIDRKGE
SSRP_STRPG      -----------NKKARHDYHI-VETVEAGIVLTGTEIKSVRA-TRIQLKDGFAQIK-NGE
SSRP_STRT1      -----------NKKARHDYSI-VDTIEAGIVLTGTEIKSVRA-ARIQLKDGYAQIK-NGE
SSRP_STRMU      -----------NKKARHDYEI-LETYEAGIVLTGTEIKSVRA-ARITLKDGFAQVK-NGE
SSRP_STRS2      -----------NKKARHDYTI-VDTVEAGMVLTGTEIKSIRA-GRINLKDGFAQIK-QGE
SSRP_LACLA      -----------NKKARHDYEI-YETFEAGIVLTGTEIKSVRQ-AKIQLKDGFARVR-NGE
SSRP_LACJO      -----------NKKASHDYFI-KETLEAGIALTGTEIKSIRA-RRINLRDGYVQII-NGS
SSRP_LACDB      -----------NRQARHDYFI-KDTYEAGIALTGTEIKSVRA-RHVTLRDGYVQII-NGS
SSRP_LEVBA      -----------NRKARHDYTV-LETVEAGIALTGTEIKSVRE-RRVNLQDGFAQIR-NNE
SSRP_LACPL      -----------NRKARHDYAV-EETYEAGIALTGTEIKSVRD-RRVNLKDGFVQVR-NGE
SSRP_LIMRD      -----------NKKARHDYFV-TDTVEAGLVLTGTEIKSVRA-HRVNLKDGFAQVR-NGE
SSRP_LIGS1      -----------NRKARHDYNI-LETYEAGIALTGTEIKSVRA-SRINLKDGFAQVK-NGE
SSRP_PEDPA      -----------NKKARHDYSI-LSTMEAGMVLTGTEIKSIRD-RRVTLRDGYVQIR-HGE
SSRP_LACP3      -----------NKKAGHDYNI-LDTYEAGIALTGTEIKSVRD-GKLNLRDGFARIR-NNE
SSRP_LATSS      -----------NKKAGHDYNI-LETFEAGLVLTGTEIKSVRK-GKISLRDGFARVR-RGE
SSRP_LEUMM      -----------NRKARFNYAI-AETFEAGISLTGTEIKSVRA-GQITIGDGFVTIH-NGN
SSRP_OENOB      -----------NRRASFNYFI-GETYEAGIQLTGTEIKSVRL-GQITIGDAYITVR-DQQ
SSRP_GEOSL      -----------NKKAFHDFFI-EERFEAGMVLKGTEVKSLRD-GKANLNDSFALIR-NGE
SSRP_GEOUR      -----------NKKAYHDYFI-EEKFEAGMVLKGTEVKSLRI-GKANLNDSFALVK-NGE
SSRP_PELPD      -----------NKKAYHDYFI-EEKMEAGLVLLGTEVKSLRA-GKANLNDSFMLVR-DGE
SSRP_SYNC1      -----------NKKAYHDYFI-DEVLEAGMVLLGTEVKSLRL-GKANLKDAFCRIM-GGE
SSRP_TREDE      -----------NKKAFFNYTV-EEKIECGLVLKGTEVKSLRE-GRISFPDAFAEIK-DNE
SSRP_TREPA      -----------NRKAFFNYHV-EDRLECGIALEGTEVKSVRA-GHLSFPDAFAEMR-GGE
SSRP_BORAP      -----------NKKAKFNYFI-EEKISCGIVLKGTEVKSIKA-KKLSFNNSFAIIK-KEE
SSRP_DEHM1      -----------NRKAFHNYFL-EEKYEAGIMLLGTEIKSLRS-GRVNMGDAYVKPQ-RGE
SSRP_CHLMU      ------------RKAFHNYEV-LETFDAGIVLTGTEIKSLRD-HGGNLGDAYVTIS-KGE
SSRP_CHLPN      ------------RKALRNYEV-IETLEAGIVLTGTEIKSLRD-HGGNLGDAYVIVS-KGE
SSRP_PARUW      ------------RRATHDYEI-LETFETGIVLQGTEIKSIRD-HGATLQDAYVKVI-HNE
SSRP_KORVE      PVASGERDASVNRAASHNYFL-LDKYEAGVALRGTEVKSIRD-GRANLKDAYGLVK-ENE
SSRP_SOLUE      -----------NRQAGHNYFL-SERFECGMVLTGTEVKAAKD-AKIQLKDAYASVL-GDE
SSRP_ACIC1      -----------NKKARHDYHI-EDTYEAGIVLTGTEVKSLRA-GRASLVDGFALIKD-GE
SSRP_SACEN      -----------NRRARHDWSV-LDTYETGIVLTGTEVKSLRQ-GKASLVDGFATVDR-GE
SSRP_FRACC      -----------NKRARHDYDI-LDTYEAGLVLRGTEVKALRA-GRASLVDGFAQISD-GE
SSRP_THEFY      -----------NRRARHDYHI-EDTYEAGLVLTGTEVKSLRA-GRASLVDGFAQIKN-GE
SSRP_SALTO      -----------NRKARHDYSI-LDTYEAGMALTGTEVKSLRA-GRASLVDAFAQERN-GE
SSRP_COREF      -----------NRKARHDYQI-LDTWEAGVVLLGTEIKSLRE-GKASLVDAFAVIDN-GE
SSRP_CORDI      -----------NRKARHDYKI-LDTFECGIVLLGTEIKSIRE-GKVSLTDSFATIDE-GE
SSRP_CORJK      -----------NRKARHDYHI-IDTYECGVVLVGTEVKSLRE-GKASLVDAYATIDE-GE
SSRP_MYCUA      -----------NRKARHNYSI-IEVFEAGVALQGTEVKSLRE-RHASLVDAFATVDD-GE
SSRP_MYCPA      -----------NRKARHNYSI-IETYEAGVALQGTEVKSLRE-GQASLADAFATIDD-GE
SSRP_MYCS2      -----------NRKARHNYTI-LDTYEAGIVLMGTEVKSLRE-GQASLADAFATVDD-GE
SSRP_RHOJR      -----------NRKARHNYTI-LDVYEAGIALVGTEVKSLRE-GKASLVDAFATVDD-GE
SSRP_ARTS2      -----------NRKARHDYHV-LDTYEAGIALMGTEVKSLRE-GHASMVDGFCTFYN-DE
SSRP_RENSM      -----------NRKARHEYHL-GDTYEAGLALMGTEVKSLRE-GRANLTDGFATFYG-DE
SSRP_CLAMS      -----------NRKARHDYTI-ESTYEAGLVLTGTEVKSLRQ-GRASLVDGYAFVDA-GE
SSRP_LEIXX      -----------NRRARHDYTI-EDTYEAGLVLTGTEVKSLRL-GRASLVDGYAFVDG-GE
SSRP_STRCO      -----------NKKARHDYQI-LDTYEAGLVLSGTEVKSLRQ-GRASLADGFVQLDG-HE
SSRP_NOCSJ      -----------NKKARHDYHI-EDTYEAGLVLQGTEVKSLRQ-GRASLVDGFVDIDR-GE
SSRP_KINRD      -----------NRKARHDYFI-DDVYEAGVSLMGTEVKALRM-GRASLVDGFAHIDR-GE
SSRP_BIFLO      -----------NKKARHDYAI-EDKYEAGLALTGTEVKSLRE-GRASLSEAFISIDRRGE
SSRP_CUTAK      -----------NRRATHDYTI-GDTWEAGLVLQGTEVKSLRA-GKATLTDAFAQVDERGE
SSRP_TROWT      -----------NKSAEYNYFL-DKTFEAGLVLLGSEVKSVRQ-QKISLSEAYIYED-NSE
SSRP_SALRD      -----------NKKAQFEYDI-EETLEAGLVLEGSEVKSVRQ-GKASLDGAYCQVDREGE
SSRP_ANADE      -----------NRRARFDYDI-EDTWEAGLVLTGSEVKSLRE-GNVNLSDAYAMPRG-EE
SSRP_ANADF      -----------NRRARFDFTI-EDSWEAGLVLTGSEVKSLRE-GNVNLSDAYALPRG-DE
SSRP_MYXXD      -----------NRRARFDYTV-DEKVEAGLALTGSEVKSLRD-GIANLSDAYALPKG-DE
SSRP_BDEBA      -----------NKKARFDYTI-VETYEAGLQLMGSEVKSLRN-KDVQLKDSYISFKG-DE
SSRP_SORC5      -----------NKRAGFNYDL-GDRFEAGIVLKGSEVKMLRA-GKADLTDSFCTVL-RGE
SSRP_PELUB      -----------NRKASFNFFF-EDLIEAGIVLKGSEIKSIRD-GKVNIADSYAVEK-DGE
SSRP_LEPIC      -----------NKKAKFNFEL-ISFLEAGIVLSGSEVKSLRD-KKGNLTDAFAKIK-NGE
SSRP_GLUDA      -----------NRKGRFNYTI-LETLEAGMVLKGPEVKSLRL-GRATINEAYAGD-RDGE
SSRP_GLUOX      -----------NRKGRFDYTI-LETTEAGIVLKGPEVKSLRL-GRATITEAYAAE-RDGE
SSRP_GRABC      -----------NRKARFDYTI-KETVEAGLVLKGPEVKSLRH-GRATLSEAWAGE-RDGE
SSRP_ACICJ      -----------NRKARFNYTI-KDTVEAGIVLRGAEVKSLRM-GRATLSEAFAGE-RDGE
SSRP_MAGSA      -----------NRRARHEYFI-VSEVEAGIMLVGTEVKSLRV-GKGNINEAFAGP-MQGE
SSRP_RHORT      -----------NRRARHDYSI-EETIEAGLILVGTEVKSLRT-GRANIADSYAGP-KSGE
SSRP_AGRFC      -----------NRKARFNYEI-IDTYEAGLVLTGTEVKSLRE-GKANIAESYASD-EGDE
SSRP_SINMW      -----------NRKARFNYEI-VDTYEAGLVLTGTEVKSLRE-GKANIAESYATD-EGGE
SSRP_CHESB      -----------NRKARFSYEV-IDTLEAGLVLSGTEVKSLRE-GHANIQESYAAV-EGGE
SSRP_RHILO      -----------NRKARFSYEV-LDTIEAGLVLTGTEVKSLRQ-GQANIQDSYASV-EGGE
SSRP_BARBK      -----------NRKARFNFEL-LEHLEAGIVLNGTEVKSLRS-NHANIAESYASF-ENEE
SSRP_BRUA4      -----------NRKARFNFEI-LDTLEAGLVLTGTEVKSLRA-NQSNIAESYASF-ENGE
SSRP_RHOPB      -----------NRKARFNYAI-EDTLEAGIALTGTEVKSIRN-GKSTIAESYADP-KDGE
SSRP_AZOC5      -----------NRRARFDYDI-GEVFEAGIALKGTEVKALRT-GKATIHESYAGG-KNGE
SSRP_SPHEL      -----------NRRARFDYFI-EQTYEAGLVLTGTEVKSLRF-GEGSIAEAYAEV-KDEX
SSRP_RHIWR      -----------NRRARFDYFL-EQFFEAGIALTGTEVKSLRF-GEGSIAESYAEV-KDDQ
SSRP_NOVAD      -----------NRRARFEYFI-EETYEAGICLTGTEVKSLRF-GEGSIAESYAEV-KNGE
SSRP_SPHAL      -----------NRRARFDYAI-EQVFEAGIALQGTEVKSLRF-GEGTIAESYAEV-NGGE
SSRP_ERYLH      -----------NRRARFDYAV-EDKFEAGIALQGTEVKALRA-GEASIAESYAEV-RDGE
SSRP_ZYMMO      -----------NRRARYEYAF-EDFYEAGLALTGTEVKSLRF-GQGSIAESYAEV-KNGE
SSRP_CAUSK      -----------NRRARYDYFI-EETMEAGLMLTGTEVKSLRV-GRANIAESYASV-EGRT
SSRP_HYPNA      -----------NRRSRREYSV-EDTLEAGIMLVGSEVKSLRE-GRANIAESYASV-EQGE
SSRP_MARMM      -----------NRRARFDYEI-EETFEAGLMLMGSEVKSLRE-GRANIAESYVSA-EREG
SSRP_DINSH      -----------NRRARREYAI-EEDLEVGIVLEGSEVKSLRE-GGSNIAESYATV-DDGE
SSRP_JANSC      -----------NRRARFDYAI-ESDLEVGIILEGSEVKSLRQ-GQSNIAESYAEV-KEGE
SSRP_PARDP      -----------NRRARFDYFI-ESDLEVGIVLTGSEVKSLRT-GQSNIAESYASV-ENGE
SSRP_ROSDO      -----------NRRARFDYAI-ESDVECGIILEGSEVKSLRE-GGANIAESYAAV-EDGE
SSRP_CERS5      -----------NRRARFDYFI-EEEIEAGIILMGSEVKSLRQ-GGSNIGESYASV-ENGE
SSRP_PARL1      -----------NRKARFNYSI-GETFEAGIELKGSEVKSLRT-GQGSLNEAYAQVTRTGE
SSRP_RICCK      -----------NKKALFNYFI-EERLEAGIVLKGSEVQSLRQ-GKASIEESYAGD-TGHE
SSRP_ORITB      -----------NRKAKFNYFI-QDKMEAGIVLQGSELKSIRS-GKVSIEDSYAAE-SSNE
SSRP_ANAMM      -----------NRKARFDYFV-LQEYDAGMVLVGSEVKSLRQ-RKVNMGDAYVLE-KDME
SSRP_ANAPZ      -----------NRKVRFNYTI-LSEYDAGIVLLGSEVKSLRQ-HKVSMGDAYVLE-SGME
SSRP_EHRCJ      -----------NRKVRFNYFI-IQEFDAGIVLIGSEVKSLRQ-RKVSIAEAYVTE-KNME
SSRP_WOLTR      -----------NRKARFEYFI-LEEFEAGMVLLSSEVKSLRE-RKVNISDAYVTE-KNGE
SSRP_NEOSM      -----------NKKARFDYSL-IDEFEAGIVLLGTEVKALKY-HSASLNEAFVAF-RRFE
