CLUSTAL format seed alignment for MF_00028

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COBQ_NOSS1       --------MAMKSIMVVGTTSHAGKSLISTAICRILSRRGWRVAPFKGQNMALNAYVTAN
COBQ_SYNY3       ----------MKAIMVVGTTSHAGKSFLTTGLCRLLRRRGDRVTPFKGQNMALNAFVTID
COBQ_SYNP6       ----------MPALMVVGCTSHAGKSLITAAICRLLRRQGWRVAPFKGQNMALNAYVTAS
COBQ_THEEB       --------MKAKSLMVVGTTSHAGKSLLAAVICRWLAQQGYRVTPFKGQNMALNAYVTRE
COBQ_GLOVI       ----------MAALMVVGTSSHAGKSLLVTALGRLFHRRGVKVAPFKGQNMALNAYVTAE
COBQ_PROMM       ---------MSTPLMVLGTSSGAGKSLMSAALCRLLLRQGETPIPFKGQNMSNNAWVDES
COBQ_SYNPX       -------MNRKRPLMVLGTSSGAGKSLMTAALCRVLHRRGEQPLPFKGQNMSNNAWVDAD
COBQ_PROMA       ---MKNISAGHNALMVLGTSSGAGKSIITTAICRSLLRKGEVPIPFKGQNMSNNAWVDIN
COBQ_PROMP       MELIEKLQPIKKPLMVLGTSSGAGKSLTVTAIGRILKNSGEEPIPFKGQNMSNNAWVDWN
COBQ_ACIAD       ----------MRHISIFGTSSDAGKSTLTFVIAKILQRAGIRVAPFKAQNVSNNARVCDD
COBQ_CLOAB       ----------MSRIMIQGTASSVGKSILVAALCRIFKQDGFSVCPYKSQNMSLNSYITLD
COBQ_CLOTE       -------MFKLAKIMIQGTGSSVGKSILVTALCRIFKQDGYTVCPYKSQNMALNSYITYD
COBQ_CALS4       ---------MALKLMIQGTASSVGKSLIVTALCRIFKQDGLKVAPFKSQNMALNSYITEE
COBQ_LISMF       ---------MVKQIMIQGTASDAGKSVLVAGLCRLFKNKGKRVVPFKSQNMSLNSFITAT
COBQ_LISMO       ---------MVKQIMIQGTASDAGKSVLVAGLCRLFKNKGKRVVPFKSQNMSLNSFITAT
COBQ_LISIN       ---------MVEQIMIQGTASDAGKSVIVAGLCRLFKNKGKRVVPFKSQNMSLNSFITAT
COBQ_SALTI       ---------MTQAVMLQGTASDVGKSVLVAGLCRIFYQDGLRTAPFKSQNMALNSGITPD
CBIP_SALTY       ---------MTQAVMLQGTASDVGKSVLAAGLCRIFYQDGLRTAPFKSQNMALNSGITPD
COBQ_PHOLL       ---------MGLSLMLQGTASDVGKSVLVAGLCRIFVQDGYRCAPFKSQNMALNSGITIN
COBQ_CLOPE       --------MKYKSIMLLGTASSVGKSTVAAAFCRYFKKKGYRVAPYKALNISLNSFVTKE
COBQ_DESVH       ------MKSPTPALMLQGTSSNAGKSILTAAFCRILLQDGYRVAPFKAQNMALNSHVTAD
COBDQ_LEPIN      -------------<MFQGTASNVGKSILTAALCRILSQDGIKVAPFKSQNMALNSFVTLN
COBQ_BACFR       ------MNKNLHPLMLAGTGSDVGKSIIAAAFCRIFLQDGYHPAPFKAQNMALNSYATPE
COBQ_CHLTE       ----------MTNIAILGTASDVGKSIVATALCRIFSNAGVDVAPYKAQNMSNNSGVTPD
COBQ_BACHD       ----------MKGIMVQGTASDVGKSLICTALCRIFARRGYKVTPFKSQNMSNNSYITVE
COBQ_GEOKA       -------MAKALPIMFQGTHSDAGKSVIATAFCRMFAQDGWKTAPFKSQNMSLNSYVTPD
COBQ_BRADU       ---------MARALMIQGAGSDVGKSLIVAGLARAFTRRGLRVLPFKPQNMSNNAAVTVD
COBQ_RHOCA       ----------MTALMIQGAGSNVGKSMLVAGLCRAARRRGLTVAPFKPQNMSNNAAVTAD
COBQ_AGRFC       --------MTARVLMFQGTGSDVGKSLMVAGLARAFTRRGLSVVPFKPQNMSNNAAVTAD
COBQ_BRUME       ---------MARAIMFQGTGSDVGKSVLVAGLCRVARNRGLKVRPFKPQNMSNNAAVSDD
COBQ_BRUSU       ---------MARAIMFQGTGSDVGKSVLVAGLCRVARNRGLKVRPFKPQNMSNNAAVSDD
COBQ_RHILO       ---------MARAIMLQGTGSDVGKTVLVAGLCRAAKKRGLKVRPFKPQNMSNNAAVADI
COBQ_SINSX       ---------MTRRIMLQGTGSDVGKSVLVAGLCRLAANQGLKVRPFKPQNMSNNAAVSDD
COBQ_RHIME       ---------MTRKIMLQGTGSDVGKSVLVAGLCRLASNHGLSVKPFKPQNMSNNAAVADD
COBQ_BURMA       --------------MIQGTTSDAGKSTLVAGLCRLARRTGARVAPFKPQNMALNSAVTAN
COBQ_BURPS       --------------MIQGTTSDAGKSTLVAGLCRLARRTGARVAPFKPQNMALNSAVTAN
