CLUSTAL format seed alignment for MF_00027

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COBB_MYCTU      -------MRVSAVAVAAPASGSGKTTIATGLIGALRQAGHTVAPFKVGPDFIDPGYHALA
COBB_MYCBO      -------MRVSAVAVAAPASGSGKTTIATGLIGALRQAGHTVAPFKVGPDFIDPGYHALA
COBB_STRCO      MTSSDSGSAVPRLVIAAPSSGSGKTTVATGLMAALTARGLAVSPHKVGPDYIDPGYHALA
CBIA_LISMF      ---------MNKILIAAASSGTGKTTITLGIMHALKKRGLRVQPFKVGPDYIDTNYHQAI
CBIA_LISMO      ---------MNKILIAAASSGTGKTTVTLGIMHALKKRGLRVQPFKVGPDYIDTNYHQAI
CBIA_LISIN      ---------MNKILIAAASSGAGKTTVTLGIMQALKKRGFAVQPFKVGPDYIDTNYHQAI
CBIA_SALTY      -----MAARHHAFILAGTGSGCGKTTVTLGLLRLLQKRALRVQPFKVGPDYLDTGWHTAI
CBIA_METJA      -------MIMKRVVIAGTSSEVGKTVISTGIMKALSKKY-NVQGYKVGPDYIDPTYHTIA
CBIA_METTH      ----------MRVVLAGTGSAVGKTTIATGIMKALSGR--GVQPFKVGPDYIDPSYHTMA
CBIA_ARCFU      --MKLLPMDIPRVVIAGTSSKVGKTMISIGLMRLLVNRGYEVQPYKVGPDFIDPGFHHLA
CBIA_PICTO      -------MKINSIIIGAPSSSSGKTTISIGIMRALSRRL-RVQPFKVGPDYIDPGYHNIA
CBIA_BACHD      --------MQPRLVIAGTHSGVGKTTVTLGLMAAFVEKGNIVQGFKCGPDYIDPSYHRAV
CBIA_BACME      -------MSNRRLVIAGTGSGVPKTTLTIGLMAALKQAGYRVQGFKCGPDYIDPTYHTAV
CBIA_LEPIC      -----MNIKIPRIVIGGTGSGVGKTTIALALTQILRKKGLKVATFKCGPDYLDPTYHSRA
CBIA_LEPIN      -----MNIKIPRIVIGGTGSGVGKTTIALALTQILRKKGLKVATFKCGPDYLDPTYHSRA
CBIA_SULAC      -------MRFPRIIISSDRSNSGKTLVTAGLIKVL-SKRYKVRGYKVGPDFIDPMYHKIA
CBIA_SULTO      -------MRFPRIIISSDRSNSGKTIISSALMRVL-SRKMKVRGFKAGPDFIDPKYHTLA
CBIA_SACS2      ---------MKRILLSSDRSGSGKTLITSAIMRAL-SKKYKVRGFKAGPDFIDPGYHKIA
CBIA_THEAC      -------MKVPRLIVAGTESGAGKTTITISIILKLLANQMKVKPYKIGPDYIDPQFHRLA
CBIA_THEVO      -------MKVPRVIIAGTNSGVGKTTTTLAVISALKNKGLKVKPYKVGPDYIDPQFHSLL
CBIA_CALS4      --------MCRVFMIAGTHSGAGKTTLSLGIMGVL-SKKYNVRPFKVGPDYIDTAYHRYV
CBIA_SYNY3      ----------MTVIIAGERSGAGKTTITLAMLAYLARQKLRVQSFKVGPDYIDPMFHSQI
COBB_AGRFC      -------MTARAIIIGAPRSGSGKTSVTIGLLRAFARRGVKVRGIKTGPDYIDPGFHAFA
COBB_RHILO      -------MTARAIIIGAPRSGSGKTSVTIGILRALTRRGLKVRGAKSGPDYIDPGFHTAA
COBB_RHOCB      -----MSEGPKGLAIAAPASGSGKTTLTLGLLRALTRRGLRVQPFKNGPDYIDPAFHAAA
COBB_BRUME      ---------MKGFMIAAPASGSGKTTVTLGLLRALKRRGEVLAPVKAGPDYIDPAYHRAA
COBB_BRUSU      ---------MKGFMIAAPASGSGKTTVTLGLLRALKRRGEVLAPVKAGPDYIDPAYHRAA
COBB_SINSX      ---------MSGLLIAAPASGSGKTTVTLGLMRALKRRGVAIAPGKAGPDYIDPAFHAAA
COBB_RHIME      ---------MNGLMIAAPSSGSGKTTVTLGLMRALRRRGLSIAPGKAGPDYIDPAFHTAA
COBB_PSEAE      ----MTQARCPALLIAAPASGQGKTTVTAALARLHARQGRRVRVFKCGPDFLDPMILARA
CBIA_HALMA      ---------MEGFVLAGTSSGVGKTVATLATLTALEDAGYQPQPAKAGPDFIDPSHHEAL
CBIA_HALSA      MTESESASGMDGVVLGGTASGVGKTVATLAVARALADAGHDVQPAKAGPDFIDPSHHEPV
                            . :..  *   **  : .               * ***::*.      