SSRP_PHOV8      -----------NKRASFDYEF-IDTYTAGIVLTGTEIKSIRL-GKASLVDTYCYF-VQGE
SSRP_PARD8      -----------NKRATFDYEL-LDTFTAGIVLTGTEIKSIRL-GKASLVDTFCIV-EKGE
SSRP_PORGI      -----------NKRATFDYEI-LDVYTAGIVLVGTEIKSLRL-GKGGLVDTYCYF-HRGE
SSRP_FLAJ1      -----------NKRARFDYEI-IDTYTAGIVLAGTEIKSIRL-GKANITESFCEF-SGIE
SSRP_FLAPJ      -----------NKRAKFEYEI-IDRYTAGMVLTGTEIKSIRL-GKANIAESFCEF-QGDE
SSRP_GRAFK      -----------NRKAKFNYEF-LDKYTAGIKLAGTEIKAIRE-GKANIAESFCEF-NNHE
SSRP_CYTH3      -----------NKKASFEYEF-LEKYEAGIVLKGTEIKAIRM-SKASISEAYCLF-DNEE
SSRP_CHLL3      -----------NRKARYEYQI-LETIVAGIELLGSEVKSVRL-GKASLNESFATI-HHDE
SSRP_CHLPM      -----------NRKARFEFEI-LDTVVAGIELLGSEVKSVRL-GKASLNESFAII-HHGE
SSRP_CHLPD      -----------NRKARFEFHI-LETMVAGIELLGSEVKSVRQ-GKASLNESYAMI-HHGE
SSRP_CHLTE      -----------NRKARFEYEI-LDTIEAGIELLGSEVKSVRL-GKASLSESYAMI-HHGQ
SSRP_CHLCH      -----------NRKARHEFEI-IETFVAGIQLAGSEVKSVRL-GQASLNESFAII-LRNE
SSRP_DESPS      -----------NKKAYHEYEI-LDTYEAGMVLSGPEVKSLRG-GRGNLVDGHVAINARGE
SSRP_RHOBA      -----------NRKAKFRYEI-LDSVECGMMLMGSEVKSMRE-GKLSLDEAHIRV-TNGE
SSRP_ACHLI      -----------NKKAHFEYFI-EQKFVAGIKLQGSEVKSIRA-GKCSINEAYITFR-NGE
SSRP_FUSNN      -----------NKKAFFDYFI-EEKYEAGIELKGSEVKSIKA-GKVSIKEAFVRII-NDE
SSRP_MYCMS      -----------NKKAYFNYEI-IQTYQAGIVLNGPEIKSIRN-HDVSINEAFVLIR-KKE
SSRP_MESFL      -----------NKKAKFNYEI-LETWEAGIELYGPEIKSIRN-HEANIAEAFILIR-KKE
SSRP_UREP2      -----------NKHARRNYEL-LDFFECGIVLKGTEVKSISR-ANCSINEAYVQII-KNQ
SSRP_MALP2      -----------NKKLHFNYEV-LEKIEAGIELKGVEVKSIHL-NNANISDSYVIFK-RNE
SSRP_MYCFP      -----------NKRGMHNYKV-IDKYEAGISLMGWEVKSARA-NTVSLLNSYCFFR-KGE
SSRP_MYCPU      -----------NKQVFRDYEI-IDKLEAGIVLQGWEVKSIRA-SDVNLKGSYCVFK-ANE
SSRP_MESH2      -----------NKRANFDYEI-IDRFTAGIVLLGWEVKSIQA-KNISLVGAFCYFK-GHE
SSRP_MESM1      -----------NKDAFFNYEI-LEKYKAGLILKGWEVKSIRE-NKVQLKGAFITFK-NDE
SSRP_ONYPE      -----------NKKAFYDYSLEKKKYQAGIKLLGSEVKSIRI-GKINLLNSYIHIK-NEE
SSRP_MYCGE      -----------NPKAKYDYHL-MESYCAGIVLKGSEVKALSL-GQGSLKEAYVFVK-NNE
SSRP_MYCPN      -----------NPRAQYDYYL-LTGYCAGLVLKGSEVKSLAL-GQGSLKEAYVFID-KHE
SSRP_MYCGA      -----------NKKAKYNYEL-LDKYEAGISLSGNEVKSLAL-HHGKLDDSYVIIR-KNE
SSRP_CAMC5      -----------NKKALHDFSI-LETFEAGVVLKGSEVKALRA-GRANLKDSFVRII-KGE
SSRP_CAMFF      -----------NKKAFHDYAI-LETFEAGIALKGSEVKALRA-GRANLKDSFVRII-RGE
SSRP_CAMHC      -----------NKKAWHNFTI-IENFEAGIVLKGSEVKALRM-GRANLKDSFCRII-KGE
SSRP_CAMJR      -----------NKKALFDYSI-IERFEAGIVLKGSEVVALRA-GRANLKDSFVRII-KNE
SSRP_WOLSU      -----------NKKALFDFHI-LERLEAGIALSGSEVKAIRA-GRVNLKDSFVKII-KGE
SSRP_ALIB4      -----------NKKAFHDFTI-LETLEAGIVLEGSEVKAIRE-GRVNLKDSFVRII-KGE
SSRP_HELAH      -----------NKKAYFDYEI-LETLEAGLVLLGSEVKALRQ-TRVNLKDNFVKII-KGE
SSRP_HELHP      -----------NKKAYFDYEI-LQSLESGIVLQGSEVKSIRA-GRVNLKDSFIKII-RGE
SSRP_NITSB      -----------NKKAFHDFEI-LERYEAGLVLQGSEVKAIRA-GRVNLKDSFVKFV-KGE
SSRP_SULDN      -----------NKKAYFDYFL-EEKFEAGLVLKGSEIKAIRA-GRVNLKDSFIRFV-QGE
SSRP_SULNB      -----------NKKARHDYEI-LEKFEAGIVLSGAEVKALRA-KRANLSDAFCRFI-KGE
SSRP_BUCAI      -----------NKKAYYNYFI-EKVFQSGLVLEGWEIKSIRS-GKVNISESYIIND-RNE
SSRP_BUCAP      -----------NKKAYYNYFI-EEVFQSGLVLMGWEVKSIRL-GQVNIIESYINNDNLNE
SSRP_BUCBP      -----------NRKAKYSFSI-KETFEAGIVLLGWEVKSVRC-GKINISNSYISLK-NGE
                                  : .       *  * . *:          .            

SSRP_ALBFT      LFVIGLQINPLGTASTHISPDKQRTKKLLMHKEEIKRLIGKVEQKG-YTLVPLNLHW-KA
SSRP_POLSJ      LFIIGCQINPLGTASTHVRPDSVRTKKLLMHKDEIRRLVGKVEQKG-FTLVPLNMHW-KA
SSRP_VEREI      LFLLGCQLQALKTASTHVSPEAARTKKLLLKKDDIRRLIGKVEQKG-YTLVPLNLHW-KN
SSRP_METPP      LFLIGCRINPLRTASTHVHPQADRTKKLLMKKDEIRRLVGKVEQKG-YTLVPLNLHY-KG
SSRP_NITMU      LFLIGCHVSPLLAASTHIQPDPVRTRKLLLHAEEIKRLIGKVERAG-YTLVPLDIHY-KK
SSRP_METFK      IYLIGCHVTPLGSASTHVRPDAIRTRKLLLHSEQIAKLIGKVERAG-YTLVPLDMHY-TR
SSRP_AROAE      LFILGMHISALQSASTHVETDPVRTRKLLMHAKEIAKLIGKVERAG-FTLVPLDLHY-AK
SSRP_DECAR      LFLIGMHISPLATASTHVSHDPTRTRKLLLHAKEISKLIGKVERAG-YALVPLDLHF-VR
SSRP_PARXL      LFLIGTHISPLPEASTHINPDPVRTRKLLLHSEEISKLIGKVEQRG-YTLVPLNFHY-KG
SSRP_RALSO      LFLIGAHISPLQSASTHVKPDPTRTRKLLLHAEEIKKLIGKVEQRG-YTLVPLNLHY-AR
SSRP_POLAQ      LFLIGCHITPLLSASTHIVPDSTRTRKLLLNAIEIRKLIGKVEQKG-YTLVPLNLHF-TK
SSRP_NEIG1      FYLVGCHITALPTASTHIKPDAVRPRKLLLKQSEINKLIGKTERAG-YTIVPLDLHF-SR
SSRP_THIDA      VYLIGCHISPLPTASTHIHPDPTRSRKLLLHAAEINKLIGKTERAG-FTLVPLDMHY-SK
SSRP_CHRVO      FWLIGCHITPLQSASTHVKPDPVRPRKLLMSQAEINRFIGKVERAG-YTMMALDLHY-TK
SSRP_BORA1      LFLLGMHVSPLPTASTHIHPDAMRTRKLLLKAEEIHKLIGKVEQRG-FTLVPLNLHY-KN
SSRP_COXBU      AWLIGAHLSPLPNVAEYMKADPQRSRKLLLNKREIGKLFGAVQKQG-LTVVPLDLHW-HK
SSRP_ALKEH      AWLIGCTITPLPTASTHIKPDPTRTRRLLLHKKEIARLTGAADREG-YTVVPLDLHW-KR
SSRP_HALHL      AWLIGCNITPLSTASTHIHPDPTRTRKLLLHRREINRLIGAVDRDG-YTVVPLKLYW-KR
SSRP_NITOC      VWLFGVHLSPLNTVSTHIHPDPLRTRKLLLHAKELRKLIGAVERKG-YALIPLTLYW-KR
SSRP_ALCBS      AFLFGARFEPLNTASTHVNPDPTRTRKLLLHRRELGRVFGGVQKDG-FTCVPVSLYW-KK
SSRP_METCA      AWLFGAHFSPLPSASTHVQPDPTRSRKLLLHAEELSRLIGQVERKG-YTLVPLSLYW-KQ
SSRP_ACIAD      AYLFGAQIQPLLTASSHVVPEATRTRKLLLSRREIGQLLGAVNQKG-YSCVPLACYW-KG
SSRP_SACD2      AWLQGAQIQPLPQACTHYVTEPARPRKLLLNRRELNKIAEAKDQKG-YTIVATSLYW-KA
SSRP_PSEE4      AWLFGSHITPLTTASTHVIADPIRTRKLLLNKRELERLEAAVAQKG-YTCVAMSLYW-SK
SSRP_PSESM      AWLMGCHITPLKTASTHVIADPTRTRKLLLNQRELEKLTSSVQQKG-YACVALSIYW-KQ
SSRP_PSEMY      AWLMGAHITPLKTASTHVIADPIRTRKLLLHKRELDKLFGAVQQKG-YTCVALSLYW-KQ
SSRP_HAHCH      AWLLGAHITPLKEASTHVIADPTRTRKLLLHRRELNKLIGAVSQTG-HTCVPLALYW-KG
SSRP_MARN8      AWLLGSHITPLNTASTHVIADPTRTRKLLLHAKEIAKIVGQVNQAG-YTCIPLALYW-KK
SSRP_CHRSD      AWLLGSHITPLNTVSTHVVADPSRTRKLLLHRKEIAKIFSRTQDKG-HTCVPLKLYW-KK
SSRP_PSYWF      AFLFGAHIQPLLSSSTHVDPDSIRTRKLLLNRKEIDTLFGAVNQKG-YACVPLEVYW-KD
SSRP_VESOH      IFLYGAHISPLKSVSTHVNSDPIRTRKLLLNRLEINRIKEKINQKG-ATIVALKLYW-IR
SSRP_HYDCU      AWLFGALITPLITASTHSNHDPLRLRKLLMHRREIDRLMGLVDQKG-FTVVPLGLHW-SK
SSRP_HAEDU      AFLFGATITPLNMASTHIVADPTRTRKLLLNQRELDSLFGKVNRDG-MTVVALSLYW-KN
SSRP_PASMU      AYLFGATIQPLNVASTHIVCDPTRTRKLLLKQKELASLFGKANRDG-YTIVALSLYW-KG
SSRP_ECOLI      AFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREG-YTVVALSLYW-KN
SSRP_AERS4      AFLFGSTFLPLNAASSHVVCDPTRTRKLLLSRHELDKLESLTARQG-YTIVPLALYW-KE
SSRP_VIBVY      AFVSGMTITPLNQASTHVVANPTRVRKLLMSRRELDNLLGRINREG-MTLAALSLYW-AR
SSRP_ALIF1      IFISGMTITPLQAASTHVIANPTRIRKLLMSRKEIDNLIGRVNREG-MTLVATTMYW-VR
SSRP_PHOPR      AFISGVTITPLNAASTHVVADPTRTRKLLLNRKEIDKLLGAVNREG-QTIVALSMYW-KA
SSRP_SHESM      AFMHGCTIIPLNTASTHVVCDPIRLKKLLLSRKELDKLAGLVERQG-YSIIPISMYWRKG
SSRP_SHEFN      AFMHGCTIQPLNTASTHVICDPIRTKKLLLKRSEIDKLAGLIERQG-YTLVPLSMYWRKG
SSRP_SHEAM      AFLHHCHITPLHAASTHVVCDPTRPRKLLLNRRELDRLAGLVERQG-YAIVPISMYWRKG
SSRP_SHELP      AYLFGCTITPLNTASTHVVCDPMRDRKLLLNRRELDKLQGLVERQG-YSIVPISMYWRKN
SSRP_COLP3      AYLLGAEISPLNAASSHVVCDPNRDRKLLLNRRELDKIIAAVERDG-YSLIATAMYW-KA
SSRP_PSET1      AFLLGAQIQPLNSASTHVICDPLRYRKLLLSRRELDRLVGATERDG-YSLIATAMYW-KN
SSRP_PSEA6      AFLVGSTIQPLNQASSHVVCEPLRQRKLLLNKRELDKLIGSVERQG-YSILATAMYW-KK
SSRP_IDILO      AYLLGAEIQPLNQASSHVYCEPDRSRKLLLKRRELDKLIGASEREG-YSIVATTIYW-KG
SSRP_PSYIN      AWLLGATFPPLLVASSHVVCDPMRYRKLLLNRRELDNLVGKVERQG-YSIIPISLYW-KH
SSRP_LEGPA      AFLLGAQIQPLPTASTHFIPDPVRTRKLLMNKKELNHLIGSVERQG-YTIVPLSLYW-KK
SSRP_XANC8      IYLIGAQITPLIQASTHVIPVERRDRKLLLHRAEIDKVLTRVEREG-YTLVPTALYW-SS
SSRP_XYLFT      IFLIGAQITPLIQASTHVVANDRRTRKLLLHRHQIDTLIGRVQREG-FTLVPTAMYW-SK