COBQ_RALSO       --------------MIQGTTSDAGKSTLVAGLCRIAHRAGVRVAPFKPQNMALNSAVTAD
COBQ_PSEPK       ----------MTTLMVQGTTSDAGKSTLVTALCRWLLRQGVAVVPFKPQNMALNSAVTAD
COBQ_PSESM       ----------MTTLMVQGTTSDAGKSTLVTALCRWLTRQGVKVVPFKPQNMALNSAVTAD
COBQ_PSEAE       ------MSDRGRTLMVQGTTSDAGKSTLVTALCRWLARRGVAVVPFKPQNMALNSAVTAD
COBQ_XANAC       --------MSARVLMVQGCTSDAGKSTLVAALCRWLHRQGIAVAPFKPQNMALNSAVTVD
COBQ_CHRVO       --------MSAKTIMIQGATSDAGKSALATGLCRLLARRGVKVAPFKPQNMALNSAVTAD
COBQ_METCA       ---MSHRLPRGATLMIQGTTSDAGKSTLVTGLCRALHRRGFRVAPFKPQNMALNSAVTPQ
COBQ_VIBVU       ------MEAKVTTLMVQGTTSDAGKSVLVAGLCRVLARKGVNVAPFKPQNMALNSAVTKE
COBQ_VIBVY       ---------MKKLLMVQGTTSDAGKSVLVAGLCRVLARKGVKVAPFKPQNMALNSAVTKE
COBQ_VIBPA       ------MKSAIPSLMVQGTTSDAGKSVLVAGLCRVLARKGINVAPFKPQNMALNSAVTKD
COBQ_VIBCH       ---------MKKWLMVQGTTSDAGKSVLVAGLCRVLARRGIQVCPFKPQNMALNSAVTPD
COBQ_PHOPR       ------MQLTTQALMVQGTTSDAGKSVLVTGLCRVLVRKGIKVAPFKSQNMALNSAVTKD
COBQ_SHEON       --------------MVQGTTSDAGKSTLVAGICRLLARQGVNVAPFKPQNMALNSAVTVD
COBQ_CORDI       ----------MKSFLVAGCTSDAGKSVVVAGLCRALTRRGLRVAPFKAQNMSNNSAVTP-
COBQ_COREF       -------MAAGPAFLIAGTTSDAGKSVITAGLCRAFARAGLRVAPFKAQNMSNNSAVTS-
COBQ_MYCPA       ---------MSGALLVAGTSSDAGKSVVVAGLCRLLARRGVRVAPFKAQNMSNNSAVTV-
COBQ_NOCFA       ---------MKGALLVAGTTSDAGKSVVVAGLCRMLARRGVRVAPFKAQNMSNNSVVTL-
COBQ_MYCBO       ----------MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNSMVCRG
COBQ_MYCTU       ----------MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNSMVCRG
COBQ_STRAW       ---------MSGGLLIAGTTSDAGKSVVTAGICRWLVRQGVKVAPFKAQNMSLNSFVTR-
COBQ_STRCO       ---------MNGGLLVAGTTSDAGKSVVTAGICRWLVRQGVKVAPFKAQNMSLNSFVTR-
COBQ_CUTAK       ----------MTGILVAGTSSDAGKSLVVTALCRVARRRGVDVVPFKAQNMSNNSMVCA-
COBQ_DEIRA       --------------MVQGCTSNAGKSYLCAALCRMLSDEGLRVAPFKAQNMSNNAGVTPP
COBQ_HALMA       ---------MAHTLLVAGTASHVGKSTVAAGLCRYLADCGVSVAPFKAQNMSNNARATP-
COBQ_HALSA       ----MTAGEDCRTILVAGTASHVGKSTVAAGLCRLLADRGLSVAPFKAQNMSNNARAVPV
COBQ_METJA       ---------MAEFIMVVGTSSNSGKTTITAGLCRILANKGYKVAPFKSQNMSLNSRVAKE
COBQ_METMP       ---------MAKFIMVVGTSSNSGKTVLVSGICRMLSNKGYKVAPFKSQNMSLNSRVSVE
COBQ_METTH       --------MSAKCIMVQGTSSSAGKSVMVAALCRIFSRRGYRVAPFKSQNMSLNSFTTAE
COBQ_METKA       ----------MSAIMFVGTASNSGKSFLAAVTCAYLRQRGVDVAPFKSQNMSLNSCVAKE
COBQ_PYRFU       ---------MGKALMIQGTMSGVGKSLIATALCRIFSDLGYDVVPFKSQNMSLNSAPSIE
COBQ_THEKO       ---------MGKALMVQGTMSGAGKSLLVAALCRIFTNLGYDVVPFKSQNMSLNSAPSIE
COBQ_METAC       --------MEKKSLLILGTASHVGKSSVVTAICRILSR-NYRVAPFKAQNMSLNSWITKD
COBQ_METMA       --------MEKKSLLILGTASHVGKSSVVTAICRILSR-SYRVAPFKAQNMSLNSWITKD
COBQ_ARCFU       ----------MPSLMVGGTTSSAGKSLLAAAFCRILARRGYDVAPFKAQNMSLNSFVTSK
COBQ_PICTO       ----------MKMIQVLGTSSDSGKSTLATAFCRILKDLGYRVSPFKAVNMSLNSIAIKD
COBQ_THEAC       ------------MIQVLGTSSGSGKTTIAMALSRIFFRSGYRVAPFKAVNMSLNSVIVEG
                                . *  *  **:             .    *:*  *:: *:     

