CLUSTAL format seed alignment for MF_00025

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPO5_SULIA            ------------------------------------------------------------
RPO5_SACS2            ------------------------------------------------------------
RPO5_SULTO            ------------------------------------------------------------
RPO5_SULAC            ------------------------------------------------------------
RPO5_METS5            ------------------------------------------------------------
RPO5_HYPBU            ------------------------------------------------------------
A8AA82_IGNH4          ------------------------------------------------------------
RPO5_ARCFU            ------------------------------------------------------------
RPO5_STAMF            ------------------------------------------------------------
RPO5_THEPD            ------------------------------------------------------------
RPO5_THEON            ------------------------------------------------------------
RPO5_THECE            ------------------------------------------------------------
RPO5_THEKO            ------------------------------------------------------------
RPO5_THEGJ            ------------------------------------------------------------
RPO5_PYRAB            ------------------------------------------------------------
RPO5_PYRHO            ------------------------------------------------------------
RPO5_PYRFU            ------------------------------------------------------------
RPO5_THESM            ------------------------------------------------------------
RPO5_NITMS            ------------------------------------------------------------
RPO5_AERPE            ------------------------------------------------------------
RPO5_THEAC            ------------------------------------------------------------
RPO5_THEVO            ------------------------------------------------------------
Q6L2F7_PICTO          ------------------------------------------------------------
RPO5_METKA            ------------------------------------------------------------
RPO5_HALS3            ------------------------------------------------------------
RPO5_HALSA            ------------------------------------------------------------
A0A1U7ETD2_NATPD      ------------------------------------------------------------
Q5UZR1_HALMA          ------------------------------------------------------------
Q18EX3_HALWD          ------------------------------------------------------------
D4GZX3_HALVD          ------------------------------------------------------------
RPO5_METTH            ------------------------------------------------------------
RPO5_METST            ------------------------------------------------------------
RPO5_METTP            ------------------------------------------------------------
D2ZPW6_METSM          ------------------------------------------------------------
B9AEP9_METSM          ------------------------------------------------------------
RPO5_MIMIV            ---------------------------------MEPNKSILQIMKSNSDKVKIILGNIIT
RPO5_METJA            ------------------------------------------------------------
RPO5_META3            ------------------------------------------------------------
RPO5_METM6            ------------------------------------------------------------