SSRP_FRAP2      AWLFNCLITPLLSASTHVVADASANRKLLLNRREIDKIMGRIEQKG-FTCVPLAMYW-KG
SSRP_BAUCH      AFLLGATLRPLIVASSHILYSPMRSRKLLLRRRELDTLLGKVHRKG-YTIVPISLYW-RN
SSRP_DICNV      VYLFGALIHPLASASSHIFPEAQRTRKLLLHRYQIAKLIGASERDG-YTLMPVSLYW-KN
SSRP_DEIRA      VDLEGLYIPVYKE-ATYNNHEPRRKRRLLLHREEIEKLRRGLEQKG-LTLVPTRLYQKGR
SSRP_THET8      LYLENLYIAPYEK-GSYANVDPRRKRKLLLHKHELRRLLGKVEQKG-LTLVPLKIYFNER
SSRP_AQUAE      AWLYNLYIAPYKH-ATIENHDPLRKRKLLLHKREIMRLYGKVQEKG-YTIIPLKLYWKNN
SSRP_DESVV      AFLVGLHIAPYDN-AGYAQHDPDRDRKLLLHAHEIENLARSVEQKG-YTVVPTKLYFARG
SSRP_OLEA2      AWIVGMHIAPYAN-AGYVQHDPDRDRKLLLHAREIDTLRARVEQKG-LTVVPVKLYFKNS
SSRP_LAWIP      GYIVGLHIPPYNN-AGYVIQNPDRPRKLLLHRQELKMLASKVEQKG-LTIVPLKLYFKNR
SSRP_FERNB      IWLLNLHIPPYQH-GNIYNHDPERPRKLLLHKKEIDRIWSKLKLEG-YTVIPTKIYFNNQ
SSRP_THEM4      VFLLNLNIPQYRN-GSLNNHDPERPRRLLLHKKEIHRLLGKVKEQG-LTIIPTKIYFNNR
SSRP_THEP1      LYLLNLHIPPYSH-GGVYNHDPERPRKLLLHKRELKRLMGKVQEEG-VTIVPLKIYFNDR
SSRP_PSELT      IYMLNLHISPYKF-ANRFNHDPERPRKLLLHKREIKRLIGKLTTTG-LTLIPTKIYFNDH
SSRP_PETMO      LILYNVHISPYSG-ASIFNHDPERPRKLLLHKKEIRRLQSKVQQEG-LTMIPLEIYTNNK
SSRP_RUBXD      VFLVGAHISPYKN-ATNVPQEPTRDRKLLLHRKEIDRLAGKSQEER-KTIIPLRLYPKN-
SSRP_SYNFM      VFLQGLHISPYTH-ASYNNHEPERVRKLLLHAHEIKRLTGKTQERG-LALIPLKLYFSK-
SSRP_MICAN      AVLINVHISPYEQSSEYFNHDPRRTRKLLMHKKEISKLIGQVEQKG-LTLVPLKMYFK-G
SSRP_SYNY3      VWLMNVHISPYDKSSLFFNHDPRRTRRLLMHNWEIRKLIGQVEQKG-LTLVPLKMYFK-G
SSRP_SYNE7      VWLHNIHISPHQQASAYYNHDPLRTRKLLMHREEIRKLIGKVEQKG-LTLVPLKMYLK-Q
SSRP_TRIV2      IWLINAHISPYNASGQYFNHEPRRTRKLLLHRQEIRKLIGKVEQQG-LTLVPLKMYLK-R
SSRP_THEVB      AWLMNVHISPHESTNPSYNHDPLRDRKLLLHKQEIRKLVGKVEQKG-LTLVPLKLYLK-N
SSRP_ACAM1      AFLLNVHVSPHTNAGQFFNHDPRRTRKLLMHRQEIRKLIGKTEQKG-LTLVPLKLYLQ-R
SSRP_TRIEI      AWLLNVHISPYQKAGDFFNHEPRRSRRLLLHKQEIRKLIGKVEQQG-LTLVPLRMYFK-R
SSRP_SYNSC      LQLHNVHISPHTHAGNYFNHDPLRTRKLLAHRREIDKFRGLVDQKG-LTLIPLSLQLK-G
SSRP_SYNR3      LQLHNVHIAGHEQASRYFNHEPLRVRRLLAHRREIDKLRGQLDTKG-LTLIPLNIHLK-G
SSRP_PROMA      LLLHNVHISPFNNAGSFFNHEPLRVRKLLAHRKEINKLETQVNRKG-LTLVPLNIFLK-G
SSRP_PROMT      IQLHNVHISPHNHAGKFFNHEPLRIKRLLAHRKEIEKLKISLERKG-LTIIPLSLYLK-G
SSRP_PROM2      ILLLNVHISPHKNVGSFFNHDPLRNRKLLLHKKEIIKMKSSTEKKG-MTIVPLNLYLK-G
SSRP_PROMP      ILLLNVHISPHKNVGPFFNHDPLRNRKLLLHKKEIVKLKYNTEKKG-LTIIPLSIYLK-G
SSRP_SYNJA      AWLHNLHVAPHGTASKVFNHDPTRRRKLLLHRREIDRLRGLVEQKG-LTVVPLRLVLN-R
SSRP_GLOVI      VLLYNMNISPLQTAG-AFAHDPLRTRKLLLKRREIHKLTGRVEEKG-LTLIPLKLYLE-G
SSRP_DESRM      MMLYNLHISPYEQ-GNRFNHEPKRTRRLLMHKQEILRLYGKVREKG-LALIPLKVYFNPR
SSRP_PELTS      LLLYNMHISPYEQ-GNQFNHEPKRTRRLLMHKYEILRLMGKTREKG-LALIPLKVYFK-N
SSRP_MOOTA      LILHDMHISPYEQ-GNRFNHEPRRPRRLLMHRYEIQRLYGKVREKG-LTLIPLKVYFNER
SSRP_CARHZ      LWLYNMHISPYEQ-GNRFNHEPKRPRKLLMHKREIMRLFGKTREKG-LTLVPLKLYFK-G
SSRP_SYMTH      IFLLNCHISPFEQ-ANRFNHEPLRPRKLLMHKSEIHRLYGKVREKG-FTLVPLRLYFNQK
SSRP_ROSS1      AWLYDVHIAPYEQSGAYFNHEPTRPRKLLLHRREISRIAGQVERQG-YTLVPLRLYLR-G
SSRP_CHLAA      VFLYDAHIAPYEQSGKYFNHDPMRPRKLLLHRREINRLNGLVRMKG-MTLVPLKVYFK-G
SSRP_SYNWW      IWVNNFHISPYDK-GNQFNHDPLRPKKLLLHRREINRLYALQREKG-LTLIPLKIYFK-E
SSRP_SYNAS      IYLYGMHIGPYSH-GNISNHEPERVRKLLMHKREIRRLYGKSREKG-FTLIPLKVYFN-N
SSRP_ALKMQ      IYLHNVHISPYEQ-GNIFNKDPLRIRKLLLHKAEIRKLIGYVQQKG-YTLVPMKVYLQ-N
SSRP_ALKOO      VFLYNVHISPYEQ-GNIFNKDPLRVRKLLLHKSEIRKLIGYVQQKG-YTLIPLSFYLK-D
SSRP_LACP7      VYVYNMHISPYEK-GNIFNKDPLRVKKLLLHKFQINKIVGQIQQKG-YTLVPLTIYLK-D
SSRP_CALS8      VFLYNMHISPYEK-GNIFNVDPMRDRKLLLHKSEINRLAGYVQQKG-YTLIPLKIYLK-R
SSRP_CALS4      VILYNMHISPYEK-GNIFNKDPLRPRKLLLHRHEINKLSGYVSRKG-YTLIPTKVYLK-R
SSRP_ACET2      VFIYGMHISPYEQ-GNIFNKDPLRDRKLLLHRAEINKLIGYIQQKG-MTLVPLEVYFK-N
SSRP_DESHY      VWLYQLHISPYEQ-GNRFNHDPLRKRKLLLNRSEIIKLVGKVQQQG-LTLIPTKIYLK-R
SSRP_CLOPS      IFINNMHISPYEQ-GNIFNVDPLRKRKLLLHKSEIQRLIGIVQQQG-VALIPLSLYLK-N
SSRP_CLOB8      IFVKNMHISPYEQ-GNIFNVDPLRERKLLLHRDEIRRLDGLVSRDG-YTLIPLSLYLK-D
SSRP_CLOBL      VFVRNMHISPYEQ-GNIYNKDPLRDRKLLLHKSEIYKLVGFTTQQG-YTLIPLSLYLK-H
SSRP_CLOTE      VFLRNMHVSPYEQ-GNIFNKDPLRDRKLLLHKMQILKLTAYTTQQG-YTLIPLSLYLK-N
SSRP_CLONN      VFVCNMHVSPYEQ-GNIFNRDPLRERKLLLHKSQINTLLGYTAQQG-YTLIPLSLYLK-N
SSRP_CLOK5      IFIRNMHISPYEK-GNIFNRDPLRDRKLLLHKKEIARLLGYTAQQG-YTIVPLSLYLK-N
SSRP_CLOAB      VFACNMHVSPYKE-GNIFNVDPLRKRRLLLHKSEIDKLLGFTSQKG-YTLVPIALYLK-N
SSRP_STAHJ      MFINNMHIAPYEE-GNRFNHDPLRSRKLLLHKKEIIKLGERTREIG-YSLIPLKLYLK-H
SSRP_CLOD6      VFLKQVHISPYEQ-GNIFNVDSLRVRKLLLHKHEIRKLIGATTIKG-YSLIPLSLYLK-N
SSRP_GEOTN      VFLHNMHISPYEQ-GNRYNHDPLRTRKLLLHRREINKLIGYTKEQG-YTLVPLKLYIK-N
SSRP_BACCN      VWVHNMHISPYEQ-GNRFNHDPLRTRKLLLHKKEIQKLVGYTKETG-YTLVPLKIYLK-N
SSRP_ENTHA      AFLHNVHISPYEQ-GNIFNHDPLRTRKLLLHKKQISRLETETKNTG-VTIVPLKVYIR-D
SSRP_LISW6      IFLHNMHISPYEQ-GNRYNHDPLRTRKLLLHKKQISRLIGETKESG-YSIVPLKMYIK-D
SSRP_HALH5      VYLHNCHISEYEQ-GNRYNHEPTRARKLLLHKKQIDTLIGQTQQKG-YTIVPLKIYIK-N
SSRP_OCEIH      VQLINLHIAEYEQ-GNRYNHDPTRSRKLLLHRKEIDKLIGLTQQQG-YALVPLKIYLK-N
SSRP_STRPG      AWLVNVHIAPFEQ-GNIWNADPERTRKLLLKKREITHLANELKGTG-MTLVPLKVYLK-D
SSRP_STRT1      AWLINVHIAPFEQ-GNIWNQDPERTRKLLLKKKQITKLQNDLKGTG-MTLVPLKVYLK-N
SSRP_STRMU      VWLNNVHITPYEQ-GNIWNQDPDRTRKLLLKKREIAKLDNELKGTG-MTLVPLKVYLK-N
SSRP_STRS2      AWLVNVHIAPYDE-GNIWNQEPTRTRKLLLRKKQIESLDNEVKGTG-MTLVPLKVYIK-D
SSRP_LACLA      VWLSNVHIAPFEQ-GNIFNVEELRTRKLLLNKKEIAKIDKELSGTG-ITFIPLKVYLK-N
SSRP_LACJO      AFLENVHISEYKE-GNRYNHDPLRSRRLLLHKREIARLAGIQAQQG-MAIIPLKVYLK-H
SSRP_LACDB      AFLENVHIDEYKE-GNRYNHDPLRSRRLLLHKKEIAKLADVKAQKG-MTIVPLKVYLK-H
SSRP_LEVBA      AWLMNVHISEYVQ-GNRFNHDPLRNRKLLLHKKEIRRLGQATMDKG-VTLVPLRMYLK-H
SSRP_LACPL      AWMQNVHISPFKE-GNRYNVDPLRSRKLLLHKKEISKLGAATMTKG-VTIIPLKMYLK-H
SSRP_LIMRD      AWLMNVHISEYDN-GTYFNQDPLRNRKLLLHKKEINKLVGALQDKG-VTLIPLKMYIK-H
SSRP_LIGS1      VWLMNVHISLYDQ-GNIFNHDPLRNRKLLLHKKEIKHLSEETQKKG-ITIVPLKVYIK-N
SSRP_PEDPA      AILMNVQINEYLQ-GNQFNHDPFRNRKLLLHKKEILKLQEETKNKG-ITIVPLKMYLK-N
SSRP_LACP3      AWLENVHISPYKE-GNLFNVDPMRNRKLLLHKREIRKLGQMTARQG-VTLVPLRMYLK-H
SSRP_LATSS      AYLENVHISPYEQ-GNQFNHDPLRNRKLLLHKKEIAKIGALTKDKG-ITIVPLRVYLK-H
SSRP_LEUMM      ALLTNVHISSYVQ-GNQFNVDPLRTRQLLLHKREIRVLEKATQEQG-VTIVPLKVYLK-H
SSRP_OENOB      AFLNNANISPYKQ-GNQFNVDPLRRRKLLLHKKEILALDRAVSKEG-KTIVPLRVYIV-K
SSRP_GEOSL      IFLHNLHINPYAF-GNRENHDPDRLRKLLMHKKEIEKLFGKIREKG-YSVVPLRLYFK-N
SSRP_GEOUR      AFLHNLHISPYDF-GNRENHDPDRMRKLLLHKKEIGKLFSMIREQG-YTVVPLRLYFK-D
SSRP_PELPD      AFLHNLHISPYEF-GNRQNHQADRNRKLLLHRKQIDRLYGRIREQG-YSIVPLRMYFK-D
SSRP_SYNC1      LYVNNLHISPYEF-GNRENADPTRARKLLVHRAELDKLARKVDEKG-LSLVPTKLYFK-E
SSRP_TREDE      VWVKNFHISEYIY-SSVFNHDPERPKKLLLKKDEIKRLKRKVEEKG-YTLVPLEFYFK-N
SSRP_TREPA      LWLKNVHIAEYVH-ACSFAPNPDRMRKLLAHRDQIARLKRKVEEKG-YTLVPLEFYLK-A
SSRP_BORAP      LWLENLHVSKYKE-GNIFNHDELRPRKLLIKKKELQRLKKFKEKEG-YTLIPISFYLK-K
SSRP_DEHM1      LWLVNAHISAYEC-SGHTSHEPMRERKLLMHRKEIALLMSKVKEKG-LTLIPVRIYLK-N
SSRP_CHLMU      AWLLQSSIAPYRF-GNINNHEERRKRKLLLHKYELQKLDSRVSQKG-LTIIPLSFFFS-K
SSRP_CHLPN      GWLLNASIAPYRF-GNIYNHEERRKRKLLLHRYELRKLEGKIAQKG-MTLIPLGMFLS-R
SSRP_PARUW      LWLIGCNIAHYRF-GNIHNHEEKRDRKLLMHKREIKKCKGAIQEKG-LALIPLALYLK-Q
SSRP_KORVE      LWLINAHIGPYDA-ASYNNHAPLRTRKLLVKKREILKLLAASQQKG-HTLIPTRMYFK-N
SSRP_SOLUE      AWLLNAHISQYSH-GNRENHLPVRNRKLLLHRREIDKLQEITREKG-LALIPTKIYMK-N
SSRP_ACIC1      VWLQNVHIPEYAE-GSWTNHEPRRPRKLLLHKREILRLLGKTRETG-LTLVPLSLYFR-D
SSRP_SACEN      VWLRNVHIPEYTE-GTWTNHEPRRSRKLLLHKGEIIRLIGKIQESG-LSLIPLSLYFS-D
SSRP_FRACC      IWLHNVHIPEYTE-GTWTNHAPRRKRKMLLHRAEIEKLVGKTQEGG-LTLVPLSLYWK-D
SSRP_THEFY      VWLHNVHIPEYTM-GTWTNHAPRRPRKLLLHREEIAKLDAKTREAG-RTLVPLSLYFR-N