COBB_MYCTU      AGRPGRNLDPVLVGERLIGPLYAHGVAGAD--IAVIEGVLGLFDGRIGPAGGAPAAGSTA
COBB_MYCBO      AGRPGRNLDPVLVGERLIGPLYAHGVAGAD--IAVIEGVLGLFDGRIGPAGGAPAAGSTA
COBB_STRCO      TGRVGRNLDAYLCGPELVGPLFLHGARGCD--IAVVEGVMGLYDG----AAGEGELASTA
CBIA_LISMF      TGVASINLDSFLIDDDAMLATLFQKHGESAD-ISVIEGVMGLFDGL----GIDRDNSSTS
CBIA_LISMO      TGVASINLDSFLIDDDAMLAALFEKHGQSAD-ISVIEGVMGLFDGL----GIDRDNSSTS
CBIA_LISIN      TGVASINLDSFLIDDDEMLASLFQKHGESAD-ISVIEGVMGLFDGL----GTDRDNASTS
CBIA_SALTY      CGVASRNLDSFMLPP-PVLNALFCEQMRQAD-IAVIEGVMGLYDGY----GVDPNYCSTA
CBIA_METJA      TGNKSRNLDSFFMNKEQIKYLFQKHSKDKD--ISVIEGVRGLYEGI----SAIDDIGSTA
CBIA_METTH      TGNTSRNIDSFFMTEAQIREAFTRAMKLSGSRMGIIEGVRGLYEGI----SPIGDTGSTA
CBIA_ARCFU      TGRYSRNLDSFMLSRSAILETFIRNFRGAD--VAIIEGKTGLYDSS----DAVSEKGSVA
CBIA_PICTO      TGRFSSNLDTWMSSREKMKEIFIKRSTGSD--ISIIEGVMGLYDGK----QPDKDTGSTA
CBIA_BACHD      TKRASRNLDSWMVSEDVVNDIFIEGCNGAD--LSIIEGVMGFYDGK----ASTSDKGSTA
CBIA_BACME      TERTSRNIDSWMLEHDMVREIVARASQDAD--ISIMEGVMGFFDGK----NPLTNEGSTA
CBIA_LEPIC      SQKICHNLDGWLMGKESVLNTFYQACHNVD--IAIIEGMMGLFDGH----SPNSEIGSTA
CBIA_LEPIN      SQKICHNLDGWLMGKESVLNTFYQACHNVD--IVIIEGMMGLFDGH----SPNSEIGSTA
CBIA_SULAC      SGHPVINLDLWLMGESGVYSSLAKYGKHFD--LGIIEGVMGLYDGL----YEDY---STY
CBIA_SULTO      ARVPSINLDLWLMGIEGVKKSLIRYGKGYD--IGIIEGVMGLYDGI----NVNY---STY
CBIA_SACS2      TGFPSINLDLWMMGKNNVKRSLAKYGKEFD--IGIIEGVMGLYDGV----DTLY---STY
CBIA_THEAC      SGVPSENLDLWMMNDDQIRYLLIEGSREFD--ISVIEGVMGLFDGA----GSDFT-GSTY
CBIA_THEVO      AGATSDNLDLWMIPRERIFQLLADASTSFN--ISVIEGVMGLLDGF----GSTDE-GSTL
CBIA_CALS4      TRNFSVNLDLFMLGEENLKNLFYKNASRAD--VSIIEGVMGLYDGI----DTTSR-GSSA
CBIA_SYNY3      TGRPCRNLDPFLTSEAYVQRCFHYHSQGTP--YSLIEGVMGLFDGVP--YQGLTDYSSTA
COBB_AGRFC      TGTPGLNLDSWAMQPDLLRHLFSQQTEDA--ELILIESAMGLFDGIPV-AENRTG--SAA
COBB_RHILO      TGLSGVNLDSWAMPPSLLNALAAQQADDT--DFVILESAMGLFDGIPA-APGRTG--SAA
COBB_RHOCB      AGRASFNLDGWAMDRPQLHAL-AGQAAGA--DLVIFEGAMGLYDG-PA-DPGRSGRGTSA
COBB_BRUME      SGVDCFNLDPWAMRPELISALSSRMTESGA-RVLVAEGMMGLFDG----AIDGKG--SSA
COBB_BRUSU      SGVDCFNLDPWAMRPGLISALSSRMTESGA-RVLVAEGMMGLFDG----AIDGKG--SSA
COBB_SINSX      TGEPCFNYDPWAMRPELLLANASHVASGG--RTLIVEAMMGLHDG----AADGSG--TPA
COBB_RHIME      SGKPCFNYDPWAMRPELLLANAAAAAEDG--SVLIMEAMMGLFDG----AADGTG--APA
COBB_PSEAE      SGAPVYQLDLWMVGEAEARRLLARAAGEA--DLILIEGVMGLFDGNP----------SAA
CBIA_HALMA      VDTPSRTLDPWLAGEDGMRRTYWRGTGDI----CVVEGVMGLYDG---------TKTSTA
CBIA_HALSA      VGTPSRSLDPWLSGTDGMRRTYHQGDGDV----CVVEGMMGLYDG---------SVASTA
                        *                         : *.  *: :.            :  