RPO5_METM7            ------------------------------------------------------------
RPO5_METM5            ------------------------------------------------------------
RPO5_METMP            ------------------------------------------------------------
RPO5_METVS            ------------------------------------------------------------
RPO5_METAC            ------------------------------------------------------------
RPO5_METMA            ------------------------------------------------------------
RPO5_METBF            ------------------------------------------------------------
RPO5_METBU            ------------------------------------------------------------
RPO5_METLZ            ------------------------------------------------------------
RPAB1_RAT             --MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPR----
RPAB1_MOUSE           --MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPR----
RPAB1_HUMAN           --MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPR----
RPAB1_PONAB           --MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFRAQFGDKPSEGRPR----
RPAB1_BOVIN           --MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDGLDQTLEEFKAQFGGKPSEGRPR----
RPAB1_CAEBR           -MADDELETYRLWRIRKTVLQMVHDRGYLVAQEELDQPLETFKETFGDRPSEKKPA----
RPAB1_CAEEL           -MADDELETYRLWRIRKTVLQMVHDRGYLVAQDELDQPLETFKVQYGDRPSEKKPA----
RPAB1_DICDI           -----MEDINRLLQIRKTVLQMLSDREYIITAYEQEYPRESFVS----------------
D2UZT4_NAEGR          -MNNANSESYRLWRIRKTVLQMLDARGYMVLESEKNMDLAEFESKFGTGPNNVSQSGQAR
RPAB1_CANGA           MDQENDRSISRLWRTFRTVKEMVRDRGYFIAQEELDLTLEDFKVKYCDSMGRAQ------
RPAB1_YEAST           MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQ------
RPAB1_KLULA           MDQEQERNISRLWRAFKTVKEMVRDRGYFITQEEIDLSLEDFKAKYCDSMGKPQ------
RPAB1_KLUMA           MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQ------
RPAB1_ASHGO           MDQDNERNVSRLWRAFRTVKEMVRDRGYFITQEEVDLSLEDFKAKYCDSMGRPQ------
RPAB1_DEBHA           -MEDTDRTISRLWRSFKTVKEMVRDRGYYITQEEIDMSLAEFRSRICDSMNVPQ------
RPAB1_YARLI           MSSDD---AQKLWKVYRTAKELVKDRGYTITDKEVNLSFDQFVSEMCDPMGKPI------
RPAB1_SCHPO           -MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLD------
RPB5_ASFM2            -------------------------------------MAMQKLFTYIYEFIEYRKMVLLE
RPB5_ASFK5            -------------------------------------MAMQKLFTYIYEFIEYRKMVLLE
RPB5_ASFB7            -------------------------------------MAMQKLFTYIYEFIEYRKMVLLE
RPB5_ASFWA            -------------------------------------MAMQKLFTYIYEFIEYRKMVLLE
RPB5_ASFP4            -------------------------------------MAMQKLFTYIYEFIKYRKMVLLE
RPO5_PYRAE            ------------------------------------------------------------
                                                                                  

RPO5_SULIA            ------------------------------------------------------------
RPO5_SACS2            ------------------------------------------------------------
RPO5_SULTO            ------------------------------------------------------------
RPO5_SULAC            ------------------------------------------------------------
RPO5_METS5            ------------------------------------------------------------
RPO5_HYPBU            ------------------------------------------------------------
A8AA82_IGNH4          ------------------------------------------------------------