SSRP_SALTO      LYLHGMHIPEYVQ-GTWTNHEPRRTRKLLLNRIEIDRLIGKTRESG-LTIVPLQVYFS-D
SSRP_COREF      VWLHNLHIPTYSM-GSWTNHSPKRTRKLLLHRREIDSLMGKVRDGN-RTLVPLKLYLV-N
SSRP_CORDI      AWIRNLNIPIYSR-GSWTNHSPMRTRKLLLHRREIDSLMGKVRDGN-KTLVPLSLYFK-E
SSRP_CORJK      VWLRGLHIPEYSM-GHWTNHSPRRTRKLLLHRREIDSLMGKVRDGN-NTLVPLQLYFV-A
SSRP_MYCUA      VWLRNLHIPEYLH-GTWTNHEPRRNRKLLLHRRQIDTLFGKIREGN-FALVPLSMYFL-D
SSRP_MYCPA      VWLRNLYIPEYQH-GSWTNHDPRRNRKLLLHRQQIDRLVGKIRDGN-LALMPLSLYFS-E
SSRP_MYCS2      IWLRNVHIAEYHH-GTWTNHAPRRNRKLLLHRKQIDNLIGKIRDGN-LTLVPLSIYFT-D
SSRP_RHOJR      VWLRSLHIPEYTQ-GTWTNHAPRRTRKLLLHKQEIEHLVGKTREGN-QTLVPLSMYFS-D
SSRP_ARTS2      LWMEGIHIPEYNQ-GSWTNHSARRRRKLLLHREELTKISHKIRESG-FTIVPLQLYFL-D
SSRP_RENSM      LWLEAVYIPEYLN-GSWNNHSARRRRKLLLHRAELIKISHKTREAG-FTLVPLQLYFL-D
SSRP_CLAMS      AWLDAVHIPEYNQ-GTWNNHPVRRKRKLLLHKEQILKIHSKVKEGG-YTVVPLQLYFV-D
SSRP_LEIXX      AWLDAVHIPEYAD-GTWNNHAPRRKRKLLLHKAQILKIESKVKQGG-YTIVPLQIYFN-D
SSRP_STRCO      AWLHNVHVPEYSQ-GTWTNHSARRKRKLLLHRVEIDKLESKSQETG-HTIVPLALYFK-D
SSRP_NOCSJ      AWLHGVHIPEYSQ-GTWTNHAARRKRKLLLNRDEIDKIERRVNEKG-LTVVPLALYFK-D
SSRP_KINRD      MWLEGVHIPEYVQ-GTWTNHTPRRKRKLLLHREEIDRWAGKVRESG-LTIVPLALYFL-D
SSRP_BIFLO      MWLEGANIPEYLN-GTWNNHAPKRKRKLLLHRLQITKLARGIEAKG-YTIVPLSLYFK-D
SSRP_CUTAK      VWMYNLHIPEYAF-GTWRNHDVMRKRKLLLNKREIAKLSREADGPG-KTIVPLQLYFK-D
SSRP_TROWT      IWLANLYIPEHKT-GGWTNHNPRRLRKLLLHKYQIARLRKDLLIPG-ITLVPIKFYFR-N
SSRP_SALRD      MKIHGMYIKPYEE-AGPFGHEPRRNRKLLLHDQQIGKWGQMAEQEG-YTIVPLSLYFR-D
SSRP_ANADE      LWLLNCRIGEYKQ-AAHFGHAPLRDRKLLMNRAEIDRVRGKVEQRG-YTLVPLRIYFK-Q
SSRP_ANADF      LFLVNCRIGEYKQ-AAHFGHEPLRDRKLLMNRPELDRVKGKIEQRG-YTLVPLRLYFK-Q
SSRP_MYXXD      LFLLNANIGSYKA-ASFFDHLPTRGRKLLMHRGEIDRWTAKVRERG-YSIIPLVLYFR-N
SSRP_BDEBA      AYLQNAHIAEYKA-SSYNNHVPERHRKLLMHRNELDEIFEALREKG-YSCVPLKIYFK-N
SSRP_SORC5      VFLHGVSIAAMAS-AAFG-HVPKGARKLLLHRREIERIDLSIAREG-MTAVATRLYFKSG
SSRP_PELUB      IVLINSHIAAFKQ-ASYSNHNPTDERKLLLNKKEINKLIGKMQRDG-FTLVPTKMYFKKG
SSRP_LEPIC      VFLENFSIAPYKN-GGYANHPEIRPRKLLLHKKEIEKLERQVKEKG-LVLVATKVYFKNN
SSRP_GLUDA      IWLFNSYIPEY-QGGVLSRFETRAPRKLLLHRKQVDKLLGAVARDG-VTLVPLDIHFNAR
SSRP_GLUOX      IWLFNSYIPEY-QGGVLSRFEPRAPRKLLMHRKQIAHFLGAVSRAG-ASLVPLDIHFNAR
SSRP_GRABC      MFLFNAYIPEY-QGGVLSRFEPRSPRKLLLKRKQINHLLGAVQKQG-QTVVPLQIHFNER
SSRP_ACICJ      MYLFNMYIPEY-QGGVLSRFDTKGPRKLLLKRKQIDQLLGAIARQG-STVVPLDVHFNPR
SSRP_MAGSA      LFLFNAYIPEY-QSKMPFPHETRRPRKLLLHKREMAKLMSAITKDG-MTLVPLDIHFGQR
SSRP_RHORT      LYLYNAYIPDWTQAVKAFAHEPRQPRKLLVHRREARRLISAINKDG-MTLVPLYLYFNDR
SSRP_AGRFC      IWLINSHLPEYLQANR-FNHEPRRRRKLLLNKREINRLRAGINRDG-MTLVPLKVYFNEK
SSRP_SINMW      IWLINSYLPEYLQANR-FNHETRRRRKLLLSRREVNRLQGAVNREG-MSLIPLRIYFNER
SSRP_CHESB      IWLINSHIPEYFAGNR-FNHEPRRRRKLLLSKKEMARLAQAVEREG-MTMVPLKLYFNER
SSRP_RHILO      IWLINSYLPEYLQANR-FNHEPRRRRKLLLNKREMAKLSQSVDREG-MTLVPLKIYFNDQ
SSRP_BARBK      LWLVNAHIPEYTQANR-FNHEPRRLRKLLVSKREIGRFFNAVSREG-MTIVPLKLYFNER
SSRP_BRUA4      FWLINSYIPEYTQGNR-FNHEPRRLRKLLISKREMSRLFNSVSRDG-MTVVPLKLYFNDR
SSRP_RHOPB      IWLINANIPEYLQANR-FNHEPKRPRKLLLHRKQINKLMGAVERQG-MTLVPLKMYFNER
SSRP_AZOC5      LWLFNSYVPEYLEANR-FNHEPRRPRKLLMHKRQIHKLTVAVEREG-MTVVPLKIYFNEQ
SSRP_SPHEL      VWLVNANIPEFSHGNR-FNHEAKRPRKLLLHEREINKLHGAVAREG-MTLVPLSVYFNGK
SSRP_RHIWR      VWLVNSNVPEFSHGNR-FNHEPKRPRKLLLHAREIDKMRNGVSREG-MTLIPLSIYFNGR
SSRP_NOVAD      VWLVNSNVPEFSHGNR-FNHVPKRPRKLLLKERQIAKFTGAVERKG-MTLVPLSIYFNSR
SSRP_SPHAL      VWLINANIPEFSHGNR-FNHEPKRPRKLLLNWREINKLHAGVARQG-MTLVPLSVYFNSR
SSRP_ERYLH      AWLINANIPEYSHGNR-LNHQPRRPRKLLLHNREIERLLGAVERKG-MTLVPLSIYFNSR
SSRP_ZYMMO      VTLINANIPEFSHGNR-FNHEPKRPRKLLLHEREIRKMQTAVSREG-MTVIPVSLYFNNK
SSRP_CAUSK      IKLINADIPPYGHANR-FNHEPRRHRTLLLHRKQIDKLIGAVQRDG-RTLIPLKLYWNEK
SSRP_HYPNA      LWLINAEIQTYGGANR-FNHEPRRKRKLLVSRRELSKLSQEVERAG-RTIVPLKLYFNDK
SSRP_MARMM      LWLINADIPPYGPANR-FNHEPKRHRKLLLKAKEIARLTGASTQQG-RTIVALRLYFNGR
SSRP_DINSH      LWLVNSYIAPYAQAKT-WKHEERRRRKLLVSRRELSRLWNATQRQG-MTLVPLVMYFNHR
SSRP_JANSC      LWLVNSYIAPYVQAKT-FGHEEKRRRKMLVSRKELSKLWNATQREG-MTLVPIVMYFNHK
SSRP_PARDP      LWLINAYIAAYKQAGV-FGHEERRRRKLLVSRKELARLWQAIGREG-MTLVPLVMYFNDR
SSRP_ROSDO      LWLVNSYIAPYKQAKT-FQHEERRRRKLLISRKQLSDFWNATQRKG-MTLVPLVLYFNHR
SSRP_CERS5      LWLINGYIAPYLQAKT-WGHEERRKRKLLVSRRELARLWNATAREG-MTIVPIRMYFNDR
SSRP_PARL1      VMLVNAYIPIYLQANQ-FNHETRRPRKLLLHKREIEKLAAAVQRQG-MTVVPLRMYFTDK
SSRP_RICCK      LFLYNCHIAEYEKANK-FNHATRRPRKLLLHTKEMKKIIGKIKIKG-YTLVALSMYFNKK
SSRP_ORITB      IFLYNSYIGEYKQANR-FNHVPRRVRKLLLHRKEIQKIIGKLSVQG-CTLVALSIYFNSK
SSRP_ANAMM      LWIHNLHISEYNRADR-KNHKPLRVRKLLLRKREIHKIAGNIKVSG-LAVVPLMIFFNNK
SSRP_ANAPZ      LWVHNLHISEYNRSSY-KNHSPLRVRKLLLRRREINKIAGSVKASG-ITVVPRLVYFNER
SSRP_EHRCJ      LWLCNLHISEYNHAST-KNHNPTRPRKLLLRKKQIYKISGNIKNDG-FTVVPLSLYFNEK
SSRP_WOLTR      IWLHNMHIAEYKAANK-KKHKPKRERKLLLHKKEINKLISQIKTAG-VTIVPLSIYFNDK
SSRP_NEOSM      LWLNNMHVPPYKPASR-FNHVPTRSRKLLVHKRQLNKISGAVRTKG-LTLVPLSIYVNEN
SSRP_PHOV8      LWVKNMHIAEYFYGSY-NNHSARRERKLLLNKKELRKLEEAGKNPG-FTIVPVRLFINEK
SSRP_PARD8      LWVKNMYIAEYFYGTY-NNHNARRDRKLLLTKKELRKIEGAVRASG-FTIVPTRLFINEK
SSRP_PORGI      LWVKNMYIAEYFYGTY-NNHVARRDRKLLLNRKELRKLEEASKSMG-TTIVPLKLFINER
SSRP_FLAJ1      LFAINTYIEEYSFGNQ-FNHKSRSERKLLLNKKELKSLHKSVQAKG-LTIVPLKLFTNEK
SSRP_FLAPJ      LFVINSHIEEYLFGHQ-YNHKPKSERKLLLNKRELKGLLKDVQNKG-LTIIPLRLFTNEK
SSRP_GRAFK      LFVINMHVEEYSHATH-FNHNPRSQRKLLLQRRELRKLEKEVTNSG-LTIIPLRLFINDR
SSRP_CYTH3      LWIKNMNISSYDKGSF-YNHDPLSARKLLLRKAELKKLFMHSKEKG-LTIIALRLFTNER
SSRP_CHLL3      VWLENMQITPYEFNHL-DALEPKRSRKLLLHKEEIRRLQSKINEKG-LTLIPLKAFFDKN
SSRP_CHLPM      VWLENMQITPYEFNHL-DSLEPKRSRKLLLHKAEIAKLQSQISEKG-LALIPLKAFFNPK
SSRP_CHLPD      VWLENMQITPYEHNHL-DTLEAKRSRKLLLNREEIRKLETKINEKG-LTLVPLKAFFNNR
SSRP_CHLTE      VWLENMQITPYEHNTL-DTLEPKRSRRLLLHKAEIMRLQSKISEKG-LTLIPLKAYFNKR
SSRP_CHLCH      VWLENMQITPYKHNRM-EVLEAKRSRKLLLHKKEIAKLQAKVSEKG-LTLVPLKAFFTPH
SSRP_DESPS      AMLYNVHISHYMFTSH-NPVEPLRVRKLLLHKRELHKLNGKLKEKG-LALIPLKIYFIEN
SSRP_RHOBA      LWLVGSDIAHYNNAGM-WNHDPRRPRKLLVHAKEFDKFAGRAFERG-LTLIPLRVYFSER
SSRP_ACHLI      VFILNMHIAKFDASSIFN-HEETRTRKLLLNRSEIDKLMGAQTRDG-MTIIPLTVELHEG
SSRP_FUSNN      IFIMGMSVVPWEFGSVYN-PEERRVRKLLLHRKEIKKIHEKVKIKG-YTIVPLDVHLSKG
SSRP_MYCMS      IYILNMNVKKYQFANYIKGLEETRTRKLLLHKKEIIKILNKIKQEN-LTIIPVKLYFKND
SSRP_MESFL      AFLINANIKKYDYANFVKGIDPLRTRKLLLHKKEINKILKRVMLEK-LTIVPLRLYLKGN
SSRP_UREP2      ALILNMHVANFFEGNNFN-QDPYRNRKLLLHKKEIIRLQHLVKTQH-MTIVPTKIYWKNN
SSRP_MALP2      AYILNMNIAPYSHGNIYN-VDPLRTRKLLLHKNEIIKYQMRIKKES-LTMVPSKIYWRKN
SSRP_MYCFP      IFLCNAQFKQYM---LVK-CDETRDRKLLMHKNEIVRLQSKLHKLGHATIIPSKIYFDNR
SSRP_MYCPU      LYLINSYIGLYM---AVK-GDERQSRKLLLHKNQLRRLKQKVESQS-LSIVPLSLYWNKK
SSRP_MESH2      LFLSNAKISEYK---GSR-GQTDRSRKLLMHKHELKKILKEKITRK-LAIIPLFIGQKNR
SSRP_MESM1      AYITNMHISQYM---SVK-GNELEPRKLLLNKHEIRHIQDKKNRNS-LAVIPLNLFWDNN
SSRP_ONYPE      AFIVNMTILKYPFSCCLA-YDENRTKKLLLQKHEIIQIKNKIKTEK-LSVIPLKVYFNKN
SSRP_MYCGE      LFLEQFTIPPYSFAGPLN-HASDRIKKLLLNKHEIKQIINKKQQQS-LSVIPSKVFFRNG
SSRP_MYCPN      VYIKDFSISPYAFSGEFN-HPFKRVKKLLLNRNEIKQITARQKQEG-LSIIPLKVFFKNG
SSRP_MYCGA      AYLLNLLIPKYKFDTSKV-LNETRTRKLLLHKSEILKIDLIKKQHS-LVIIPYQIYFVNN
SSRP_CAMC5      IFLLNAHISHLDTTNSHFRPDERAPRKLLMHRKQIDKLFGSVTKDG-LTMVALALYLNDK
SSRP_CAMFF      LFLLNAHISYLDTTNSYFRPDERAPRKLLMHRRQIDKLFGKVSTDG-LTMVALSLYLNSK
SSRP_CAMHC      LFLLNAHISFLENTNAFFRPSENGARKLLMHKKEINRLFGAVSKEG-MAIVALSLYLNDK
SSRP_CAMJR      IFLLNSHISLLHTTHSFYKHEERGARKLLMHRKQIDKLLGKVSIEG-YTIVALDLYFNTK