COBB_MYCTU      HVAALLGAPVILVVDARGQSHSVAALLHGFSTFDT----ATRIAGVILNRVGSA--RHEQ
COBB_MYCBO      HVAALLGAPVILVVDARGQSHSVAALLHGFSTFDT----ATRIAGVILNRVGSA--RHEQ
COBB_STRCO      QVAKLLRAPVVLVVDASSQSRSVAALVHGFVSWDP----EVRIGGVILNKVASD--RHEA
CBIA_LISMF      FIAKCTKTPVILVVDGKAISTSAAAIVDGFNRFDP----ELTIAGVIINRVASE-NHFSL
CBIA_LISMO      FIAKCTKTPVILVVDGKAISTSAAAIVDGFNRFDP----ELTIAGVIINRVASE-NHFSL
CBIA_LISIN      FIAKCTKTPVILVVDGKAISTSAAAIVDGFNRFDP----ELKIAGVIINRVASE-NHFSL
CBIA_SALTY      AMAKQLGCPVILLVDGKAVSTSLAATVMGFQHFDP----TLNLAGVIVNRVTSD-AHYQL
CBIA_METJA      SVAKALDSPIILLVNAKSLTRSAIAIIKGFMSFD-----NVKIKGVIFNFVRSENHIKKL
CBIA_METTH      SVAKALDAPVVLIINSRSLVKSAAAMVLGFRSLDR----EVKIEGVILNQVKNRRHYLKT
CBIA_ARCFU      EVSKILKAPVVLVANVERLNRTAAAIILGYKLFDP----DVLLKGVILNRVGSERHAGKV
CBIA_PICTO      EVARTLKSPVIIVIDISAMARTAAAIILGLIKMDK----RLRISGVILNNAGSDYHCSIV
CBIA_BACHD      DISLLLQAPVLLVVDISGMARSAAAVVKGFQQLNE----KVKIAGVILNGAGSE-RHAEM
CBIA_BACME      EISLITNSPVLLVVNCASMARSAAAIVKGFQQFLP----EANIVGVIANRVGSE-GHYKL
CBIA_LEPIC      EIAKWLASPVLVVLDTRGMARTVSAILKGLKIFDP----DLNLAGAFANFTGSP-SHIQL
CBIA_LEPIN      EIAKWLASPVLVVLDTRGMARTVSAILKGLKIFDP----DLNLAGAFANFTGSP-SHIQL
CBIA_SULAC      KLSELTHTPLILVINCSNLSSTVGAIVKGLREYR-----NANVRGVIFNYIASE-KHLDY
CBIA_SULTO      ELSEVTKTPIILVVNCSNVSSTVGAIVKGLKDYR-----NARIRGVIFNQIGSE-THYNY
CBIA_SACS2      ELAKVTKTPIILIINCSNIGSTVGAIVKGLKYYRS----DVSIRGVIFNKIASE-THYNY
CBIA_THEAC      DLARRTGTPIVLVIDGYGISATAAAIVSGIKAYA-----GELLRGVIVTRVSGE-SHYRL
CBIA_THEVO      DLARITGTPIILVIDGYGLSGSAAAIVKGFKDFS-----GDLLAGVIVTRVSGE-RHYDL
CBIA_CALS4      HIAKLVNVPVVLVVDASSMAASVSALIMGYIYYDK----DVDIRGVILNKVGSE-RHYTL
CBIA_SYNY3      HIARLLNLPIVFVMDCQRLSGSVAAIVQGYRHWQP----GVNLVGVILNRVGGD-RHLEL
COBB_AGRFC      DLARLFRIPVLLVLDVSGQSQTAATIAHGFAHYDP----DVTMGAVVLNRAGSE--RHRT
COBB_RHILO      DLARLYGLPVLLVLDVSGQSTTAAAVAKGFATYDP----DVRMAGVVLNRLGSE--RHRK
COBB_RHOCB      EIARMFGWPVVLVLDVKGQGQSAAATALGFARHPE----APPLAGVILNHVASP--RHEA
COBB_BRUME      DLARLLDLPVVLVVDCARQSHSIAALVWGFSQFRK----DVLIEGVILNRVGSP--RHEA
COBB_BRUSU      DLARLLDLPVVLVVDCARQSHSIAALVWGFSQFRK----DVLIEGVILNRVGSP--RHEA
COBB_SINSX      DLAATLNLAVILVVDCARMSQSVAALVRGYADHRD----DIRVVGVILNKVGSD--RHEM
COBB_RHIME      DLAAALGLAVILVVDCARLSHSVAALVGGYARHRD----DVRVAGVILNRVGSD--RHEG
COBB_PSEAE      DLARRFGVPVLGVINGAAMAQTFGALAYGLAHFQP----DLPFSGVLGNRVGSQ--RHSD
CBIA_HALMA      AVAEGLDLPVVLVVDAKAGMESVAATALGFAQYADRIGVDIEVAGILAQRAHGG--RHAD
CBIA_HALSA      RVASELDLPVVLVVDASAGMQSVAATALGFQAYAAEASVDVDVAGVLAQRAHGG--RHAD
                 ::     .:: : :      :  :   *             . . .     .       