COBQ_NOSS1       ----------GGEIGYAQAVQAWAAGVVPWVEMNPILLKPQGDMTSQVIIRGRPVGRVNA
COBQ_SYNY3       ----------GGEMGHAQAVQAWAAGTVPRVAMNPILLKPQGDMTSQVIMLGQAVGTTRA
COBQ_SYNP6       ----------GGEIGYAQAFQAWAAGVEPTIEMNPILLKPQGDMTSQVVLKGRAVGRTLA
COBQ_THEEB       ----------GGEIGYAQAMQAWAAGIEPEVAMNPILLKPQGNMTSQVILRGQVVGVTRA
COBQ_GLOVI       ----------GHEIGHAQAVQAWACGLEPSVAMNPILLKPQGNMTSQVILKGKPAGVCGA
COBQ_PROMM       ----------GGEMAYSQALQAWAAGLKPQCAMNPVLLKPQGDSTSEVIHLGQSVGTARA
COBQ_SYNPX       ----------GGEMAYSQAMQAWAAGLEPCCAMNPVLLKPRGDSTSEVIHGGTSVGLARA
COBQ_PROMA       ----------NGEMAYSQAVQAWAAGIEPICAMNPVLLKPQGDCTSEVIHLGKSVGVVQA
COBQ_PROMP       ----------GGEMAFSQALQAFACGIIPSSEMNPILLKPQGNSTSEVIHLGKSKGITTA
COBQ_ACIAD       ----------GSEIAIAQSFQAEVLAIPTSYHLNPILLKSGINGQASVIVEGQVISQQDV
COBQ_CLOAB       ----------GKEMGRAQVLQAYAAGLEPEVYMNPILLKPTTDKSCQVIVKGEVYGVSSA
COBQ_CLOTE       ----------GKEMGRAQVLQAHAAGLEPEAYMNPILLKPTGDKKCQIIFNGEVYGNSTA
COBQ_CALS4       ----------GLEIGRAQAVQAEAAGIKPSYHMNPILLKPSSDKKSQVVLRGRVYENMSA
COBQ_LISMF       ----------GDEMGRAQVFQAEAAGVFPDVRMNPVLLKPTNDRQSQVIFMGAILDNMDA
COBQ_LISMO       ----------GDEMGRAQVFQAEAAGVFPDVRMNPVLLKPTNDRQSQVIFMGAILDNMDA
COBQ_LISIN       ----------GDEMGRAQVFQAEAAGVFPDVRMNPVLLKPTNDRQSQVIFMGAILDNMDA
COBQ_SALTI       ----------GKEMGRAQIFQAEAAGITPDVRMNPVLLKPTSDRQAQVVLMGKVATNMDA
CBIP_SALTY       ----------GKEMGRAQIFQAEAAGITPDVRMNPVLLKPTSDRQAQVVLMGKVATNMDA
COBQ_PHOLL       ----------GEEMGRAQIFQAEAAGIEPDVRMNPVLLKPTSERKAQVVLMGKVACSMNA
COBQ_CLOPE       ----------GDEIGRAQVVQAEACEIDPKEYMNPILMKPSAGFKTQVIVRGKVHCTMDA
COBQ_DESVH       ----------GLELGRAQAVQAAACRLDVDVRMNPVLLKPNSDTGSQVVVMGRPVGNMRV
COBDQ_LEPIN      ----------GEEIGRAQALQAQAAKILPDIRMNPILLKPSNEKDSQVIINGKPLNSMNF
COBQ_BACFR       ----------GLEIGRAQAVQAEAAGVPCHTDMNPLLLKPSSDHTSQVVLNGRPIGNRNA
COBQ_CHLTE       ----------GFEMGRAQIVQAQAARVAPHADMNPVLLKPNTDTGAQVVLQGKVCADKSA
COBQ_BACHD       ----------GLEIGRAQGIQAEAAMEEASVYMNPILLKPRNDREAEIVCFGQAVDTVSG
COBQ_GEOKA       ----------GNEIGRAQGIQAEAAGVAARAEMNPILIKPSREHESQIVVLGKPYGNMQA
COBQ_BRADU       ----------GGEIGRAQALQALAAGVEPHTDMNPVLLKPETDVGAQVVVHGKRIATARA
COBQ_RHOCA       ----------GGEIGRAQALQALACGLEPVTDMNPILLKPESDVGAQVVVQGKRLTTTRA
COBQ_AGRFC       ----------GGEIGRAQALQARAAGVPLSVHMNPVLLKPQSETGAQVVVQGKIVGSAKA
COBQ_BRUME       ----------GGEIGRAQWLQALACGVPSSVHMNPVLLKPQTDMGSQLIVQGQVRGEARG
COBQ_BRUSU       ----------GGEIGRAQWLQALACGVPSSVHMNPVLLKPQTDMGSQLIVQGQVRGEARG
COBQ_RHILO       PGD---NNHGGGEIGRAQWLQAIACGVAPSVHMNPVLLKPQSDVGAQVIVQGKVFGEARA
COBQ_SINSX       ----------GGEIGRAQWLQALAARVPSSVHMNPVLLKPQSDVGSQIVVQGKVAGQARG
COBQ_RHIME       ----------GGEIGRAQWLQALAARVPSSVHMNPVLLKPQTDVGSQVVVQGRVAGQAKG
COBQ_BURMA       ----------GGEIGRAQALQALAAGIEAHTDLNPVLLKPTGDRGAQVIIHGTARANLDA
COBQ_BURPS       ----------GGEIGRAQALQALAAGIEAHTDLNPVLLKPTGDRGAQVIIHGKARANLDA
COBQ_RALSO       ----------GGEIGRAQALQAQAAGLAPTVDMNPVLLKPNSDTGAQVIIHGRPRGDLNA