SSRP_WOLSU      AFLLNAHISYLETTNPHYKPDERRPRKLLLHRKQIDKLTGSVSTEG-MTLVTLSIYFNER
SSRP_ALIB4      VFLLNAHISHLSTTHSTYRPDERRSRKLLLHSKQIDKMYSKVTKDG-ITLVALKLYFNDK
SSRP_HELAH      AFLFGVHISYLDTIHAYYKPNERRERKLLLHKKQLLKWQIEASKER-LSIVGLKLYFNQR
SSRP_HELHP      AFLFNAHISFLQTTYTHFKPNERRERKLLLHKKEIDKLFGSVSKES-LSIVPLNIYFNQK
SSRP_NITSB      PFVFGMHISYLDSANPHFRPDEKRPRKLLLHKKEIDKLIGKTSEKG-YTIVPLKLYFNKK
SSRP_SULDN      AFLFNAHIGRLETTHHFYAHEERGSRKLLLHKKQIQKMIKAVEKDG-YTVVPLQLYFNDR
SSRP_SULNB      LYLMNAHIAHLETANKYFTPDTRAPRKLLLHKKELEKLYVKVHKDG-LTIVPLMIYFNER
SSRP_BUCAI      MYLCNCLIEPLQMSSNRFSCDPTRKKKLLLHKNEIDFLSLKKKNTG-YTMVSLSLFWK-K
SSRP_BUCAP      MYLYNSIVQPLHTSSNYVSCDSSRKRKLLLHKNEIQYLCNKKNKIG-STLVALSLFWE-K
SSRP_BUCBP      MYLVNSQFDPISKSNLYITYECNRIKKILLRKREITYLYSKLYKSH-LTIIVLSIFFK-K
                       .                 : :*    :                          

SSRP_ALBFT      GKIKCEIALAKGKAEHDKRDTIKDREGKREVERAMKTNHR--------------------
SSRP_POLSJ      GKVKCEIGLAKGKGEHDKRDTIKDREGKREVERAMKSRSR--------------------
SSRP_VEREI      GVVKCEIALARGKAQHDKRNSIKEREGKREVERALKSRSR--------------------
SSRP_METPP      GRVKADIALAKGKDLHDKRETEKKRDWEREKGQLMRHKISSPRKDT--------------
SSRP_NITMU      GRIKLEIGLAKGKKQHDKRESEKQKEWERDKQRLMRPK----------------------
SSRP_METFK      GRIKVQIGLAKGKKQYDKRHSEKEKDWKREQSSLMKKYVKTQAGS---------------
SSRP_AROAE      GRIKATIGLAKGKKQYDKRESEKERDWERDKARLMRVKT---------------------
SSRP_DECAR      GRIKLEIGLAKGKKQHDKRADELDKDSKREAQRAMKERQR--------------------
SSRP_PARXL      GRVKCEIGLAKGKKQHDKRETEKKRDWEREKARLMRSPG---------------------
SSRP_RALSO      GRVKCEIGLAKGKKLYDKRETEKDRDWQREKARLMREKA---------------------
SSRP_POLAQ      GNVKCEIGLARGKKQHDKRAATKEREWEVQKGRIARGDLNA-------------------
SSRP_NEIG1      GKIKMEIGLAKGKKQHDKRQSMKEADWKREKQRLIKHTR---------------------
SSRP_THIDA      GRIKLEIGLAKGKKQHDKRAAEKDREWQREKQRLVRSAQH--------------------
SSRP_CHRVO      GNVKAEVGLAKGKKLHDKRDTEKDREWQREKQRVMKNQRGAA------------------
SSRP_BORA1      GRVKLDFALGRGKKLYDKRDTSREKDWLRERERVMKHDTRRRSD----------------
SSRP_COXBU      NHVKVEIVLAKGKKTHDKRETIKRREWEREKHRVLKSHG---------------------
SSRP_ALKEH      GKAKLSIGLAKGKKKHDKRADQKEQDWQRQKQRLMK-HKV--------------------
SSRP_HALHL      GRAKIEIGVAKGKKKQDKRADKKEQDWQRQRERLLK-HKVS-------------------
SSRP_NITOC      GRVKLEIALAKGKQKYDKRATEKEKEWTRQKERLLKVHKFTRRGLPALAGRGIGILRKFV
SSRP_ALCBS      GFAKCDIALAKGKQKFDKRATEKERDWNRQKQRVLRQR----------------------
SSRP_METCA      GRAKLEIGLARGKKQHDKRAAEKERDWEREKQRVMRRG----------------------
SSRP_ACIAD      HLVKLEIALVKGKQLHDKRATEKDRDWQRDKARIMHK-----------------------
SSRP_SACD2      HMVKCEIAIAKGKQLHDKRQTEKEREWNIQKQRVLYDK----------------------
SSRP_PSEE4      HLIKCEIALGKGKKEFDKRDTVRERDSNRELQRTMRNKGKEE------------------
SSRP_PSESM      HLIKCEIALGKGKKEYDKRHTERERDSDRELQRAVRTKGKDD------------------
SSRP_PSEMY      HLVKCEIALAKGKKDFDKRHVEKERDANREVQRAMRSKGKDD------------------
SSRP_HAHCH      NKVKCEIALVKGKKDFDKRETEKERDWNRQKQRVIRDHVKQ-------------------
SSRP_MARN8      NKVKCEIALVKGKKLFDKRATEKERDWNRQKQRIMREANT--------------------
SSRP_CHRSD      NLVKCELALVRGKKLHDKRATEKARDWNREKARIMRAH----------------------
SSRP_PSYWF      SLVKCKIGLAKGKKLHDKRKTLKDRDWERDKERGFKQHLD--------------------
SSRP_VESOH      GMVKLEIGLAKGKKSYDKRQDNKLRDWQRDKQRTLKQINYRL------------------
SSRP_HYDCU      GKVKISIGLAKGKKLHDKRATQKERDWNRDKQRIMKYHA---------------------
SSRP_HAEDU      AWAKVKIGLAKGKKLHDKREDIKDREWHVTKQRIMKNAGRGS------------------
SSRP_PASMU      AWAKLKIGLAKGKKQHDKREDIKEREWKVTKDRIMKNARLG-------------------
SSRP_ECOLI      AWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR--------------------
SSRP_AERS4      CWVKVEIGLVKGKKEHDKREDTKAREWDREKARIMKNKHRG-------------------
SSRP_VIBVY      SWVKIKIGVAKGKKLHDKRDDIKDRDWQRQKARVMKSSLR--------------------
SSRP_ALIF1      SWAKIKVGVAKGKKLHDKRTDSKEKDWNRDKARIMKSSLR--------------------
SSRP_PHOPR      SWVKLKIGTARGKKLHDKRADSKSRDWARDKQRIMKHSTR--------------------
SSRP_SHESM      AWVKVEIGLGKGKKDHDKREDTKAREWEVEKARVMKKEKTRG------------------
SSRP_SHEFN      AWVKVEIGLGKGKKDHDKREDTKEREWKIEKARVMKKDKENA------------------
SSRP_SHEAM      AWVKVEIGLGKGKKAHDKRDDIKQRDWDIEKARVMKNK----------------------
SSRP_SHELP      AWVKLEIGLGKGKKEHDKRDDTKEREWKIEKSRTMKHAAR--------------------
SSRP_COLP3      CWVKLEFYLGKGKKDHDKRSDIKDREWAVDKGRLMKNKNLDR------------------
SSRP_PSET1      CWVKLEFHLAKGKKLHDKREDGKDKDWSREKERLMKHKA---------------------
SSRP_PSEA6      NWVKVEIYLGKGKHEHDKRDAVKDRDWARDKERMMKHKV---------------------
SSRP_IDILO      PWAKLEIFLAQGKKSHDKRDTIKERDWQRQKARIMKHSVR--------------------
SSRP_PSYIN      AWVKISFALAKGKQEHDKRADVKDREWKVDKERMMKHSVR--------------------
SSRP_LEGPA      NKIKIKIALAKGKKEHDKRDTIKDREWQRDRSRIMKKNT---------------------
SSRP_XANC8      NKVKLEIALAKGKQSHDKRDAAKERDWQRDKQRVMRRHNRDA------------------
SSRP_XYLFT      NRVKMEIALAKGKQAHDKRHAEKEREWQRDKQRIMRAHNRNA------------------
SSRP_FRAP2      PRVKVEIALAQGKKVHDKRQAQKDKDWAREKDRIFKKAHR--------------------
SSRP_BAUCH      SLAKIQLGIAKGKKQYDKRHCIKEREWLLNKARITKLVHR--------------------
SSRP_DICNV      GFVKVDVAIAKGKKEFDKRQVKKDQDWKKTQSRIMKAHKRQL------------------
SSRP_DEIRA      -YFKVELALARGKKLHDKRRADAERTVARELREL--------------------------
SSRP_THET8      GYAKVLLGLARGKKAYEKRREDKKEAVRRALEEL--------------------------
SSRP_AQUAE      -KVKVLIALAKGKKLYDRRRELKEKAMKRELEREFKGKIHL-------------------
SSRP_DESVV      -KVKVDIAVGRGKKLHDQREDLKRRAEDRDTQRELARF----------------------
SSRP_OLEA2      -RVKLEIAVGRGKKLHDKRQDIKQRDVERETRREIMRH----------------------
SSRP_LAWIP      -KVKTEIALAKGRKLYDHRNELKKRAEAMDIKRELAARHL--------------------
SSRP_FERNB      GKVKVEIAIAKGKKSYDKREEIKKKETQKRIKEYLKYNR---------------------
SSRP_THEM4      GLVKVEIAVAKGKKKYDKREDIKKREINRRIREYLKG-----------------------
SSRP_THEP1      GIAKVEIAVARGKKKYDKREAIKKREMERKIREYMKYSR---------------------
SSRP_PSELT      GLAKVEIALVRGKKRYDKREEIKRKEINRKIKTYLKYGE---------------------
SSRP_PETMO      GLIKVKIALAKGLKKYDKREKIAEKEYERRIRKQQKYENI--------------------
SSRP_RUBXD      GLVKLEIAVASRKRQYDKRREIAKKTAQREIERAMKERLRR-------------------
SSRP_SYNFM      GKVKVELALAQGKKLYDKRESIKRKEENRELDRLRKRRRQE-------------------
SSRP_MICAN      SWVKISIGLGRGKKLHDKREDLKRRQDQRDMARAMKR-----------------------
SSRP_SYNY3      SWVKVALGLGKGKKLHDKRETLKRRQDDRDMARAMKR-----------------------
SSRP_SYNE7      GWVKVTLGLGRGKKLHDKRETERRRQDQRDIQRAIKRA----------------------
SSRP_TRIV2      GWVKVSIALGKGKKLHDKRESLKRRQDQRDIQRAMKNY----------------------
SSRP_THEVB      GRVKVSLGLARGKKLHDKRQDLKQRQDKREMERAMKQR----------------------
SSRP_ACAM1      GWIKVTIGLARGKKLHDKRESIKKRQDKRDMERALKRGAE--------------------
SSRP_TRIEI      GWVKVDIALAQGKKLYDKRETIKRRDDKRAMQRAIKQY----------------------
SSRP_SYNSC      SWIKLTIGLGKGRKLHDKRAAEKEKQSKKDVKAAMERY----------------------
SSRP_SYNR3      SWIKLTIGLGKGRKLHDKRQEERRKQDQKDLRSALKRL----------------------
SSRP_PROMA      SWIKITIGLGKGRKLHDKRENEKRKQSEREVKSALARY----------------------
SSRP_PROMT      SWIKLKIGVGKGRKIHDKRDREKINDSKRDVANALKRF----------------------
SSRP_PROM2      SWIKLTIGVGKGKKLHDKRQDEKQKSIKREINSALKR-----------------------
SSRP_PROMP      SWIKLTIGIGKGKKLHDKRQADKQRDIKREIKTALKR-----------------------
SSRP_SYNJA      GWIKAHLGVARGKKLHDKRQAIKERETRREIQRELKGR----------------------
SSRP_GLOVI      SWVKLDLGLARGKKLYDKREDIKKRETKRDIERAMRR-----------------------
SSRP_DESRM      GKVKVQLALAQGKKSYDKRHDIAARDAKRDMDRAMRERQKM-------------------
SSRP_PELTS      GLAKIELALAKGKKIYDRREDIASRDARREIDRAIKERMRLH------------------