COBB_MYCTU      VLRQACDQAGVAVLGAIPRTAELELPTRYLGLVTAVEYGRRARLAVQAMTAVVARHVDLA
COBB_MYCBO      VLRQACDQAGVAVLGAIPRTAELELPTRYLGLVTAVEYGRRARLAVQAMTAVVARHVDLA
COBB_STRCO      LLREAVDSVGVPVLGVLRRAAPVETPSRHLGLVPVAERGSDAVDAVAAMGARVADGCDLE
CBIA_LISMF      IKGAIERYTDVPVLGYLPKNAAVALPERHLGLVPKEEM-TELETKWELLGDLIAEHVDLD
CBIA_LISMO      IKGAIERYTDVPVLGYLPKNAAVALPERHLGLVPKEEM-TELETKWEVLGDLIAEHVDLD
CBIA_LISIN      IKGAIERYTDVPVLGYLPKNAAVALPERHLGLVPQEEM-TELEAKWELLSDLITTHVDLD
CBIA_SALTY      LKNAIEHYCSLPVLGYVPPCDGVALPERHLGLITARES-LVNQQSWHDFAATLEQTVDVD
CBIA_METJA      KDAMSYYLPDIEIIGFIPRNEDFKVEGRHLGLVPTPENLKEIESKIVLWGELVEKYLDLD
CBIA_METTH      RRAVEE-LTGTAVIGGIPRSSELEVEQRHLGLVPAVER-DTIAAQIEKWGLAMEEYIDLE
CBIA_ARCFU      RTAVEK-LAGVRVLGVVPR-KKVKMPYRHLGLVTAYER-EDMDELLDNIAEIVEKHVDVD
CBIA_PICTO      RTAIEK-YTGIPVIGCVKRSDDLKIDDRYLGLKTAMED--DNSGKIDKIADIIERSVDLD
CBIA_BACHD      CSEAIKEACGIPALGYLKKGDVPSIPERHLGLVPALER-GEHDSLFSQLAAVVSRQFDLE
CBIA_BACME      VKAAIEQECHIPVVGYLKTNDELTIPERHLGLIPSIER-GELTPFFEQLGQLVHDTIDIE
CBIA_LEPIC      LKDASTE---VPILGGLCKHSEQTFPERHLGLYSASEE-NVSEEKFNFWGEEGEKSLEVN
CBIA_LEPIN      LKDASTE---VPILGGLCKHSEQTFPERHLGLYSASEE-NVSEEKFNFWGEEGEKSLEVN
CBIA_SULAC      CKKSIPEN--VEVLGYLPIDKSLSVPSRHLGLYTTEDF-KNAKDVINATANLIEMNVDVD
CBIA_SULTO      CKSSIKE---VQVLGYIKYDRNFSVPSRHLGLFTTEDF-KETENVLQSVSKAIEESVDID
CBIA_SACS2      CRNAVED---VEVLGYVPFDKNLEIKSRHLGLVTVEDN-REVQNLIRYASELVEKYVDLD
CBIA_THEAC      IRDAVEEKTGVPVLGYMIRNEKAVLESRHLGLVQAYEI-DEIREIFGAIDSST--VIDMH
CBIA_THEVO      IKKAIEDNTNVRVLGYIEKNDEVRLESRHLGLVQASEL-NSFSDYIERLSKVT--HINVD
CBIA_CALS4      LKEVIERDLNIEVFGYLPKDVELELPERHLGLLPVYET-ENLDKKLEKLYGYIENCIDVE
CBIA_SYNY3      LKIALEPL-RIPILGVFFRQQDLTLPDRHLGLVPCGEL-PQIQQYFDQLAHVAAQQLDWP
COBB_AGRFC      LCTEAIEKIGLPVVGCVLRDPSLILPERHLGLVQASEH-PEIDPHIDRLADAMEKSIDLD
COBB_RHILO      LSGDAIEAIGLPVVGAILRDPTLNLPERHLGLVQAGEY-DDLMAHLDRLADMAEKSLDLD
COBB_RHOCB      MIRAEMDRLGLRVLGALPRRSDLSLPERHLGLVQAEEQ-AGLEATLEALADFVAAHVDLE
COBB_BRUME      MLRGALAPLGVPVLGALPRDPALSLPERHLGLVQADEH-AGLESFLEQAADVMEAHIDMD
COBB_BRUSU      MLRGALAPLGVPVLGALPRDPALSLPERHLGLVQADEH-AGLESFLEQAADVMEAHIDMD
COBB_SINSX      MLRDALGKVRMPVFGVLRQDSALQLPERHLGLVQAGEH-SALEGFIEAAAARVEAACDLD
COBB_RHIME      MLRDALAGIAMPVFGVLRQDAALKLPERHLGLVQAGEH-GSLEAFIDHAAMRVASGCDLE
COBB_PSEAE      ILRDCLPP-GMRWFGGLPRSAEFELPSRHLGLVQAEEL-ADLDARLDAAADALRASAETD
CBIA_HALMA      GIRDALPE-DLTYFGRIPPMSDLEIPDRHLGLHMGSEA-GLDRDALSTAAETIDIERLVE
CBIA_HALSA      GIRDALPD-SLTYFGRVPPRDDLDVPDRHLGLHMGSEA-AIDDDAVDAAAAHVAAKRIAD
                             .* .          *:***    :                       

COBB_MYCTU      AVIACAGSQAA---------------HPPWDPVIAVGNTARQPAT---------------
COBB_MYCBO      AVIACAGSQAA---------------HPPWDPVIAVGNTARQPAT---------------
COBB_STRCO      ALVGLARSTGALSCAAWDAGEALVSSPPPPLPVPSPGAAPPDPLVRPGRPRPQAPDGLRR
CBIA_LISMF      RLLAISKTGA----------------------KLTVHPPEIQVPDFS-----------GV
CBIA_LISMO      RLLAISKTGA----------------------KLTVHPPEIQVPDFS-----------GM
CBIA_LISIN      KLLEISKSSE----------------------NLSTSKAQMKVADFS-----------GL