COBQ_PSEPK       ----------GGEIGRAQAVQAQACRLQPHTDMNPVLLKPNSDTGAQVIIHGRAVTSMNA
COBQ_PSESM       ----------GGEIGRAQAVQAQACFLAPHTDMNPVLLKPNSDTGAQVIIHGRAVTTMNA
COBQ_PSEAE       ----------GGEIGRAQAVQAQACRLAPHTDMNPVLLKPNTDIGAQVIIHGRAVTSMDA
COBQ_XANAC       ----------GGEIGRAQALQAQACGLDPQTDFNPVLLKPNSDTGAQVIVHGQPVATLDA
COBQ_CHRVO       ----------GGEIGRSQAVQAQACGVEPHTDMNPVLLKPNSHTGSQVIIQGRAIGNMEA
COBQ_METCA       ----------GGEIGRAQAVQAQACGLPPHTDMNPVLLKPYADQGSQVIIQGHAVGNMDA
COBQ_VIBVU       ----------GGEIGRAQAVQAQACRIEPSVHMNPVLIKPNSDTGAQIILQGKALTNMDA
COBQ_VIBVY       ----------GGEIGRAQAVQAQACRIEPSVHMNPVLIKPNSDTGAQIILQGKALTNMDA
COBQ_VIBPA       ----------GGEIGRAQAVQAQACNIEPTVHMNPVLIKPNSDTGAQIILQGKALSNMDA
COBQ_VIBCH       ----------GGEIGRAQAVQAQACGIAPSVHMNPVLLKPNSDTGAQVILQGRALSNMEA
COBQ_PHOPR       ----------GGEIGRAQAVQAQAACIEPTVHMNPVLLKPNTDVGAQIIVQGKAIADMDA
COBQ_SHEON       ----------GGEIGRAQALQAAACYLVPHTDFNPILLKPSSDTGAQIIVQGKALTTLEA
COBQ_CORDI       ---------DGGEIGRAQALQAYACGLTPSVDFNPILLKPGSDRTSQLVVRGIATGNVSA
COBQ_COREF       ---------DGGEIGRAQALQALACGLEPSVEFNPILLKPGPDNRARLVIRGREQGDVGA
COBQ_MYCPA       ---------EGGEIGRAQAIQARAAGLEPSVRFNPILLKPGSDRTSQLVIKGQVAESVTA
COBQ_NOCFA       ---------DGGEIGRAQALQARACGLEPSVRFNPVLLKPGSDRRSQLVVRGQAVDTVGA
COBQ_MYCBO       ------PDGTGVEIGRAQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVAS
COBQ_MYCTU       ------PDGTGVEIGRAQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVAS
COBQ_STRAW       ---------EGAEIGRAQAMQAQAARVEPTALMNPVLLKPGSDRSSQVVLMGRPVGEMSA
COBQ_STRCO       ---------DGAEIGRAQAMQAQACRVEPTAHMNPVLLKPGGERSSQVVLLGRPVGEMSA
COBQ_CUTAK       ---------DGSEIGRAQYLQATAAGVTPTSAMNPVLLKPGTDRRSFVVLRGKPGGVLEA
COBQ_DEIRA       E-----SSAPGLEMGRAQLVQARAARVVPDVRMNPVLLKPEADTSSQVVLLGRAAPELTA
COBQ_HALMA       ----------GGEVGVSQYVQARAAGVAPSTDHNPVLLKPRGDGESQLILDGDAVGHFEA
COBQ_HALSA       ADGAPPAADPWGEIGVSQYVQARAARTAASTDHNPVLLKPRGDAESQLVVDGRAVGHYSA
COBQ_METJA       ----------DGEIAIAQYTQSLACRVEPSVHFNPILLKPKGNFISQVIVHGRPYKDMNY
COBQ_METMP       ----------DGEIAVAQYTQAMAARAEPSVHFNPILLKPKGNFVSQVIVHGNPYEDKDY
COBQ_METTH       ----------NREIAVAQVLQAEAAGIEPSHHMNPVLLKPKEDFTSQVIVHGRPAGNMNF
COBQ_METKA       ----------NGEIAVAQAFQAAMAGQEPSIHHNPVLLKPKGELRSEVIVHGKPIGTMSY
COBQ_PYRFU       ----------GGEISRAQYLQAIACRKKPSIKFNPILLKPEGNMRSQVVFLGEPIGSVSA
COBQ_THEKO       ----------GGEISRAQYLQALACRKKPSVKFNPILLKPEGNMRSQVVFMGRPIGSVSA
COBQ_METAC       ----------GKEIGIAQAIQAKAAGTEPTADMNPVLLKPKGDCVSQVILLGEPYADKSA
COBQ_METMA       ----------GKEIGIAQAIQAKAAGTEPTADMNPVLLKPKGDCVSQVVLLGEPYADKSA
COBQ_ARCFU       ----------GKEIAIAQAYQAFAAGIEPDERMNPVLLKPKGNFVSQLVVMGEAVGDVDS
COBQ_PICTO       ----------GSEIARAQWVQAMAAGAEPSAYMNPVLLKPEGHHKSQVIILGRSIGSMGI
COBQ_THEAC       ----------EYEIARAQWLQAKAANTEPTRFMNPILLKPEGMGASQVIMLGKSLGKKTI
                             *:. :*  *:           **:*:*.       ::  *        

COBQ_NOSS1       ADYYEQY----FEPGWRAIEESLQHLATEFD--LVVCEGAGSPAEINLKHRDLTNMRVAK