RPO5_ARCFU            ------------------------------------------------------------
RPO5_STAMF            ------------------------------------------------------------
RPO5_THEPD            ------------------------------------------------------------
RPO5_THEON            ------------------------------------------------------------
RPO5_THECE            ------------------------------------------------------------
RPO5_THEKO            ------------------------------------------------------------
RPO5_THEGJ            ------------------------------------------------------------
RPO5_PYRAB            ------------------------------------------------------------
RPO5_PYRHO            ------------------------------------------------------------
RPO5_PYRFU            ------------------------------------------------------------
RPO5_THESM            ------------------------------------------------------------
RPO5_NITMS            ------------------------------------------------------------
RPO5_AERPE            ------------------------------------------------------------
RPO5_THEAC            ------------------------------------------------------------
RPO5_THEVO            ------------------------------------------------------------
Q6L2F7_PICTO          ------------------------------------------------------------
RPO5_METKA            ------------------------------------------------------------
RPO5_HALS3            ------------------------------------------------------------
RPO5_HALSA            ------------------------------------------------------------
A0A1U7ETD2_NATPD      ------------------------------------------------------------
Q5UZR1_HALMA          ------------------------------------------------------------
Q18EX3_HALWD          ------------------------------------------------------------
D4GZX3_HALVD          ------------------------------------------------------------
RPO5_METTH            ------------------------------------------------------------
RPO5_METST            ------------------------------------------------------------
RPO5_METTP            ------------------------------------------------------------
D2ZPW6_METSM          ------------------------------------------------------------
B9AEP9_METSM          ------------------------------------------------------------
RPO5_MIMIV            MLGNRIYIDNNGDSKPLLDPTNAFKNMEERGDNVFIIKADNGDLYAVKVIFQKITAISKQ
RPO5_METJA            ------------------------------------------------------------
RPO5_META3            ------------------------------------------------------------
RPO5_METM6            ------------------------------------------------------------
RPO5_METM7            ------------------------------------------------------------
RPO5_METM5            ------------------------------------------------------------
RPO5_METMP            ------------------------------------------------------------
RPO5_METVS            ------------------------------------------------------------
RPO5_METAC            ------------------------------------------------------------
RPO5_METMA            ------------------------------------------------------------
RPO5_METBF            ------------------------------------------------------------
RPO5_METBU            ------------------------------------------------------------
RPO5_METLZ            ------------------------------------------------------------