CBIA_SALTY      ALLSLSVLSAL---------------------PAGMWPERPDNTAGA-----------GL
CBIA_METJA      KIVEIADEDFE---------------------EVDDVF-LWEV-NEN-----------YK
CBIA_METTH      ALQDIMSSAGK---------------------IRGERQPLWQRGNRK-----------RV
CBIA_ARCFU      KILEIAEKAPP---------------------LDSVFEDEKEDEEKK-----------YV
CBIA_PICTO      LLIKISKESGD---------------------I-SFKSGLFSKKNVN-----------RV
CBIA_BACHD      RIERLALEASA---------------------LSRRTNLFQQTKRPS-----------VV
CBIA_BACME      KVYELAL-APK---------------------IEINDPIFTKPSVP------------QV
CBIA_LEPIC      SILEIANSAPE---------------------ISIPVSNINTTLKR-------------C
CBIA_LEPIN      SILEIANSAPE---------------------ISIPVSNINTTLKR-------------C
CBIA_SULAC      KIVEIAEEANE---------------------LQESNEIEERN--------------VVG
CBIA_SULTO      KIIEIANSAEE---------------------LQEVDEAISNDELD-T---------KKG
CBIA_SACS2      KIYEMASDEDL---------------------EIDLPEDNESNG-------------VKR
CBIA_THEAC      QIIDIARSADK---------------------LETLYSPEIERL-------------GTF
CBIA_THEVO      GIIEIARASRD---------------------LDPKFSPLLSRV-------------GYA
CBIA_CALS4      KLMNLTVKPPD---------------------FIEKEDRVLKEK--------------KV
CBIA_SYNY3      KLLPLLETPRN---------------------LPSPMSLFDVPQKSP-----------QA
COBB_AGRFC      TLFSLAAPV-D--------------------MPCGSVAAAIAPPGQR-------------
COBB_RHILO      AVMRLATPL-A--------------------PAAGGFADALQPPGQR-------------
COBB_RHOCB      ALLSVAG---A--------------------GPAPGAGAWAVPPAGR-------------
COBB_BRUME      ALQTIWLRPKR--------------------YDAMANVARLKPLGNR-------------
COBB_BRUSU      ALQTIWLRPKR--------------------YDAMANVARLKPLGNR-------------
COBB_SINSX      AIRLIATIFPQ--------------------VPAAADAERLRPLGQR-------------
COBB_RHIME      AVLAAAT---P--------------------LTVGERAGTLKPLGQR-------------
COBB_PSEAE      LPEPVTFEV------------------------PAPAPLQRSLEGVR-------------
CBIA_HALMA      TARAPPEVA------------------------TTERNTGDSPADRR-------------
CBIA_HALSA      VARTPPRPP------------------------AHDPAPD---TGQT-------------
                                                                            

COBB_MYCTU      -VAIAAGRAFTFGYAEHAEMLRAAGAEVVEFDPL-SETLPEGTDAVVLPGGFPEQFTAEL
COBB_MYCBO      -VAIAAGRAFTFGYAEHAEMLRAAGAEVVEFDPL-SETLPEGTDAVVLPGGFPEQFTAEL
COBB_STRCO      RVAMASGAAFTFSYAEHTELLAAAGAEVVTFDPLRDEELPEGTQGLVIGGGFPEVYASEL
CBIA_LISMF      RVAYALDAAFHFYYQDNLDFIRSTGATLIPFSPLE-EREVPDADFIYIGGGFPEVFAEQL
CBIA_LISMO      RVAYALDAAFHFYYQDNLDFIRSTGATLIPFSPLE-EREVPDADFIYIGGGFPEVFAERL
CBIA_LISIN      RVAYALDAAFHFYYQDNLDLIRLTGAELIPFSPLE-DNEVPEADFIYIGGGFPEIFAKQL
CBIA_SALTY      TLALADDEAFNFYYPDNIDLLERAGVNIVRFSPLH-DRALPDCQMIWLGGGYPELYAADL
CBIA_METJA      KIAVAYDKAFNFYYWDNFEALKENKAKIEFFSPLK-DSEVPDADILYIGGGYPELFKEEL
CBIA_METTH      RIGVAIDEAFNFYYQENIEALEDNAASVVPFSPIH-DEELPDVDAVYIGGGYPEIFAAEL
CBIA_ARCFU      KIGVIRDQVFSFYYQDNLDELSKY-AELVFVNSLT-DKRLPDVDALYIGGGFPEVFAEGL
CBIA_PICTO      RIAIAYDAAFNFYYYDNIEMLKMYGAEIVYFSPLN-DYKLPEADGLYIGGGFPELFAERL
CBIA_BACHD      KIAVAYDAAFHFYYEENFTLLRQAGAELVYFSPLRGEDLPSHCDGLYLGGGFPEEFADEL
CBIA_BACME      KIAVARDAAFNFYYEENFELLKACGAELVEFSPLKGEMVPQDADGLYIGGGFPEEFAETL