SSRP_MOOTA      GLAKVELALVKGKRLYDKREDIAARDAQREIARALRERQKV-------------------
SSRP_CARHZ      NYAKIELGLAKGKKIYDKREEMAKRDAAREIEKALRARY---------------------
SSRP_SYMTH      GKVKVELALAKGKRAYDKRDDIAAREAKREMARALRGRYDD-------------------
SSRP_ROSS1      RRAKVEIGLARGKKLYDKRDDIARREARRDIERALKERTRR-------------------
SSRP_CHLAA      RRAKVELGVARGKKIYDKREDIARRDAARDIDRALKRARHDL------------------
SSRP_SYNWW      GRAKMDLAVAVGKKLYDKREDIASRDAWRDMERSLKERNRA-------------------
SSRP_SYNAS      SRIKVEIGVGRGKKLYDKREDIKLKEDRRAMERGLRSRSREG------------------
SSRP_ALKMQ      GLVKLQLGVGVGKKLHDKRQDMAKKDSQRRIQKELGQRQKGME-----------------
SSRP_ALKOO      GLIKVELGIGVGKKIYDKRQDIAKKDAARRIDKELRQREKQ-------------------
SSRP_LACP7      SLVKMEIGVARGKKLYDKRQDIAKKDQKREAEKDFKVKNL--------------------
SSRP_CALS8      GKIKVELAVAKGKKLFDKREAIAKRDAELEIRKKMKEYLR--------------------
SSRP_CALS4      GLVKVELAVAKGKKLFDKREDIARRDAKRELEKQFKEKQLGI------------------
SSRP_ACET2      GKVKIELGIAKGKKLYDKREDIAKRDALREIDRRLKENFR--------------------
SSRP_DESHY      GLAKIELGVCRGKKNYDKRQDIAERDAKREIERHFRDQGKGY------------------
SSRP_CLOPS      GRVKVNLGVCRGKKNYDKRDTMLEKAHKREMDRQLKERNRY-------------------
SSRP_CLOB8      GKVKVALGVCKGKKNYDKRDSMLEKAHKRDMDRAIKEKNKY-------------------
SSRP_CLOBL      GRVKVSLAVAKGKKNYDKRDAMLEKAAKREMDRQIKERSRY-------------------
SSRP_CLOTE      GRVKVNLAVAKGKKNYDKRQDLIEKAAKRDIERELKDRSRY-------------------
SSRP_CLONN      GRVKVALGVAKGKKNYDKRDAIAAKAAKRDIDRQMKERMRY-------------------
SSRP_CLOK5      GRVKVNLAVAKGKKNYDKRDSMLEKAAKRDIERQMKERFR--------------------
SSRP_CLOAB      RRVKVKLAVAVGKKNYDKRDALKEKDARREIDRAMKN-NR--------------------
SSRP_STAHJ      GQCKVLLGVARGKKIHDKRQALKDKAMKRDVDRAIKDRY---------------------
SSRP_CLOD6      GKVKVEIALAKGKKLYDKRQDMAKKDAQRRIEREMTGKY---------------------
SSRP_GEOTN      GFAKVELGVAKGKKKYDKREDMKRKEAQREIERAFRERQKI-------------------
SSRP_BACCN      GFAKMALGLARGKKQYDKRHDLKEKEAKREIARAFRDRQKM-------------------
SSRP_ENTHA      GYAKVLIGLAKGKKSYDKREDLKRKDVDRQIDRTLKNFSR--------------------
SSRP_LISW6      GYAKVLIGVARGKKKYDKRQDLKQKEAKRDIERAFKERQQ--------------------
SSRP_HALH5      GFAKCLIGLGKGKKTFDKRETLRRRDAKREVERALKEKNR--------------------
SSRP_OCEIH      GFAKVLIGLGKGKKKYDKREDLKQKQMKRDVDRAIKDHMR--------------------
SSRP_STRPG      GFAKVLIGLAKGKHDYDKRETIKRRDQERDIKKQMKHYNAR-------------------
SSRP_STRT1      GFAKVLLGIAKGKHDYDKRESIKRREQERDIKRIIKSVNR--------------------
SSRP_STRMU      GFAKVLIGLAKGKHDYDKRESIKRREQDRDIKRQMKQFNGR-------------------
SSRP_STRS2      GFAKVLIGLAKGKHDYDKRESIKRREQDRDIKRTMKAINSR-------------------
SSRP_LACLA      GFAKVLMGLARGKKDYDKRETLKRKEQNRDIARQIKAYNR--------------------
SSRP_LACJO      GFAKVLIGVGQGKKQYDKRQTIKKRDQDREIHRKYGI-----------------------
SSRP_LACDB      GFAKVLIGVAQGKKEYDKRETIKKRDQDRELRRKYRI-----------------------
SSRP_LEVBA      GFAKVLIGVAQGKREFDKRETIKRREQDRQIARVMKHY----------------------
SSRP_LACPL      GFAKVLIGVAHGKREYDKRQDIKKREQQRQIDRVMKHY----------------------
SSRP_LIMRD      GYAKVLLGLAKGKHQYDKREAIKRREQNREIERVMKHY----------------------
SSRP_LIGS1      GFAKVLIGIAQGKHVYDKRETIKRRDQEREIRRTLKNYG---------------------
SSRP_PEDPA      GFAKVLIGVAKGKHEYDKRESLKKRDQQREIDRALKNR----------------------
SSRP_LACP3      GYAKVLIGVAEGKHNYDKRETLKRKDQEREVQRALKARY---------------------
SSRP_LATSS      GFAKVLIGVGEGKREYDKRETLKRKEQDREMARALRKR----------------------
SSRP_LEUMM      GFAKVLVGIGRGKKKYDKREDIKKRDQERELSRRFKN-----------------------
SSRP_OENOB      GFAKILIAIGTGKKNYDKRQTIKERDLKRELGKNLKNFH---------------------
SSRP_GEOSL      GLAKVELGLAKGKKLYDKREDMKKKDQSREMAQALREKSKSH------------------
SSRP_GEOUR      GLVKVEVGLAKGKKLYDKREDMKKKDMRRDVAVALKERNR--------------------
SSRP_PELPD      GLVKVEIGLAKGKKLYDKREDMKKKDSQRELSQALKSKNRE-------------------
SSRP_SYNC1      GRVKIEIGIARGKKLHDKRQTLKSKEADREMARALRDRH---------------------
SSRP_TREDE      GIVKVLLGVCKGKKTFDKRADIKDRDIKRDMQREIKIRGK--------------------
SSRP_TREPA      GRVKVALGICKGKKLFDKRAQIKARDNARELSRSLCERHH--------------------
SSRP_BORAP      SIIKVEVGICKGKKLYDKREILKQKSIKKDLSREIKYK----------------------
SSRP_DEHM1      DIAKVELSLGRGKKLYDKRDTITKRDTERELEREVKYRNFRR------------------
SSRP_CHLMU      GFVKVRIGCCRGKKSHDKRQALIEREKNRELAAAMKRSYR--------------------
SSRP_CHLPN      GYVKVRLGCCRGKKAYDKRRTIIEREKEREVAAAMKRRHH--------------------
SSRP_PARUW      GRIKVRIAIAKGKKSFDKRADLKERDDKRQMQQALKQQQY--------------------
SSRP_KORVE      GRVKVELAVAKGKQLWDKRETDRRKTADRDAREAIARSRKS-------------------
SSRP_SOLUE      GKIKCEIAVAKGKKLYDKRAADKARTADDEARAEMRRRA---------------------
SSRP_ACIC1      GKAKVELALARGKRAYDKRQALAERHAQREIARALGRRVKGHRM----------------
SSRP_SACEN      GKAKVELALAKGKKAHDKRQDLAKKDAQREIERAMGRARKGKW-----------------
SSRP_FRACC      GRAKIEIALARGRKSYDKRHAIAERDAAREIGRAMGRRAKGRYL----------------
SSRP_THEFY      GRAKVEIALARGKREYDKRHDIAEREAKREMERALRRRR---------------------
SSRP_SALTO      GWAKVEIGVAKGKKSYDKRQDLAKRDAQREIARAAGRRGKGMAD----------------
SSRP_COREF      GRVKLELGLAQGKQDYDKRQDIKRRTEEREVTRELGRRIKGINA----------------
SSRP_CORDI      GRLKVELGLAQGKQDYDKRQDIKRRTEEREVVRDLGRRVKGIHA----------------
SSRP_CORJK      GKLKVELALARGKQEYDKRQDIKRRTEEREITREMGRRIKGIQG----------------
SSRP_MYCUA      GKVKVELALARGKHAHDKRQDLARRDAQREVIRELGRRAKGMG-----------------
SSRP_MYCPA      GKVKVELALARGKKAYDKRQDLAQRDAQREVVRQLGRRTKGMI-----------------
SSRP_MYCS2      GKVKVELALARGKQAHDKRQDLARRDAQREVIRELGRRAKGKI-----------------
SSRP_RHOJR      GKVKVELALAKGKQDYDKRQDLARRTAEREVTRELGRRVKGMR-----------------
SSRP_ARTS2      GKAKVEIGVARGKKEYDKRQTLREQQDKREALRVMRE-RNRG------------------
SSRP_RENSM      GKAKVEIALAKGKRDYDKRQALREAQDTRESLRAMRE-KNLG------------------
SSRP_CLAMS      GRAKVELAIAKGKKEYDKRQTLRERQDKREADRAMSSHRRLGE-----------------
SSRP_LEIXX      GRAKVEIGVAKGKREYDKRQALRERQDNREAQRAMASRKHLGE-----------------
SSRP_STRCO      GRAKVEIALARGKKEYDKRQTLREKQDRREAERTISAIKRKQRA----------------
SSRP_NOCSJ      GRAKVEIALAKGKKSWDKRAALAERQANRETEQAVGRRLKGMHD----------------
SSRP_KINRD      GRVKVEIGLARGKKNYDKRHALRERQDRREADRAMSERKDR-------------------
SSRP_BIFLO      GRVKAEIALARGKKEFDKRQALREEQDKREALRAMRYANMRH------------------
SSRP_CUTAK      GYAKVEIAVGTGKRDWDKRQAIRERDAKREAQRALANRVRNRKR----------------
SSRP_TROWT      GRAKLLIALARGKKLIDKREVIKEREATLEANRALKHRLRRPRAQRNTQRSVTPRRTREN
SSRP_SALRD      GWAKLKIGIAKGRQKHDKRQAIKERE--------MERRLEREQSDYNF------------
SSRP_ANADE      GWAKVELGLARGRSHEDRRGAIAERESKREMDRALARGRRR-------------------
SSRP_ANADF      GWAKVELGLAKGRSHEDRRHAIAERETKREMDREISRRRR--------------------
SSRP_MYXXD      GRAKVELGLCRGKTHEDRRHDIKERETKREMDRAMRRR----------------------
SSRP_BDEBA      GRAKLQIALVKGKKTHDKREAIKKRDVSDQIRSSLRRSR---------------------
SSRP_SORC5      L-AKVEIALARGKKSHDKRETIKEQDAEREMRAVVVHGQRGYGRA---------------
SSRP_PELUB      K-AKIEIAVAKGKKQFDKRATKKNRDWNREKARHIRKSS---------------------
SSRP_LEPIC      LRVKVEIAVGKPKKLHDKRDDLQKKDAQQEIARALKSSNRYQ------------------
SSRP_GLUDA      GVAKVTLGIGEGRKKADKRQAIADRDWQRDKARLLRNKGRE-------------------
SSRP_GLUOX      GMAKVTLGLGQGRRKEDKRHAIAERDWKRDKARLVRSSGKDY------------------
SSRP_GRABC      GMAKVLLGVAEGRNKADKRAAIASRDWQRDKARLMREKG---------------------
SSRP_ACICJ      GLAKVTLGIAEGRKQHDKRQAIAKRDWERDKARILKNR----------------------
SSRP_MAGSA      GIAKIQLGLAKGKKLHDKREAIKERDWNRDKARLMRDKG---------------------
SSRP_RHORT      GFAKVQLGLAKGRKAHDKRQAIKEREWNRDKARVLRDKG---------------------
SSRP_AGRFC      GRAKLELALAKGKKLHDKRETEKERDWNRQKSRLLKGNSQ--------------------