RPAB1_RAT             ------RTDLTVLVAHNDDPTD------QMFVFFPEEPKVGIKTIKVYCQRMQEENITRA
RPAB1_MOUSE           ------RTDLTVLVAHNDDPTD------QMFVFFPEEPKVGIKTIKVYCQRMQEENITRA
RPAB1_HUMAN           ------RTDLTVLVAHNDDPTD------QMFVFFPEEPKVGIKTIKVYCQRMQEENITRA
RPAB1_PONAB           ------RTDLTVLVAHNDDPTD------QMFVFFPEEPKVGIKTIKVYCQRMQEENITRA
RPAB1_BOVIN           ------RTDLTVLVAHNDDPTD------QMFVFFPEEPKVGIKTIKVYCQRMQEENITRA
RPAB1_CAEBR           ------RSDLTILVAHNDDPAD------QMFVFFPEDTKIGIKTIKAICQQMQEQNISRA
RPAB1_CAEEL           ------RSDLTILVAHNDDPAD------QMFVFFPEDAKIGIKTIKAICQQMQEQNISRA
RPAB1_DICDI           ------RENLTMYCVKKDDPTD------SIYVFFPDTPKVGVTQIKKYVDIMKDRQANRA
D2UZT4_NAEGR          GYTTIGRDRLSIVTSMADDPSE------MIFVFFPATKAIGMKQIKDYHSKMKDNNVKRA
RPAB1_CANGA           ------RKMMSFQANPTEESMTKFPDMGTLWVEFCDEPSVGVKTMKTFVIHIQEKQFQTG
RPAB1_YEAST           ------RKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTG
RPAB1_KLULA           ------RKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTG
RPAB1_KLUMA           ------RKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTG
RPAB1_ASHGO           ------RKMMSFQSNPTEETLKKSPNMGSVWVEFCDEPSVGIKTMKNFVIHIGEKNFQTG
RPAB1_DEBHA           ------RKLMCFQANPTAESLEKFPDLGSLWVEFCDEASVGIKTMRNFCIHISEKNFSTG
RPAB1_YARLI           ------KKKMCFMASPSPEAIEKFPEMGNIWVEFCEEASVTVKTMRNFCIHISENKFATG
RPAB1_SCHPO           ------RTTLSFYAKPSNDSNK-----GTIYIEFAKEPSVGIKEMRTFVHTLGDHNHKTG
RPB5_ASFM2            EKVPYDKFVQMVFNTGFFRINAETLNHGIVSVFIFGANGKYVHHGGDMRTLLTNTLNEKK
RPB5_ASFK5            EKVPYDKFVQMIFNTGFFRINAETLNHGIVSVFIFGANGKYVHHGGDMRTLLTNALNEKK
RPB5_ASFB7            EKVPYDKFVQMVLNTGFFRINAETLNHGIVSVFIFGANGKYVHHGGDMRTLLTNTLNEKK
RPB5_ASFWA            EKVPYDKFVQMVLNTGFFRINAETLNHGIVSVFIFGANGKYVHHGGDMRTLLTNTLNEKK
RPB5_ASFP4            EKVPYDKFVQMVLNTGFFRINAETLNHGIVSVFIFGANGKYVHHGGDMRTLLTNTLNEKK
RPO5_PYRAE            ------------------------------------------------------------
                                                                                  

RPO5_SULIA            ---------------------------------MRGSSNR---KIDPRIHYLVPKHEVLS
RPO5_SACS2            ---------------------------------MRGSSNK---KIDPRIHYLVPKHEVLN
RPO5_SULTO            ---------------------------------MRSSSKI---KIDPSQHELVPKHEVLS
RPO5_SULAC            ---------------------------------MRSSSKK---KIDISNHELVPKHEILQ
RPO5_METS5            ---------------------------------MRSSSK----KIDPSVHVLVPKHEVLS
RPO5_HYPBU            ----------------------------------MARQKK---KFNILEHELVPKHEVVP
A8AA82_IGNH4          -----------------------------------------------MDHVLVPQHVKLS
RPO5_ARCFU            ---------------------------------------M---KFKLQDHMLVPKHEVLS
RPO5_STAMF            ------------------------------------MSRK---KPNILEHELVPKHEVLS
RPO5_THEPD            ------------------------------------MPRK---F-DVLEHELVPKHVLLS
RPO5_THEON            -----------------------------------MAAKK---EFDIFTHELVPEHRILS
RPO5_THECE            -----------------------------------MATKK---EFDIFAHELVPEHRILS
RPO5_THEKO            -----------------------------------MAAKK---EFNIFDHVLVPEHRILS
RPO5_THEGJ            -----------------------------------MAGKK---EFSVFMHELVPEHRVIS
RPO5_PYRAB            -----------------------------------MAGKS---EFNIFKHVLVPEHRILS
RPO5_PYRHO            -----------------------------------MSGKN---EFNIFKHVLVPEHRILS