CBIA_LEPIC      KIGIAMDSAFHFYYEENLMRLRQAGAELVFFSPLS-DSRLTDVDGLYFGGGYPEVFAPTL
CBIA_LEPIN      KIGIAMDSAFHFYYEENLMRLRQAGAELVFFSPLS-DSKLTDVDGLYFGGGYPEVFAPTL
CBIA_SULAC      KAYVAYDSAFSFYYDENIDILKK-RYDVEFFSPLNNDAPADQPSFIYIGGGYPELHLEEL
CBIA_SULTO      IAAIAYDSAFNFYYSENIDLLRY-KYQIEFFSPLLNEKIDN-PSLIYVGGGYPELHLNEL
CBIA_SACS2      KMAIAYDPAFSFYYQENLDILKN-KYELEFFSPLNNEYVED-AEAIYIGGGYPELHLNEL
CBIA_THEAC      KVSVAMDSAFDFYYEENLRMLKRMGASIRYFSPMGNEVPDADSDLIYLGGGYPEVFAGKL
CBIA_THEVO      KIAVAYDSAFDFYYEENFRVLRNLGAELVFFSPLNNEIPPEDTDGLYIGGGYPEVFAKKL
CBIA_CALS4      KIAYAYDEAFNFYYKESLETLEEMGAHLIPFSPLDDERLPEGTEGLYIGGGFPEVFAKRL
CBIA_SYNY3      RLAIAQDQAFNFYYADNLDLLTHCGFELIPFSPLEDTELPPAIDGVYLGGGFPELFAEQL
COBB_AGRFC      -IALAEDAAFTFLYPHLRRHWRAAGAEIVPFSPLADEAPDESCDICWLPGGYPELFAGKL
COBB_RHILO      -IALAEDGAFTFLYPHVAAYWRKAGAEIVPFSPLADEAPDDSCDVCWLPGGYPELHAGKL
COBB_RHOCB      -IALARDAAFSFVYPHMLEAWRRAGVTVLPFSPLADQAPDPSADLVWLPGGYPELHAGRI
COBB_BRUME      -IAVARDDAFAFAYMHLFEGWRRRGAEISFFSPLADEAPKADADAIYLPGGYPELHAQRL
COBB_BRUSU      -IAVARDDAFAFAYMHLFEGWRRRGAEISFFSPLADEAPKADADAIYLPGGYPELHAQRL
COBB_SINSX      -IAVARDIAFAFCYEHLLYGWRQGGAEISFFSPLADEGPDAAADAVYLPGGYPELHAGQL
COBB_RHIME      -TAVARDVAFAFCYEHLLSGWRGQGAEVTFFSPLADEAPDPRADAVYLPGGYPELHAEQL
COBB_PSEAE      -IGVARDASFAFLYQANLDLLRELGAELAFFSPLQDQAL-PAVDSLYLPGGYPELHLGRL
CBIA_HALMA      -VAVAQDSAFCFIYPSVLERLRSE-ASVEPFSPVAGDSV-PDADAIYLPGGYPELHGESL
CBIA_HALSA      -VAVADDAAFCFAYPATRERLRER-ADVVTFSPVAGDDL-PACDGVYLPGGYPELHTDAL
                      .  * * *             :  ...:         .   . **:** .   :

COBB_MYCTU      SANDTVRRQINELAAAGAPVHAECAGLLYLVSELDGHP-----MCGVVAGSARFTQHLK-
COBB_MYCBO      SANDTVRRQINELAAAGAPVHAECAGLLYLVSELDGHP-----MCGVVAGSARFTQHLK-
COBB_STRCO      SANEGLRKSVAELAFSGAPVAAECAGLLYLCRELDGLP-----MCGVLDAAARMSKRLT-
CBIA_LISMF      AKNKSMRESILAAHEQGKPIYAECGGLMYLGSSLEMEA-ESYEMVGVFDGVSKMTTRLRK
CBIA_LISMO      AKNKSMHESILAAHEQGKPIYAECGGLMYLGSSLEMEA-ESYEMVGVFDGVSKMTTRLRK
CBIA_LISIN      NDNRSMRKSILAAHEKGIPIYAECGGLMYLGSSLEMEG-KQYEMVGVFNGISKMTTRLRK
CBIA_SALTY      AANTVMLKHLRAAHQRGVAIYAECGGLMYLGSTLEDSGGEIHQMANIIPGHSKMGKRLTR
CBIA_METJA      SRNKEMIESIKEFDGY---IYGECGGLMYITKSIDNVP-----MVGLLNCSAVMTKHVQG
CBIA_METTH      ESNTSMRKSIQRFHADGRPIFGECGGLMYLMSSIDERE-----MCGVFPHPAEMTGRVQG
CBIA_ARCFU      EKNEKLRNEIYDFCQSGNPVYAECGGLMYLGESLETSEGE-FEMVGFLPLKTKMYERFQA
CBIA_PICTO      SDNYSIKKDIMEFFNSGRPVFAECGGYMYLSRGIKINGKY-YEMASIINGESYMDSLILG
CBIA_BACHD      SQWIKDHPQLKKRVQSGLPTLAECGGYMFLGEQLTTTKGKTVEMAGVIPMVVQMENKLVS
CBIA_BACME      AQQIDVKNSVRAAIQKGLPTLAECGGFMFLTDGIVTTDDTCYEMVGLIPGQVRMQTKLAA
CBIA_LEPIC      SKNKSLLNYIRDLSYKNIPIYAECGGLMYLSKGIKLVEGEFFPMLGLISATSIMEKKLKA
CBIA_LEPIN      SKNKSLLNYIQDLSYKNIPIYAECGGLMYLSKGIKLVEGEFFPMLGLISATSIMEKKLKA
CBIA_SULAC      ENSTKTKDWIKRNVEKGVKLLAECGGFMFLSNEIINE--KSYRMIGLYDIQIKAKDKLT-
CBIA_SULTO      EKSSSTIRWIKKEAEKGTKILAECGGLMYLSKEIIAD--KSYKMVNLFDISIKAKDKLT-
CBIA_SACS2      EKSTRTKKWLKNMSYAGVKIYAECGGLMYLSKNLIDENNKNHSMTGIFDIDIKTKDKLT-
CBIA_THEAC      QSATDTIEAIRHAASIGTGVYAECGGYMFLCRSLESTDGHIYGGVGIIPASVYMDASLV-