COBQ_SYNY3       QEYYQNY----FDRGWQAIANSLETLAQDFD--VVVCEGAGSPAEINLKHRDLTNMRVAT
COBQ_SYNP6       ERYYQDY----FEVGWEAICEALEQLQADYD--WIVCEGAGSPAEINLKHRDLTNLRVAK
COBQ_THEEB       ADYYRDY----FERGWQAITEALADLQQRFD--WIVCEGAGSPAEINLKHRDLTNMRVAT
COBQ_GLOVI       VDYYRDY----FEPGWQAVVEALAELQSQYE--LVICEGAGSPAEVNLRHRDLTNMRVAL
COBQ_PROMM       ETYYEQW----FRPGWSVIREALKDLQCSYTHGRLVLEGAGSPVEVNLQRRDLTNLRLAQ
COBQ_SYNPX       EHYYRDW----FRPGWQAIREGLQTMQQRWPNGRLVLEGAGSPVEVNLQRRDLTNLRLAQ
COBQ_PROMA       ANYYEDW----FSSGWEAIQKGLNDIATSYKKHRLILEGAGSPVEINLQHRDLTNLKLAK
COBQ_PROMP       KDYYKDW----FFPGWGVIKKSLNSIYERYPNCRLIIEGAGSPVEMNLIHRDLTNLRVAK
COBQ_ACIAD       LEYYRD-----LDTLKPAVQRCFETLAKMYD--CIVAEGAGSPVELNLMDKDLSNIFIAK
COBQ_CLOAB       KNYYN---MKKE--FAPMLKEDFEELEDKFD--IVVIEGAGSPAEINLRENDIVNMGLAE
COBQ_CLOTE       MEYHN---MKTK--FGEKLKDQFKNIEEKFD--IVVIEGAGSPAEINLRDKDIVNMGFAE
COBQ_CALS4       EEYFK---FRPK--LLELIKEDFDFLAKRND--VVVIEGAGSPAEINLKEKDIVNMGLAE
COBQ_LISMF       VTYHD---FKQT--LIPKIQAVYQSLADEND--IIVLEGAGSPAEINLNDRDIVNMGMAK
COBQ_LISMO       VTYHD---FKQT--LIPKIQAVYQSLADEND--IIVLEGAGSPAEINLNDRDIVNMGMAK
COBQ_LISIN       VSYHD---FKQT--LIPKIQAVYQSLADEND--IIVLEGAGSPAEINLNDRDIVNMGMAK
COBQ_SALTI       VSYHD---YKPR--LREQILAVYNSLAQEYD--VIVLEGAGSPAEINLRDRDIVNMGMAE
CBIP_SALTY       VSYHD---YKPR--LREQILAVYNSLAQEYD--VIVLEGAGSPAEINLRDRDIVNMGMAE
COBQ_PHOLL       VEYHQ---YKPS--LQQQICEVFHSLASEYD--VIVLEGAGSPAEINLRDRDIVNMGMAE
COBQ_CLOPE       YKYKE---LNKY--LKEKAKEAYDDISNDYD--LIVLEGSGSCAEINLRETDIANMHTAK
COBQ_DESVH       REYMA---YKPV--AFDAARAAYDSLAADVD--VMVLEGAGSPAEVNLKAHDIVNMAMAR
COBDQ_LEPIN      KDYDQ---YKPI--AFEEVKKSYDSLASEYN--VIIIEGAGSASEVNLKKNDIVNMKMAE
COBQ_BACFR       YEYFR---REGREELRKEVHAAFDRLAARYN--PVVMEGAGSISEINLRDSDLVNLPMAM
COBQ_CHLTE       REYFG---DTQR--WAEAAFESLDRLMVRHE--LLVIEGAGSCAEMNLYQRDFVNFKTAR
COBQ_BACHD       VKYRD---GFYKR-GLEAIKQALATLSQSFD--MVVIEGAGSPVEVNLNDRELVNMKVAE
COBQ_GEOKA       FAYRN---EFFHQ-GLAVIRQSLETLMNEYD--RIVIEGAGSPAEVNLNDRELVNMRIAR
COBQ_BRADU       REYA-----AMKPSLMGAVLESFERLKARAD--LVLVEGAGSPAEVNLRKADIANMGFAR
COBQ_RHOCA       RDYA-----TLKPQLMGAVLESFNRLKATHD--LVIVEGAGSPAEVNLRAGDIANMGFAR
COBQ_AGRFC       ADYQ-----HMKAGLMPRVLDSFEHLKQLAD--LVLVEGAGSASEINLRANDIANMGFAR
COBQ_BRUME       RYYQ-----ELKPQLMAAVMESFAKVGDGAD--LVLVEGAGSPAEINLRAGDIANMGFAT
COBQ_BRUSU       RYYQ-----ELKPQLMAAVMESFAKVGDGAD--LVLVEGAGSPAEINLRAGDIANMGFAT
COBQ_RHILO       RDYQ-----ALKGRLMDAVLDSWAKVGEGAD--LVIVEGAGSPAEINLRSRDIANMGFAT
COBQ_SINSX       REYQ-----ALKPKLLGAVMESFEQISAGAD--LVVVEGAGSPAEINLRPGDIANMGFAT
COBQ_RHIME       KEYQ-----ALKPSLLGSVMESFEQVSAGAD--LVIVEGAGSPAEINLRAGDIANMGFAT
COBQ_BURMA       RAYH-----DYKPTAMRAVLESYGRLRGAYD--AVIVEGAGSPAEINLREGDIANMGFAE
COBQ_BURPS       RAYH-----DYKPTAMRAVLESYGRLRGAYD--AVIVEGAGSPAEINLREGDIANMGFAE
COBQ_RALSO       RAYH-----DYKPTAMAAVLASHGRLRAQYD--LVLVEGAGSPAEVNLRARDIANMGFAE
COBQ_PSEPK       VAYH-----DYKTTAMQAVLASHHRLSAAYP--VVMVEGAGSPAEINLRAGDIANMGFAE
COBQ_PSESM       VAYH-----GYKEIAMQAVLESHRRLSESYP--VIMVEGAGSPAEINLRANDIANMGFAE