RPO5_PYRFU            -----------------------------------MAGKK---EFSIFDHVLVPEHRVLS
RPO5_THESM            -----------------------------------MTAKK---SLTIFDHVLVPEHRVLS
RPO5_NITMS            -----------------------------------MATKKN--QILVPDHIYVPKHEIIS
RPO5_AERPE            -----------------------------------MSSKTRKSSRVILEHEYVPEHRLLS
RPO5_THEAC            -----------------------------------------MAKFNVLDHNLVPEHHIVP
RPO5_THEVO            -----------------------------------------MAKFNVLDHNLVPEHHIVS
Q6L2F7_PICTO          -----------------------------------------MSKFNVLEHEIVPEHHLVP
RPO5_METKA            -------------------------------------MAERLDPDVVLNHVLVPKHEVID
RPO5_HALS3            -------------------------------------------MVDVSQHELVPEHTVLD
RPO5_HALSA            -------------------------------------------MVDVSQHELVPEHTVLD
A0A1U7ETD2_NATPD      -------------------------------------------MVDVSQHNMVPEHTVLD
Q5UZR1_HALMA          -------------------------------------------MVDVSQHDLVPDHSVVD
Q18EX3_HALWD          -------------------------------------------MVDVNQHTLVPEHTLVD
D4GZX3_HALVD          -------------------------------------------MVDVSQHKLVPEHTKLD
RPO5_METTH            -----------------------------------------MKR-EILKHQLVPEHVILN
RPO5_METST            -----------------------------------------MKA-DILQHKLVPEHTILS
RPO5_METTP            -----------------------------------------MKRFAVQDHELVPEHILLT
D2ZPW6_METSM          ------------------------------------------MTINIQEHMLVPKHEIMT
B9AEP9_METSM          --------------------------------------------------MLVPKHEIMT
RPO5_MIMIV            SVISEFLDEYETYKKIIVTKDYTGKIDTFILRNSGQIFKEHEFLADLLSNEFQPRFQLLS
RPO5_METJA            --------------------------------------------MKVTDHILVPKHEIVP
RPO5_META3            --------------------------------------------MKIALNQMVPKHEVIS
RPO5_METM6            --------------------------------------------MKVSSHEMVPTHEIIP
RPO5_METM7            --------------------------------------------MKVSSHAMVPTHEIIP
RPO5_METM5            --------------------------------------------MKVSSHEMVPTHEIIP
RPO5_METMP            --------------------------------------------MKISSHEMVPTHEIIP
RPO5_METVS            --------------------------------------------MKVSSHEMVPEHEIIP
RPO5_METAC            -----------------------------------------MTKFSLLDHESVPKHEIIS
RPO5_METMA            -----------------------------------------MTKFSLLDHEAVPKHEIMS
RPO5_METBF            -----------------------------------------MTKFSLLDHESVPKHEIMP
RPO5_METBU            -----------------------------------------MSKFSLLDHELIPHHEIMD
RPO5_METLZ            -----------------------------------------MTRLNVLLHEMVPDHQIMT
RPAB1_RAT             LIVV-------QQGMTPSAKQSLVDMAP---KYVLEQFLQQELLINITEHELVPEHVVMT
RPAB1_MOUSE           LIVV-------QQGMTPSAKQSLVDMAP---KYVLEQFLQQELLINITEHELVPEHVVMT
RPAB1_HUMAN           LIVV-------QQGMTPSAKQSLVDMAP---KYILEQFLQQELLINITEHELVPEHVVMT
RPAB1_PONAB           LIVV-------QQGMTPSAKQSLVDMAP---KYILEQFLQQELLINITEHELVPEHVVMT
RPAB1_BOVIN           LIVV-------QQGMTPSAKQSLVDMAP---KYILEQFLQQELLINITEHELVPEHVVMT
RPAB1_CAEBR           IIVV-------QTGMTPSAKQSIGDMAP---KYMLEHFLEAELMVNITEHELVPEHVVMT
RPAB1_CAEEL           IIVV-------QTGMTPSAKQSIGDMAP---KYMLEHFLEAELMVNITEHELVPEHVVMT
RPAB1_DICDI           IIVV-------QQNITPFAKQALAEFSQE-KKITLEQFNEAELLVNITHHQLVPKHILLT
D2UZT4_NAEGR          ILVLRPADSFQQKDLSSQAKRAIEALQA--IGYILETFKETELLVNITEHVLVPQHVPLN