CBIA_THEVO      AYAVDARENIAKLIKKGVPTLAECGGYMYLTRTIVGQDGIEYPGVGIVPAKTFLTDKLI-
CBIA_CALS4      SENESMLREIKEAVEKGMPVYAECGGLMYLSKGIRDLEGNRYSMVGVYDFEVVMTKKLQR
CBIA_SYNY3      SQNQALKDQLKTLIHQGLPTYGECGGLMYLSQSLTNFEGQIFPMLEMLPTAVTMGGKLS-
COBB_AGRFC      ADAVGFKAGITRFAET-KPVHGECGGYMVLGERLEDAEGVIHAMTGLLSHATSFATRKMN
COBB_RHILO      AAAETFKAGMARFAAT-KPIHGECGGFMVLGEALEDASGETHRMLGLLGHATSFAKRKMN
COBB_RHOCB      AAATRFKAGLRAFAET-RSVHGECGGYMVLGARLVDAEGRAHAMAGLLGLVTSYEKRRLH
COBB_BRUME      AGASRFRTAIGDAAARGVTVYGECGGYMVLGKTLEDAAGVHHPMLGLLPLETSFARRKLH
COBB_BRUSU      AGASRFRTAIGDAAARGVTVYGECGGYMVLGKTLEDAAGVHHPMLGLLPLETSFARRKLH
COBB_SINSX      SAAARFRSGMHSAAERGARIFGECGGYMVLGEGLVAADGTRYDMLGLLPLVTSFAERRRH
COBB_RHIME      SNASNFRAAMHKAAGGGARVFGECGGYMVLGEGLVAADGGRYEMLGLLPLVTSFAERKRH
COBB_PSEAE      QGNRAMAEAIRAHHAAGKPLLAECGGMLYLLDCLEDADGERGELLGLLPGRARLQKRLTA
CBIA_HALMA      ETG-GTLDEIAVRAADGVPVYGECGGLMALSESLTTTDGDTYEMAGVLPADIEMQDRYQA
CBIA_HALSA      ADA-PALDTLGARAADGLPVLGECGGLMALAESLTTTDGDTAEMAGVLPADVRMQDRYQA
                         :           .**.* : :   :            .             

COBB_MYCTU      LGYRDAVAVVDSALYSVGERVVGHEFHRTAVTFADS---YQPAWVYQGQDVDDVRDGAVH
COBB_MYCBO      LGYRDAVAVVDSALYSVGERVVGHEFHRTAVTFADS---YQPAWVYQGQDVDDVRDGAVH
COBB_STRCO      LGYRDAVAVSDSALAVAGTRMRGHEFHRTVVEPGAG---AAPAWGMRAP--ERRVEGFVE
CBIA_LISMF      FGYCIAEPLEDTLLGKKGTAIRGHEFHHSVFETTEP-TRMKLTKKRDGKIVKEWHGGYQK
CBIA_LISMO      FGYCIAEPLEDTLLGKKGTAIRGHEFHHSVFETTEP-TRMKLTKKRDGETVKEWHGGYQK
CBIA_LISIN      FGYCIAEPLEETLIGKKGMSIRGHEFHHSVFETTET-ACMKLSKKRDGEIVKEWRGGYQK
CBIA_SALTY      FGYCEAQAMQPTLLAAPGEIVRGHEFHYSDFIPETP-AVMACRKVRDGRVLQEWTGGWQT
CBIA_METJA      LSYVKAEFLEDCLIGRKGLKFKGHEFHYSKLVNIKEE--RFAYKIERGRGIINNLDGIFN
CBIA_METTH      LSYVIAEAVMDNLITEAGDKFRGHEFHYSRVLGASGG--KFAFRVLRGRGIVDSLDGITS
CBIA_ARCFU      QGYSVYRTLKPCIIAKRNQKIVGHEFHYSRPTLTGKA--DFAFRVERGFGIDGRRDGILK
CBIA_PICTO      YRNIRAES--NNILMMGGWHVKGHEFHYSRLNVNAN-----AYKTERG------PDGIST
CBIA_BACHD      LGYRDVTPLDDSFLLSKGQQIRGHEFHYSKAVYTET--ERPAYFVKGLFG--EGKEGYMS
CBIA_BACME      LGYREVTGKPGNFLFKGDIQAKGHEFHYSTFYSEKE--FSPAYDTKGMRG--MKEEGYMN
CBIA_LEPIC      LGYVEVTTKKETIFGEVGLRFRGHQFRYSDLELDESNPIELVYNLRKRKSDQVSEEGYSK
CBIA_LEPIN      LGYVEVTTKKETIFGEVGLRFRGHQFRYSDLELDESNPIELVYNLRKRKSDQVSEEGYSK
CBIA_SULAC      IGYTELETEKDNLLSSKGESIRGHEFHVSKAVSVG--DVNFAFKNKHGKGIWNGKDGVYV
CBIA_SULTO      IGYTELDVLSDNILGRKGEVLRGHEFHVSKAINLGN-DVKFSMKNRIGKGIWENKDGAIV
CBIA_SACS2      IGYTELEAVKENFIVNKNNVVRGHEFHVSKPISVN--EKEFVFKVRIGKGIINKLDGVKS
CBIA_THEAC      IGYREISAKRDTSILRAGETARGHEFHKSRIRFDG--PYDHPFVLKSRSSSFE--DGFSS
CBIA_THEVO      LGYREIVSKTSNMLLRHGETARGHEFHRSTIQFQD--KVDHPFVLKYKDRFEE--DGYYS
CBIA_CALS4      FGYVEAEITMDNVLFKKGERIKGHEFHYSRIEGFSQ---NASYIVNRPGKEEKWECGFVH
CBIA_SYNY3      LGYRQAQVVNSHSWLWQTESLRGHEFHRSQMTKLPN--QALYRQRGLLAIDQNTTDGWCV
COBB_AGRFC      LGYRQATIAADSPLGMAGDVLRGHEFHYARVIDPGR--DQPFAHMADGQGRPLGPSGGRR
COBB_RHILO      LGYREARLRADCPLGAQGALIRGHEFHYAQMTATGN--DEPLADLADGLGNPIGASGYRR
COBB_RHOCB      LGYRSADLLAPLPGYGAGSRLYGHEFHYSTILEQ-P--DAPLAKVCDAAGAPVAETGSVR