COBQ_PSEAE       AAYH-----DYKRVAMEAVLASHGRLAAAYR--VVMVEGAGSPAEINLRANDIANMGFAE
COBQ_XANAC       VGYH-----AYKATAFKAVLASHERLVERFD--VVLVEGAGSPAEINLRANDIANMGYAE
COBQ_CHRVO       RGYH-----GYKPVAMKAVLASHARLAAQYQ--CIVAEGAGSPAEINLRDGDIANMGFAE
COBQ_METCA       RRYH-----EFKPTALSAVLESYARLAHQFQ--AVIVEGAGSPAEINLRTGDIANMGFAE
COBQ_VIBVU       YGFH-----NYKKVAMDTVMDSFARLKDEYQ--AIMIEGAGSPAEINLRQNDIANMGFAE
COBQ_VIBVY       YGFH-----NYKKVAMDTVMDSFARLKDEYQ--AIMIEGAGSPAEINLRQNDIANMGFAE
COBQ_VIBPA       ASFH-----DYKKVAMNTVLDSFSKLTKEFD--SIMIEGAGSPAEINLREGDIANMGFAE
COBQ_VIBCH       NAYH-----DYKKVAMDTVMDSFQRLQQEYE--AIMIEGAGSPAEINLRENDIANMGFAE
COBQ_PHOPR       IGYN-----GYKKVVMGPIMESFGILQDEYQ--TVIIEGAGSPAEINLRENDVANMGFAE
COBQ_SHEON       SAFFGEKSKDYKAMALNAVLDSFERLGQQYH--TIVVEGAGSPAEINLRAGDIANMGFAE
COBQ_CORDI       RSYIE----HRT-ELRKIASESLNSLRERFD--VVVCEGAGSPAETNLRATDVANFGLAE
COBQ_COREF       GDYIR----HRH-DLRGIAAAQLESLRERFD--IVVCEGAGSPAEINLRATDVANFGLAQ
COBQ_MYCPA       TSYVQ----HRD-RLAALVLNELTCLRDEFD--AVICEGAGSPAEINLRATDLANMGLAR
COBQ_NOCFA       ADYFR----HRT-ALREVVAAELASLRAEFD--VVLCEGAGSPAEINLRATDLANMGLAR
COBQ_MYCBO       SSWCA----GRR-ALAEAACRAFDALAARYD--VVVAEGAGSPAEINLRAGDYVNMGLAR
COBQ_MYCTU       SSWCA----GRR-ALAEAACRAFDALAARYD--VVVAEGAGSPAEINLRAGDYVNMGLAR
COBQ_STRAW       RGYHG----GRQEALLGTVLDCLAELRGTYD--AVICEGAGSPAEINLRRTDIVNMGIAR
COBQ_STRCO       RGYHG----GRQERLLGTVLDSLAELRGTYD--AVICEGAGSPAEINLRRTDIVNMGIAR
COBQ_CUTAK       GEYTT----GRR-YLAEAAWAAYDELAASHD--MVICEGAGSPAEINLRRGDYTNMGLAR
COBQ_DEIRA       LPWRE----RKP-RLWPFVKGALHSLLDEFD--VVVIEGAGSPAEVNLRPSDIVNMRVAR
COBQ_HALMA       RGYYD----EHWEDALETARAAHDRLAQSHD--VIVAEGAGSIAEINLHDRDLANIETAR
COBQ_HALSA       GSYYE----SHWADARDAAAAAHARLAADND--VVVAEGAGSIAELNLHDRDLANLETAR
COBQ_METJA       NEYRKN-----KDFFLKKIKESLEILDREYD--YVIMEGAGSCCEINLLKDDIANLRIAE
COBQ_METMP       NEYRSK-----KDDFLVKIKESIDYLDKNYD--YVVIEGAGSCCEINLLNDDIANLKVAE
COBQ_METTH       QDYQTEF----RDTALEAIRESLEYLKSRYE--LIVIEGAGSPAEINMRDRDLANMEIAH
COBQ_METKA       REYREIV----FEDPWQAVLESAEILSEEHE--VIVAEGAGSPAEINVLDTDIANLRVAE
COBQ_PYRFU       RDYMLSK----KIELFRKSMEVLKSLMKRHD--LVIIEGAGSPVEINLKDYDIANMRVAR
COBQ_THEKO       RDYMLSK----KAELFEKAIEVLKELMREHD--LVIIEGAGSPVEINLKDYDIANMRVAK
COBQ_METAC       GQYYD-S----IEEMNGVLEGALERLWKEHD--IIVMEGAGGAAEINLYERDVVNVGTAR
COBQ_METMA       GQYYD-S----IEEMHAVLKGALERLWKEHD--IIVMEGAGGAAEINLYERDIVNVGTAR
COBQ_ARCFU       RKYYGVK----VEWLKRVVEEAYLSLAEEYD--FVVIEGAGGMAEINLYERDLPNIHIAR
COBQ_PICTO       NDYYNYI----NKNAK-IIKESIDFLSNKYD--VIISEGAGSPAEINLAGRDFANIYVSS
COBQ_THEAC       PEYYEFI----MNDGKRVIREAIDRISDDYD--LIIAEGAGSPAEINLLDRDMANIYVSS
                   :                      :        :: **:*.  * *:   :  *.  : 

COBQ_NOSS1       YLNAPTLLVVDIDRGGAFAHVVGTLELLDPEERQLIKGVVINKFRGQRSLLDPGIKWLEE
COBQ_SYNY3       HLQAATILIADIDRGGVFAHVVGTLQLLEPEERKLIKGIVINKFRGQRSLLDSGITWLEE
COBQ_SYNP6       HLQAPTLLLVDIDRGGSFAHLIGTLELLDPDERSLIRGFVFNKFRGRRELLQSGLDWLEE