RPAB1_CANGA           IFIY-------QNNITPSAMKLVPSIPPA----TIETFHEAALVVNITHHDLVPKHIRLN
RPAB1_YEAST           IFVY-------QNNITPSAMKLVPSIPPA----TIETFNEAALVVNITHHELVPKHIRLS
RPAB1_KLULA           IFIY-------QSGITPSANKILPTAAPA----VIETFPEASLVVNITHHELVPKHIRLS
RPAB1_KLUMA           IFIY-------QSGITPSANKILPTAAPA----VIETFPEASLVVNITHHELVPKHIRLS
RPAB1_ASHGO           IFIY-------QNGITPSALKLLPSVAPA----TIETFNETALVVNITHHELVPKHIKLS
RPAB1_DEBHA           IFIY-------QSSITPSANKLIPTVSPA----SIETFQEGDLVVNITHHDLVPKHIKLA
RPAB1_YARLI           ILVY-------ENNMTPSANRLIPSVAPA----TIDTFQETDLLVNITKHVLVPTHIKLS
RPAB1_SCHPO           ILIY-------ANSMTPSAAKIIATVTGQF---TIETFQESDLIVNITHHELVPKHILLS
RPB5_ASFM2            QYEELILIVDKPILGKKNILDIIVEQRAANPTVVINIYPYHLFCINIPKVSAIPKHKLIT
RPB5_ASFK5            QYEELILIVDKPILGKKNILDIIVEQRAANPTVVINIYPYHLFCINIPKVSAIPRHKLIT
RPB5_ASFB7            HYEELILIVDKPVLSKKNILDIIVEQRAANPTIVINIYPYHLFCINIPKVSAIPKHKLIT
RPB5_ASFWA            HYEELILIVDKPVLSKKNILDIIVEQRAANPTIVINIYPYHLFCINIPKVSAIPKHKLIT
RPB5_ASFP4            HYEELILIVDKPVLSKKNILDIIVEQRAANPTIVINIYPYHLFCINIPKVSAIPRHKLIT
RPO5_PYRAE            ---------------------------------------MSRISLGVKEVTVIPR-----
                                                                           *      

RPO5_SULIA            -IDEAYKILKELGIRPEQLPWIRASDP------VARSINAKPGDIIRIIRKSQLYGEVVS
RPO5_SACS2            -IDEAYKILKELGIRPEQLPWIRASDP------VARSINAKPGDIIRIIRKSQLYGEVVS
RPO5_SULTO            -IEEAYKILKELGIKPEQLPWIRASDP------IAKLVGAKPGDIIKITRKSSLSGEVVV
RPO5_SULAC            -LEEAYKLVKELGIKPEQLPWIRASDP------VAKSIGAKPGDIIKITRKSPFTGESVT
RPO5_METS5            -VEEAFKVLKELGIGPEQLPWMRASDP------MARTINAKPGDIVKITRKSPIVGELVV
RPO5_HYPBU            -PEEAARIIRELGVRPEQLPWLRATDP------VARAIGAKPGDIVRIYRKSPTAGEVVV
A8AA82_IGNH4          -PEEAVEELRKWGLRVEQLPLLKASDP------VARELDLKPGDIVKIIRKSENAEEVVV
RPO5_ARCFU            -KEEAEELLKILGIGKEQLPKIKADDP------IAKEIGAKPGDIVKITRKSLTAGESVF
RPO5_STAMF            -VREAAELLRKLKIKPAQLPWISIDDP------VVKAIKAKPGDIIRIIRKSPTAGEAIA
RPO5_THEPD            -KEEANRLLKAMGLKKSELPWIYSTDP------VARALKAKPGDVIMIIRQSPTAGESVA
RPO5_THEON            -EEEKEELLRKYRIKISQLPQIKASDP------AVVALGAKPGDVLEIKRKSPTAGYYYY
RPO5_THECE            -EEETKELLRRYRIQISQLPQIKASDP------AVVALGAKPGDVLEIKRKSRTAGYYYY
RPO5_THEKO            -EEEKEELLKKYRIRISQLPQIKASDP------AVVALGAKPGDVIEIKRKSPTAGYYYY
RPO5_THEGJ            -EEEKEELLRRYRIRLSQLPQIKASDP------AVVELGAKPGDVIEIKRKSPTAGVYLY
RPO5_PYRAB            -EEEKKALLEKYRITPAQLPQIKASDP------AVKALGAKPGDIIEIKRKSPTAGVYYY
RPO5_PYRHO            -EEEKKALLEKYKITPAQLPQIRASDP------AVKALGAKPGDIIEIKRRSPTAGVYYY
RPO5_PYRFU            -EEEKKALLEKYKITLAQLPQIKASDP------AVKALGAKPGDVIEIKRKSPTAGVYYY
RPO5_THESM            -KEETEELLKKYNIKPSQLPQIKTSDP------AVQALDAKPGDIIEIKRKSPTAGVYYY
RPO5_NITMS            -KTEAEEVLKKYNCKPTELPLIFVNDP------AILGLGVKPGDMIKITRKSPTAGEGLY
RPO5_AERPE            -IEEAVQVLKMLGIKPWQLPKISVNDP------IARLLKAKPGDIIEITRRSYTAGEAKY
RPO5_THEAC            EEEE-KNILKELNIEKEFLPKISPNDPAIKALE-AVHGKIKEGTIIKIVRKSPTMGHSVY
RPO5_THEVO            EEEE-KTILKELGIEKEFLPRISPNDPVIKALE-AIHGKIKDGTVIKIIRNSPTMGHSVY
Q6L2F7_PICTO          VEDE-DKILSELKTTKEALPKISLTDPAIRALEEALNTKIGENRIIKIIRKSPTAGYYEY
RPO5_METKA            DEEEIEKILEELGVEKDDLPRIHTNDPVVVALSEKLGKRIKPGSLVKIVRDSPTAGKTVV
RPO5_HALS3            -EETLDGVLADYDIDRTELPKIKYKDP-------ALPDNAEIGDVVEIVRDSRTTDEAVV