COBB_BRUME      LGYRLLEPLGGLPWDMP---LKAHEFHYASIVREEK--ADRLFRVRDASGENLGEAGLRV
COBB_BRUSU      LGYRLLEPLGGLPWDMP---LKAHEFHYASIVREEK--ADRLFRVRDASGENLGEAGLRV
COBB_SINSX      LGYRRVVPVDNAFFDGP---MTAHEFHYATIVAEGA--ADRLFAVSDAAGEDLGQAGLRR
COBB_RHIME      LGYRRVTPVDDVFFRGP---MTAHEFHYATIVSEGA--AEPLFTVRDAAGLDLGRAGLRR
COBB_PSEAE      LALQEVELPEGR--------LRGHTFHHSTLDCA----VEPLARGVCPNGRNTAEAVFRL
CBIA_HALMA      LDHVELEARADTVAATSGAHRRGHEFHYSAATLGSD--ASFAFDMVRGDGIDGEHDGLTE
CBIA_HALSA      LDHVELRATGDTLTAGSGATLRGHEFHYSAATVASD--ARFAFAVERGDGIDGDHDGLTE
                                      .* *: :                               

COBB_MYCTU      SGVHASYLHTHPAATPGAVARFVAHAACNTPRA-------------------------
COBB_MYCBO      SGVHASYLHTHPAATPGAVARFVAHAACNTPRA-------------------------
COBB_STRCO      RGVHASYLHTHWAAEPGVARRFVERCRTS-----------------------------
CBIA_LISMF      GNTFASYLHIHFYQNLLIITHMFGAIER------------------------------
CBIA_LISMO      GNTFASYLHIHFYQNLAMITHMFGAIER------------------------------
CBIA_LISIN      GNTFASYLHIHFYQNPAILMQMFGAGKR------------------------------
CBIA_SALTY      GNTFASYLHVHFAQRPEMLQHWLAAARRVL----------------------------
CBIA_METJA      GKVLAGYLHNHAVANPYFASSMVNFGE-------------------------------
CBIA_METTH      GSSLASYIHIHAASCPQFAANFTRNAWEF-----------------------------
CBIA_ARCFU      ENTLGCYIHVHFLSDKSIARRFVKKAMKKK----------------------------
CBIA_PICTO      KNLLAGYMHLYFPSNPRIPERFVRSCYNV-----------------------------
CBIA_BACHD      DHLLAGYTHLHFASEPAVATQWVKACEVYKNRRLHRGQVSQ-----------------
CBIA_BACME      NNLIAGYTHFHFGSSTKMVENWVEQCKAAKKER--RDAV-------------------
CBIA_LEPIC      NSILASYIHAHWASNPNLAEGFVQSCLRK-----------------------------
CBIA_LEPIN      NSILASYIHAHWASNPNLAEGFVQSCLRK-----------------------------
CBIA_SULAC      ENSLGSYSHFHFSRTRRLLSF-------------------------------------
CBIA_SULTO      YNTLASYSHFHFSSARGLLSF-------------------------------------
CBIA_SACS2      NNTVASYSHLHFSNFQLRIVF-------------------------------------
CBIA_THEAC      GSVTATYAHIHFLSNPRVAENLLIA---------------------------------
CBIA_THEVO      NNVVASYVHIHFLSNIAIPKRFVEECIRYSKKREIS----------------------
CBIA_CALS4      KNCLASFVHINLYTYKEGVKRFLDRCSSFGRK--------------------------
CBIA_SYNY3      GSVQASYLHLHWGSQISTVEKFRAACLAFQKKLSYLGKHPPFKSVPLRNTGGDAHGRE
COBB_AGRFC      GFVSGTFFHAIAKGG-------------------------------------------
COBB_RHILO      GHVSGTFFHAIARASA------------------------------------------
COBB_RHOCB      GHVTGSFFHLIAG---------------------------------------------
COBB_BRUME      GSVSGSFMHVIDFSGEAA----------------------------------------
COBB_BRUSU      GSVSGSFMHVIDFSGEAA----------------------------------------
COBB_SINSX      GPVAGSFMHLIDVAGAA-----------------------------------------
COBB_RHIME      RNVAGSFMHLIDFSE-------------------------------------------
COBB_PSEAE      GRLTASYIHFYLPSNPQAAAALLAPARDAD----------------------------
CBIA_HALMA      YSTIGTYCHCHGESGAFDRLLAVPSKDI------------------------------
CBIA_HALSA      YRTLGTYAHVHPESTAFDAFLDAL----------------------------------
                    . : *