SSRP_SINMW      GRAKLELALGKGKKLHDKRETSKERDWNRQKNRLLKERG---------------------
SSRP_CHESB      GIAKLLLAIARGKKLHDKRETLKQRDWSREQARLLKERG---------------------
SSRP_RHILO      GRAKLLLAVGRGKKLHDKRETEKQRDWSREKGRLLKERG---------------------
SSRP_BARBK      GCVKLEIALARGKKIHDKRETEKKRDWGREKARLLRRYG---------------------
SSRP_BRUA4      GRAKLELALARGKKTHDKRETEKKRDWNREKARLMRDKG---------------------
SSRP_RHOPB      GRVKLQLALAKGKQLHDKRDTEKKRDWSREKGRIMRARG---------------------
SSRP_AZOC5      GRAKVEVALAKGRKAHDKREAVKERDWNRDKARLMRDRG---------------------
SSRP_SPHEL      GRAKVELALAKGKKTHDKRETIKERDWKREQSRILRDRG---------------------
SSRP_RHIWR      GRAKVELALAKGKKLHDKRDTEKERDWKREQQRLLRDRG---------------------
SSRP_NOVAD      GRAKVELALAKGKNAADKRTTIKERDWKREKARIMKDHG---------------------
SSRP_SPHAL      GRAKVELALAKGKKAHDKRESIKERDWKRDKQRLLKDRG---------------------
SSRP_ERYLH      GRAKVELALAKGRQAQDKREYIKDRDWKRDKARIMRDKG---------------------
SSRP_ZYMMO      GKAKLELAIARGKKTHDKRATIKERDWKRDQARLLRDKG---------------------
SSRP_CAUSK      GLAKLEIGLAKGKKNHDKRETEAARDWQRDKARLMKGDRGD-------------------
SSRP_HYPNA      GRAKLLIGVATGRKAHDKREHEAKRDWARDKARIMKAG----------------------
SSRP_MARMM      GLAKLQIGLATGKKTVDKRQTIKDREWNKQKSRLMKNYG---------------------
SSRP_DINSH      GLVKLKIGVAKGKKLADKRQTDAKRDWNRQKQRLLKQNL---------------------
SSRP_JANSC      GLVKLKIGIAKGKKAQDKRETSAKRDWNRQKARLLKQNG---------------------
SSRP_PARDP      GKVKLKIGVAKGKKVADKRETAAKRDWNRQKQRLLKQG----------------------
SSRP_ROSDO      GMAKIKIGVAKGKKLHDKRETAAKRDWSRQKSRLMKDHG---------------------
SSRP_CERS5      GIVKLKIGIAKGKKLSDKRATEAKRDWGREKQRLLKQHS---------------------
SSRP_PARL1      GRVKVEIGLAQGKKLADKRETLKERSWERDKARLMREKG---------------------
SSRP_RICCK      NKVKVELGLAKGKKLYDKRESIKEKDWQRDQSRLIRQK----------------------
SSRP_ORITB      NKVKVELGLAKGKKQYDKRYAIKEQEWKKQQARIMRNKF---------------------
SSRP_ANAMM      GIAKIKIAIVKGKKLYDKREAIKTRDWQREKSRISRREV---------------------
SSRP_ANAPZ      GLAKVRIALVKGKKLYDKREAIKAREWEREKGRTMKRDI---------------------
SSRP_EHRCJ      GLAKAKIVIVKGKKLHDKRETIKTRDWNREKSRVLRGN----------------------
SSRP_WOLTR      GLVKTRIAIVKGKKLYDKRATIKQREWNRAKSRLSKNNL---------------------
SSRP_NEOSM      GLIKVKFALAKGKKKHDKRQDIKDRDWARKQARQDFS-----------------------
SSRP_PHOV8      GLAKLVVALAKGKKQYDKRESLKEKDDRREMDRMFKR-----------------------
SSRP_PARD8      GLAKVVVAIARGKKEYDKRDSIRERDDRREMDRAFKR-----------------------
SSRP_PORGI      GLAKLQIGLARGKKQYDKRASIKERDDRREMDRALKR-----------------------
SSRP_FLAJ1      GLAKLQIGLCKGKKNYDKRESLKEQDTKRDLDRIKKAYN---------------------
SSRP_FLAPJ      GMAKLDIALCKGKKTFDKRETIKDRDNKRDLDRIKKEF----------------------
SSRP_GRAFK      GLAKLQISLAKGKKLYDKRETIKDRESKRRLDRIQKEYK---------------------
SSRP_CYTH3      GYAKIEIALAKGKKLYDKRESIKSKDNEREMQRIRI------------------------
SSRP_CHLL3      GRLKVELALAKGKKLYDKRETIKGRENERHLQQLRKQY----------------------
SSRP_CHLPM      GVLKLELAVAKGKKLFDKRETIKNRDNERQLQQIKKQY----------------------
SSRP_CHLPD      GILKIEIALAKGKKLYDKRETIKSRDAERQLQQLKKTY----------------------
SSRP_CHLTE      GVLKIELGLARGKKLYDKRETIKNRDAKRQLQQLRKQY----------------------
SSRP_CHLCH      GLLKIELAIARGKKLYDKRETLKNRENQRHLDQLRKQYS---------------------
SSRP_DESPS      GKAKIELGLAKGKKMYDKRATLKEQQGKRELARVMRRG----------------------
SSRP_RHOBA      GLAKCVMGLVKGKKLHDKRETIKKRESDRGLQRAMRRK----------------------
SSRP_ACHLI      -LIKVVIALAKGKKLFDKRETIKERDIKREQQQSLKGKMR--------------------
SSRP_FUSNN      -YVKMQIAIAKGKKTYDKRESIAKKDQERNLKREFKNNNR--------------------
SSRP_MYCMS      -YVKLEIALAKGKKLHDKRQTIKKRDTERKELKNYK------------------------
SSRP_MESFL      -YAKLEIGLGRGKKIHDKRETIKKRDIERKEMRKYKY-----------------------
SSRP_UREP2      -KLKIEIALGKGKQLHDKREDIKKRDLAR-ETRLF-------------------------
SSRP_MALP2      -KLKVEIALAKGKKQFDKRQTIKDRDNSR-EARKHIRV----------------------
SSRP_MYCFP      SRIKIEIALVQGMKKTDKREEIKKRDNERYIKKVLKNVY---------------------
SSRP_MYCPU      SKVKAEIALVRGLKKHDKREKLKKEETNKKLKKLISY-----------------------
SSRP_MESH2      -KIKLEIALAKGKTKLDKRNLIKERDQKREAAKFLKNYY---------------------
SSRP_MESM1      -YIKLEIALAKGKTKADKRHRILEKDVRKHLKKITY------------------------
SSRP_ONYPE      -LVKLEIALSKGKKQHDKRNALKDFDAKLRIQKTLKNFNQKQ------------------
SSRP_MYCGE      -KIKVEIWLAKPKKKFDKRETIKKKTIRRELEAEYR------------------------
SSRP_MYCPN      -KIKMEIWLAKPKKKFDKREAIKSKTIQRELRQQYGSP----------------------
SSRP_MYCGA      -KIKVSIYLARPKKRYDKRQTIKEREINKKIRKY--------------------------
SSRP_CAMC5      NIIKARVALAKGKNLHDKRETLKKREADMEARAAMKKFI---------------------
SSRP_CAMFF      NIVKANIALAKGKNLHDKREALKQKEANIEARSALKKYI---------------------
SSRP_CAMHC      NKVKARIALAKGKNLHDKREALKRKEAEREAQSAMKRYAKGY------------------
SSRP_CAMJR      NKVKATLALAKGKNLHDKRETLKKKQADLEAKAAMKNYK---------------------
SSRP_WOLSU      NRAKAEIALAKGKNLHDKRETLKKRILDREVKAALKEH----------------------
SSRP_ALIB4      NMIKIEVATAQGKKLHDKREDLKAKTMKRETEQVLKSFK---------------------
SSRP_HELAH      NRAKIQIALVKGKKLHDKRQNLKEKALNKEILADLKHHFKG-------------------
SSRP_HELHP      NKIKLCIALVRGKKLHDKRESIKKKMLEREARAHMKSYGKKL------------------
SSRP_NITSB      NIAKLEIGLAKGKTLHDKRESLKKKIMDREARAAMKEYR---------------------
SSRP_SULDN      NIVKIQIAIAKGKQLHDKRNDLKEKDMKRDMERSMKDY----------------------
SSRP_SULNB      NYAKVSIAIAKGKKLHDKRADMKAKTLDREAKTAMKNRSY--------------------
SSRP_BUCAI      SWCKLEFGLAKGKTAQDKRINLKKREWEQEKLKILKKTKETY------------------
SSRP_BUCAP      SWCKLNFGLAKGKTKIDKRASEKQNEWKKEKLKILKKVKFQN------------------
SSRP_BUCBP      QWCKVKIGIAKGKTIKDKREHKKLSEWKKTQNRFVKRIRH--------------------
                   *  .         ::*                                         

SSRP_ALBFT      -------------------
SSRP_POLSJ      -------------------
SSRP_VEREI      -------------------
SSRP_METPP      -------------------
SSRP_NITMU      -------------------
SSRP_METFK      -------------------
SSRP_AROAE      -------------------
SSRP_DECAR      -------------------
SSRP_PARXL      -------------------
SSRP_RALSO      -------------------
SSRP_POLAQ      -------------------
SSRP_NEIG1      -------------------
SSRP_THIDA      -------------------
SSRP_CHRVO      -------------------
SSRP_BORA1      -------------------
SSRP_COXBU      -------------------
SSRP_ALKEH      -------------------
SSRP_HALHL      -------------------
SSRP_NITOC      VFRQKSM------------
SSRP_ALCBS      -------------------
SSRP_METCA      -------------------
SSRP_ACIAD      -------------------
SSRP_SACD2      -------------------
SSRP_PSEE4      -------------------
SSRP_PSESM      -------------------
SSRP_PSEMY      -------------------
SSRP_HAHCH      -------------------
SSRP_MARN8      -------------------
SSRP_CHRSD      -------------------
SSRP_PSYWF      -------------------
SSRP_VESOH      -------------------
SSRP_HYDCU      -------------------
SSRP_HAEDU      -------------------
SSRP_PASMU      -------------------
SSRP_ECOLI      -------------------
SSRP_AERS4      -------------------
SSRP_VIBVY      -------------------
SSRP_ALIF1      -------------------
SSRP_PHOPR      -------------------
SSRP_SHESM      -------------------
SSRP_SHEFN      -------------------
SSRP_SHEAM      -------------------
SSRP_SHELP      -------------------
SSRP_COLP3      -------------------
SSRP_PSET1      -------------------
SSRP_PSEA6      -------------------
SSRP_IDILO      -------------------