RPO5_HALSA            -EETLDGVLADYDIDRTELPKIKYKDP-------ALPDNAEIGDVVEIVRDSRTTDEAVV
A0A1U7ETD2_NATPD      -REEVEDVLAEYDIKRTDLPKIQRRDA-------ALPDDAEPGNVVKIVRDSRTTDEAVV
Q5UZR1_HALMA          -EDDLEAVLTEYEIKKTDLPKIKRTDK-------ALPDDAEVGDVVRIVRDSRTTDEAVV
Q18EX3_HALWD          -EDDIEAILTEYDIRRADLPKIQRRDP-------ALPDNAEPGDVVKIVRDSRTTDRAVS
D4GZX3_HALVD          -DEAVEDVLQEYNVEKTNLPKIKLKDP-------ALPEDAEPGDVIKIVRNSRTTDKAVV
RPO5_METTH            -ESEAKRVLKELDAHPEQLPKIKTTDP------VAKAIGAKRGDIVKIIRKSPTAEEFVT
RPO5_METST            -EEEAQKVLDDLNVRLDQIPKILPTDP------VVKAIDAKVGDILKITRKSETAGIFVA
RPO5_METTP            -PEEAQQVLMQYGVEARHLPKIHVTDP------VAKEIGAKVGDIIKIKRKSPTAKESIF
D2ZPW6_METSM          -DSEIEDLKNSADYDIENLPRIKVDDP------VVKDIDAKENDILRITRESDTAGTFVT
B9AEP9_METSM          -DSEIEDLKNSADYDIENLPRIKVDDP------VVKDIDAKENDILRITRESDTAGTFVT
RPO5_MIMIV            -PSEMESVKTEYNANPYTLKKIVRSDP------IVRYFALKKNDIIRIIRPSATSGQGID
RPO5_METJA            -KEEVEEILKRYNIKIQQLPKIYEDDP------VIQEIGAKEGDVVRVIRKSPTAGVSIA
RPO5_META3            -KEEVQKLLAKYDIKIQQLPKIFDIDP------VIEEIGAKPGDVVKISRDSPTSGHATY
RPO5_METM6            -REEIPLLLEKYNIKLQQLPKLLDTDP------LVLETEATPGDVLKITRMSPTAGESTY
RPO5_METM7            -REEIPLLLEKYNIKLQQLPKLLDTDP------LVLEVEAAPGDVLKITRMSPTAGESTY
RPO5_METM5            -REEIPLLLEKYDIKLQQLPKLLDTDP------LVLEVEATPGDVLKITRMSPTAGETTY
RPO5_METMP            -REEIPLLLEKYSIKMQQFPKLLDTDP------LVLEIGATPGDVVKITRMSPTAGESTY
RPO5_METVS            -GDEIPFLLEKYGIKIQQFPKLLISDP------LVIEVGAKVGDIVKITRKSQTAGETVY
RPO5_METAC            -EGELKSVLSKYLIEKEQLPKIKVQDP------VSKEIGAVVGDVVRITRKSQTAGEADY
RPO5_METMA            -EGELKSVLSKYFIEKEQLPKIKVQDP------VCKEIGAVVGDVVKITRKSQTAGEADY
RPO5_METBF            -EGELKSVLSKYSIEKEQLPKIKVHDP------VCKEIGAVVGDVVKITRISQTAGEAEY
RPO5_METBU            -EDDLKTVLTHYNVEREQLPKLKVTDP------IALEIGAEPGDVVKVIRKSQTAGEALY
RPO5_METLZ            -DEDVKNLLTTFDITEDHLPKIYHDDP------AVKACGAKPGNVIMIVRKSQTAGEATS
RPAB1_RAT             -KEEVTELLARYKLRESQLPRIQAGDP------VARYFGIKRGQVVKIIRPSETAGRYIT
RPAB1_MOUSE           -KEEVTELLARYKLRESQLPRIQAGDP------VARYFGIKRGQVVKIIRPSETAGRYIT
RPAB1_HUMAN           -KEEVTELLARYKLRENQLPRIQAGDP------VARYFGIKRGQVVKIIRPSETAGRYIT
RPAB1_PONAB           -KEEVTELLARYKLRENQLPRIQAGDP------VARYFGIKRGQVVKIIRPSETAGRYIT
RPAB1_BOVIN           -KEEVTELLARYKLRENQLPRIQAGDP------VARYFGIKRGQVVKIIRPSETAGRYIT
RPAB1_CAEBR           -AEEKAELLARYKLKDSQLPRIQQCDP------VARYFGLRRGQVVKIIRPSETAGRYIT
RPAB1_CAEEL           -AEEKAELLARYKLKDSQLPRIQQCDP------VARYFGLRRGQVVKIIRPSETAGRYIT
RPAB1_DICDI           -KEEKLELLTRYKMKESQLPRIQTNDP------VARYYGLSRGHVVKIVRPSETAGRYIT
D2UZT4_NAEGR          -KAQHEELLQRYKLKETQLPRMKVTDP------IARYYGLQRGAIVKIIRSSETAGRYVT
RPAB1_CANGA           -EEEKAELLKRYRLKESQLPRIQRADP------VALYLGLKRGEVVKIIRKSETAGRYAS
RPAB1_YEAST           -SDEKRELLKRYRLKESQLPRIQRADP------VALYLGLKRGEVVKIIRKSETSGRYAS
RPAB1_KLULA           -EAEKKELLKRYRLKESQLPRIQRMDP------VALYLGLKRGEVIKIIRKSETSGRYAS
RPAB1_KLUMA           -DAEKKELLKRYRLKESQLPRIQRMDP------VALYLGLKRGEVIKIIRKSETSGRYAS
RPAB1_ASHGO           -DEEKKELLKRYRLKESQLPRIQRMDP------VALYLGLKRGEVVKIIRKSETSGRYAS
RPAB1_DEBHA           -RDEKKELLERYRLKESQLPRIQREDP------VGRYLGLKRGEVVKIIRRSETSGRYAS
RPAB1_YARLI           -GAEKKFLLERYRLKESQLPRIQREDP------VARYLGLRRGQIVKIIRRSETSGRYAS
RPAB1_SCHPO           -PDEKKELLDRYKLRETQLPRIQLADP------VARYLGLKRGEVVKIVRRSETSGRYNS
RPB5_ASFM2            -QEEAQEFLGREYLQPQDLMQISASDP------PVVWLGGRPGDFVQIERPSETAMHAVV