COBQ_THEEB       YLGAPTILVADIDRGGVFAHIVGTLMLLEPAERALIQGIVINKFRGQRSLLDSGLQWLEE
COBQ_GLOVI       HLGAPTLLVTDIDRGGALAHVVGTLQVLPPEERALIKGIVINKFRGSLALLQPGLDWLAQ
COBQ_PROMM       FLRARCLLVADIERGGVFAQIMGTLSLLKPVEKQLIRGLLINRFRGRRELFDEGRDWLEA
COBQ_SYNPX       YLRANCLLVADIERGGVFAQIVGTLALLRPVERPLIKGILINRFRGRRELFDEGRSWLEQ
COBQ_PROMA       HLNAKCVLVADIERGGVFAQIIGTLALLKPDEKALIQGIIINRFRGDISLFEKGRQWIEE
COBQ_PROMP       YLNANCILVTDIERGGVFAQIIGTLELMKPDERKLIKGILINRFRGDLSLFEEGKKWIEN
COBQ_ACIAD       HYQTKIILVADIEKGGVFASVWGTYNLLPADLRSNVIGVIINKFRGDLSLFDEGIRIIEQ
COBQ_CLOAB       LVDAPVVLVGDIDKGGVFASLFGTVMLLEENERKRIKGTIINKFRGDVEILKPGLSMLEE
COBQ_CLOTE       MVDAPVLLAGDIDRGGVFASLAGTMLLLTEEERNRVKGTIINKFRGDIEILKPGLKMLED
COBQ_CALS4       LVNAPVLLVGDIDRGGVFASIAGTMLLLDEKERNRVEGVIINKFRGDIEILKPGLKMLEN
COBQ_LISMF       MVDAPVVLVADIDKGGVFASIYGTIMLLNEEERARIKGVIINKFRGDVALLQPGIDMIEE
COBQ_LISMO       MVDAPVVLVADIDKGGVFASIYGTIMLLNEEERARIKGVIINKFRGDVALLQPGIDMIEE
COBQ_LISIN       MVDAPVVLVADIDKGGVFASIYGTIMLLKEEERARLKGVIINKFRGDVALLQPGIEMIEE
COBQ_SALTI       MAQCPVILVADIDRGGVFAAIYGTLALLHKQERDRVKGVIINKFRGDVALLYSGIEQIES
CBIP_SALTY       MAQCPVILVADIDRGGVFAAIYGTLALLHKQERDRVKGVIINKFRGDVALLYSGIEQIES
COBQ_PHOLL       MVDAPVLLVADIDRGGVFAAIYGTLALLRPAEKARVKGVIINKFRGDISLLQPGIEQIEA
COBQ_CLOPE       IADADVILVADINRGGVFASIVGTIMLLTEEERKRVKGVIINKFRGKREFFEPAMRQIEE
COBQ_DESVH       HAEAKVLLVGDIDRGGVFASLVGTMELLDPWERDLVAGFVLNKFRGDATLLSPAYDVVTG
COBDQ_LEPIN      YAKADVLLVGNIDHGGLFGSLLGTMETLTEWERKLVFGFIINRFRGAKELLKTGINYIEE
COBQ_BACFR       HAGADVILVADIDRGGVFASVYGSVMLLRPEERKHIKGILINKFRGDIRLFESGVKMLED
COBQ_CHLTE       RAGAAVILVADIDRGGVFAQVVGTLAVIPPEDRALVKGVIINRFRGDKSLFEGGVKMLES
COBQ_BACHD       LADVPVILVADIERGGVFASLYGTLELLQPNERKRVVGIIVNKFRGDPELFSSGVQWIEQ
COBQ_GEOKA       LANAPVVLIGDIERGGVFASLVGTLSLLEPEDRKRVIGVIINKFRGDVALLKPGLDWFEQ
COBQ_BRADU       KADVPVVLIGDIDRGGVIAQLVGIKTVIDPDDAAMIQGFVINKFRGDPTLFDDGYKLIEA
COBQ_RHOCA       AADVPVVLVGDIDRGGVIAQIVGTQAVLDPADAEMISGFLINKFRGDVTLFDDGYRLIGA
COBQ_AGRFC       AADAPVILIGDIDRGGVIASLVGTREVLDDDDAAMIEGFIVNRFRGDPALFSDGMRMIAE
COBQ_BRUME       HADVPVVLVGDIDRGGVIASLVGTHTILPQEDRAMVRGFLINKFRGDISLFDDSLAAITR
COBQ_BRUSU       HADVPVVLVGDIDRGGVIASLVGTHTILPQEDRAMVRGFLINKFRGDISLFDDGLAAITR
COBQ_RHILO       RADVPVVLVGDIDRGGVIASVAGTHLILPEEDRRMIVGYLINKFRGDVSLFDDGLKAIEK
COBQ_SINSX       RANVPVVLVGDIDRGGVIASLVGTHAILPEEDRRMVTGYLINKFRGDVTLFDDGIAAVNR
COBQ_RHIME       RADVPVVLVGDIDRGGVIASLVGTHAILPGDDRRMVTGYLINKFRGDVTLFDDGIASVRQ
COBQ_BURMA       AVDCPVVLVADIDRGGVFAHLVGTLACLSDSERARVRGFVINRFRGDPALLEPGLRWLEA
COBQ_BURPS       AVDCPVVLVADIDRGGVFAHLVGTLACLSDSERARVRGFVINRFRGDPALLEPGLRWLEA
COBQ_RALSO       AVDCPVVLVADIDRGGVFAHLVGTLACLSESERARVTGFVINRFRGDLSLLTPGLDWLTA
COBQ_PSEPK       AVDCPVILVADINRGGVFAHLVGTLELLSTTEQARVKGFVINRFRGDIALLQPGLDWLEQ
COBQ_PSESM       AVDCPVLLIADINRGGVFAHLVGTLELLSPSEQARVKGFIINRFRGDIALLQPGLDWLEA
COBQ_PSEAE       AVDCPVILVADIDRGGVFAHLVGTLELLSDSERERVKGFVINRFRGDIALLQPGLDWLEA