SSRP_PSYIN      -------------------
SSRP_LEGPA      -------------------
SSRP_XANC8      -------------------
SSRP_XYLFT      -------------------
SSRP_FRAP2      -------------------
SSRP_BAUCH      -------------------
SSRP_DICNV      -------------------
SSRP_DEIRA      -------------------
SSRP_THET8      -------------------
SSRP_AQUAE      -------------------
SSRP_DESVV      -------------------
SSRP_OLEA2      -------------------
SSRP_LAWIP      -------------------
SSRP_FERNB      -------------------
SSRP_THEM4      -------------------
SSRP_THEP1      -------------------
SSRP_PSELT      -------------------
SSRP_PETMO      -------------------
SSRP_RUBXD      -------------------
SSRP_SYNFM      -------------------
SSRP_MICAN      -------------------
SSRP_SYNY3      -------------------
SSRP_SYNE7      -------------------
SSRP_TRIV2      -------------------
SSRP_THEVB      -------------------
SSRP_ACAM1      -------------------
SSRP_TRIEI      -------------------
SSRP_SYNSC      -------------------
SSRP_SYNR3      -------------------
SSRP_PROMA      -------------------
SSRP_PROMT      -------------------
SSRP_PROM2      -------------------
SSRP_PROMP      -------------------
SSRP_SYNJA      -------------------
SSRP_GLOVI      -------------------
SSRP_DESRM      -------------------
SSRP_PELTS      -------------------
SSRP_MOOTA      -------------------
SSRP_CARHZ      -------------------
SSRP_SYMTH      -------------------
SSRP_ROSS1      -------------------
SSRP_CHLAA      -------------------
SSRP_SYNWW      -------------------
SSRP_SYNAS      -------------------
SSRP_ALKMQ      -------------------
SSRP_ALKOO      -------------------
SSRP_LACP7      -------------------
SSRP_CALS8      -------------------
SSRP_CALS4      -------------------
SSRP_ACET2      -------------------
SSRP_DESHY      -------------------
SSRP_CLOPS      -------------------
SSRP_CLOB8      -------------------
SSRP_CLOBL      -------------------
SSRP_CLOTE      -------------------
SSRP_CLONN      -------------------
SSRP_CLOK5      -------------------
SSRP_CLOAB      -------------------
SSRP_STAHJ      -------------------
SSRP_CLOD6      -------------------
SSRP_GEOTN      -------------------
SSRP_BACCN      -------------------
SSRP_ENTHA      -------------------
SSRP_LISW6      -------------------
SSRP_HALH5      -------------------
SSRP_OCEIH      -------------------
SSRP_STRPG      -------------------
SSRP_STRT1      -------------------
SSRP_STRMU      -------------------
SSRP_STRS2      -------------------
SSRP_LACLA      -------------------
SSRP_LACJO      -------------------
SSRP_LACDB      -------------------
SSRP_LEVBA      -------------------
SSRP_LACPL      -------------------
SSRP_LIMRD      -------------------
SSRP_LIGS1      -------------------
SSRP_PEDPA      -------------------
SSRP_LACP3      -------------------
SSRP_LATSS      -------------------
SSRP_LEUMM      -------------------
SSRP_OENOB      -------------------
SSRP_GEOSL      -------------------
SSRP_GEOUR      -------------------
SSRP_PELPD      -------------------
SSRP_SYNC1      -------------------
SSRP_TREDE      -------------------
SSRP_TREPA      -------------------
SSRP_BORAP      -------------------
SSRP_DEHM1      -------------------
SSRP_CHLMU      -------------------
SSRP_CHLPN      -------------------
SSRP_PARUW      -------------------
SSRP_KORVE      -------------------
SSRP_SOLUE      -------------------
SSRP_ACIC1      -------------------
SSRP_SACEN      -------------------
SSRP_FRACC      -------------------
SSRP_THEFY      -------------------
SSRP_SALTO      -------------------
SSRP_COREF      -------------------
SSRP_CORDI      -------------------
SSRP_CORJK      -------------------
SSRP_MYCUA      -------------------
SSRP_MYCPA      -------------------
SSRP_MYCS2      -------------------
SSRP_RHOJR      -------------------
SSRP_ARTS2      -------------------
SSRP_RENSM      -------------------
SSRP_CLAMS      -------------------
SSRP_LEIXX      -------------------
SSRP_STRCO      -------------------
SSRP_NOCSJ      -------------------
SSRP_KINRD      -------------------
SSRP_BIFLO      -------------------
SSRP_CUTAK      -------------------
SSRP_TROWT      KNVRGSKARSARRNVRREN
SSRP_SALRD      -------------------
SSRP_ANADE      -------------------
SSRP_ANADF      -------------------
SSRP_MYXXD      -------------------
SSRP_BDEBA      -------------------
SSRP_SORC5      -------------------
SSRP_PELUB      -------------------
SSRP_LEPIC      -------------------
SSRP_GLUDA      -------------------
SSRP_GLUOX      -------------------
SSRP_GRABC      -------------------
SSRP_ACICJ      -------------------
SSRP_MAGSA      -------------------
SSRP_RHORT      -------------------
SSRP_AGRFC      -------------------
SSRP_SINMW      -------------------
SSRP_CHESB      -------------------
SSRP_RHILO      -------------------
SSRP_BARBK      -------------------
SSRP_BRUA4      -------------------
SSRP_RHOPB      -------------------
SSRP_AZOC5      -------------------
SSRP_SPHEL      -------------------
SSRP_RHIWR      -------------------
SSRP_NOVAD      -------------------
SSRP_SPHAL      -------------------
SSRP_ERYLH      -------------------
SSRP_ZYMMO      -------------------
SSRP_CAUSK      -------------------
SSRP_HYPNA      -------------------
SSRP_MARMM      -------------------
SSRP_DINSH      -------------------
SSRP_JANSC      -------------------
SSRP_PARDP      -------------------
SSRP_ROSDO      -------------------
SSRP_CERS5      -------------------
SSRP_PARL1      -------------------
SSRP_RICCK      -------------------
SSRP_ORITB      -------------------
SSRP_ANAMM      -------------------
SSRP_ANAPZ      -------------------
SSRP_EHRCJ      -------------------
SSRP_WOLTR      -------------------
SSRP_NEOSM      -------------------
SSRP_PHOV8      -------------------
SSRP_PARD8      -------------------
SSRP_PORGI      -------------------
SSRP_FLAJ1      -------------------
SSRP_FLAPJ      -------------------
SSRP_GRAFK      -------------------
SSRP_CYTH3      -------------------
SSRP_CHLL3      -------------------
SSRP_CHLPM      -------------------
SSRP_CHLPD      -------------------
SSRP_CHLTE      -------------------
SSRP_CHLCH      -------------------
SSRP_DESPS      -------------------
SSRP_RHOBA      -------------------
SSRP_ACHLI      -------------------
SSRP_FUSNN      -------------------
SSRP_MYCMS      -------------------
SSRP_MESFL      -------------------
SSRP_UREP2      -------------------
SSRP_MALP2      -------------------
SSRP_MYCFP      -------------------
SSRP_MYCPU      -------------------
SSRP_MESH2      -------------------
SSRP_MESM1      -------------------
SSRP_ONYPE      -------------------
SSRP_MYCGE      -------------------
SSRP_MYCPN      -------------------
SSRP_MYCGA      -------------------
SSRP_CAMC5      -------------------
SSRP_CAMFF      -------------------
SSRP_CAMHC      -------------------
SSRP_CAMJR      -------------------
SSRP_WOLSU      -------------------
SSRP_ALIB4      -------------------
SSRP_HELAH      -------------------
SSRP_HELHP      -------------------
SSRP_NITSB      -------------------
SSRP_SULDN      -------------------
SSRP_SULNB      -------------------
SSRP_BUCAI      -------------------
SSRP_BUCAP      -------------------
SSRP_BUCBP      -------------------