RPB5_ASFK5            -QEEAQAFLGREYLQPQDLMQISASDP------PVVWLGGRPGDFVQIERPSETAMHAVV
RPB5_ASFB7            -QEEAQEFLGREYLQPQDLMQISASDP------PVVWLGGRPGDFVQIERPSETAMHAVV
RPB5_ASFWA            -QEEAQEFLGREYLQPQDLMQISASDP------PVVWLGGRPGDFVQIERPSETAMHAVV
RPB5_ASFP4            -QEEAQEFLGREYLQPQDLMQISASDP------PVVWLGGRPGDFVQIERPSETAMHAVV
RPO5_PYRAE            --EEAKELLKRMKLRPWQLPWIRASDP------LAQKAGAKPGDVLKIVRESPTAGEAVV
                                        :  :   *                . .: : * *        

RPO5_SULIA            YRYVISG----------
RPO5_SACS2            YRYVISG----------
RPO5_SULTO            YRYVISG----------
RPO5_SULAC            YRYVITG----------
RPO5_METS5            YRYVVSG----------
RPO5_HYPBU            YRYVVGY----------
A8AA82_IGNH4          FRYVVAG----------
RPO5_ARCFU            YRLVV------------
RPO5_STAMF            YRYVVVDTLRPRKKEKV
RPO5_THEPD            FRLVMRG----------
RPO5_THEON            YRLVVED----------
RPO5_THECE            YRLVVED----------
RPO5_THEKO            YRLVVED----------
RPO5_THEGJ            YRLVVED----------
RPO5_PYRAB            YRVVVED----------
RPO5_PYRHO            YRVVVED----------
RPO5_PYRFU            YRVVVED----------
RPO5_THESM            YRIVVED----------
RPO5_NITMS            YRYVVEV----------
RPO5_AERPE            YRFVVAYQKGVK-----
RPO5_THEAC            YRVVASEVFK-------
RPO5_THEVO            YRVVASEVFK-------
Q6L2F7_PICTO          YRVTVKGVF--------
RPO5_METKA            YRVVTNPPE--------
RPO5_HALS3            YRLVIE-----------
RPO5_HALSA            YRLVIE-----------
A0A1U7ETD2_NATPD      YRLVVE-----------
Q5UZR1_HALMA          YRLVVE-----------
Q18EX3_HALWD          YRLVIE-----------
D4GZX3_HALVD          YRLVIE-----------
RPO5_METTH            YRLVQD-----------
RPO5_METST            YRVVRD-----------
RPO5_METTP            YRLVID-----------
D2ZPW6_METSM          YRIVKS-----------
B9AEP9_METSM          YRIVKS-----------
RPO5_MIMIV            YRVVV------------
RPO5_METJA            YRLVIKRII--------
RPO5_META3            YRLVVKKTI--------
RPO5_METM6            YRLVIATSL--------
RPO5_METM7            YRLVIATSL--------
RPO5_METM5            YRLVIATSP--------
RPO5_METMP            YRLVIATSL--------
RPO5_METVS            FRLVVSNSV--------
RPO5_METAC            YRLVIE-----------
RPO5_METMA            YRLVIE-----------
RPO5_METBF            YRLVIE-----------
RPO5_METBU            YRYVIG-----------
RPO5_METLZ            YRLVVRRPKK-------
RPAB1_RAT             YRLVQ------------
RPAB1_MOUSE           YRLVQ------------
RPAB1_HUMAN           YRLVQ------------
RPAB1_PONAB           YRLVQ------------
RPAB1_BOVIN           YRLVQ------------
RPAB1_CAEBR           YRLVV------------
RPAB1_CAEEL           YRLVV------------
RPAB1_DICDI           YRLCV------------
D2UZT4_NAEGR          YRYVV------------
RPAB1_CANGA           YRICM------------
RPAB1_YEAST           YRICM------------
RPAB1_KLULA           YRICL------------
RPAB1_KLUMA           YRICL------------
RPAB1_ASHGO           YRICL------------
RPAB1_DEBHA           YRICL------------
RPAB1_YARLI           YRICL------------
RPAB1_SCHPO           YRICA------------
RPB5_ASFM2            IRFITKSKI--------
RPB5_ASFK5            IRYITKSKI--------
RPB5_ASFB7            IRFITKSKI--------
RPB5_ASFWA            IRFITKSKI--------
RPB5_ASFP4            IRFITKSKI--------
RPO5_PYRAE            YRLVVPG----------
                       *