COBQ_XANAC       AVDCAVILVADIDRGGVFAHLVGTLALLSASERARVAGVVINRFRGDLALLQPGLEWLER
COBQ_CHRVO       AVDCPVILVADIERGGVFAHLAGTLALLSESERARVVGLVINRFRGDPSLLKTGVDWLER
COBQ_METCA       AVDCPVLLVADIDRGGVFAHLVGTLELLSASERERIRGFVINRFRGDMDLLRPGIEWLQR
COBQ_VIBVU       EADVPVIIVADIDRGGVFAHLYGTLALLSPSEQARVKGFVINRFRGDIKLLESGLDWLEE
COBQ_VIBVY       EADVPVIIVADIDRGGVFAHLYGTLALLSPSEQARVKGFVINRFRGDIKLLESGLDWLEE
COBQ_VIBPA       AADVPVIIVADIDRGGVFAHLYGTLALLSESEQTRVKGFVINRFRGDIRLLQSGLDWLEE
COBQ_VIBCH       KADVPVIIVADIDRGGVFAHLYGTLALLSESEQARVKGFVINRFRGDIGLLQSGLDWLEQ
COBQ_PHOPR       KADVPVIIIADIDRGGVFAHLYGTLALLSESEQARVIGFVINRFRGDIKLLESGLDWLEE
COBQ_SHEON       AVDCPVIIIADIDKGGVFAHLVGTLALLSESEQARVKGFVINRFRGDISLLQSGIDWLEA
COBQ_CORDI       ECDLPVYIVGDIDRGGVLAHFYGTHQIVDDADRARIKGFVVNKFRGDVSILEPGLQDLED
COBQ_COREF       AAQLAVYIVGDIDRGGVLAHLFGTHAIISDEDRALIRGFVINKFRGHQELLEPGLVQLEE
COBQ_MYCPA       AADLAVILVGDIDRGGLLAHLFGTVAVLDPQDQALIAGFVVNKFRGDPALLQPGLRRLHD
COBQ_NOCFA       AADLPVLVVGDIDRGGVLAHLFGTVAVLEPDDQRLIAGFVVNKFRGDVDLLRPGLDRLAE
COBQ_MYCBO       HAGLPTIVVGDIDRGGVFAAFLGTVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLER
COBQ_MYCTU       HAGLPTIVVGDIDRGGVFAAFLGTVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLER
COBQ_STRAW       NARLPVLVVGDIDRGGVFASFFGTVALLSREDQELVAGFLVNKFRGDVSLLEPGLDMLRN
COBQ_STRCO       GAGLPVLVVGDIDRGGVFASFFGTVALLAPEDQALVAGFLVNKFRGDVSLLEPGLDMLHG
COBQ_CUTAK       AKNLPVVLVGDIDRGGVLASLFGTWALLDDDDRALLAGYIVNKFRGDDAILAPGLEEITD
COBQ_DEIRA       EARAAVLLAADIDRGGAFAHLLGTWHCLMPEERALMRGFILNRFRGDASLLAPAPEWLEE
COBQ_HALMA       FADADILLVADIERGGVFASLVGTLELVPDDIRKQVAGAVITKFRGDQSLLDPGIDAFED
COBQ_HALSA       FADATILLVVDIERGGAFASLHGTLALLPDDIRDRVAGAVITKFRGDRSLLDPGITEIEA
COBQ_METJA       LVNAKAILVADIDRGGVFASIYGTIKLLPENWRKLIKGIIINKFRGNVEVLKEGIEKIEE
COBQ_METMP       IAGADAILVSDIDRGGVFASIYGTVQLLPENWKKLLKGFVINKFRGNIDVLKDGFEKIEE
COBQ_METTH       LADADVILVADIDRGGVFASIAGTLMLLDERDRSRIKGVVINKFRGNIDILMPGIERIEE
COBQ_METKA       ALGADVILVADISRGGAFAAVYGTIELLPERWRRLIKGFLFNKFLGDESLLEPGIKELER
COBQ_PYRFU       EVNAPVILVADIDRGGSFAQIVGTMELLSEEERNLVMGFVFNKFRGDPSLLYPGFKFLEK
COBQ_THEKO       AVNAPVILVADIDRGGSFAQIVGTMELLSEEERELVMGFIFNKFRGDASLLKPGFEFLEK
COBQ_METAC       LTQAPIILVGDIERGGVFASLYGTVALLPEDVKKNVKGFIINKFRGDPEILKPGLKQLEE
COBQ_METMA       LTKAPIILVGDIERGGVFASLYGTIALLPEDVRKNVKGFIINKFRGDIEILRPGLKQLED
COBQ_ARCFU       FARPDILIVGDIDRGGVFASLYGTYALLPDDVKPLVKGFVINRLRGREDVLESGIRELER
COBQ_PICTO       LYNTPAILVADIDRGGVFASIYGTINLMQRS--DLLKYYIINKMRGDQSLLYPGIERIEE
COBQ_THEAC       IYNTPAILVGDIDRGGVFASIYGTLSLMPRP--DLVRWIMINKMRGDASLLEPGLKKLEN
                        :  :*.:** :. . *    :       :   :..:: *   .:  .   .  

COBQ_NOSS1       RTGIPVVGVIPYLQEVFPAEDSLDLLERKTHKA-----------HADLQITVVRLPRIAN
COBQ_SYNY3       YTGIPVLGVIPYGQNLFSAEDSLDILERSGRPS-----------KEDIRIVVLRLPRIAN
COBQ_SYNP6       RTGIPVLGVIPWIDRAFPSEDSLDLMERRRRKT-----------QAEVTIAVIRLPRIAN
COBQ_THEEB       TTGVPVLGVIPWLERHYAAEDSLDLWDPRPQRQ-----------GADLKITVIRLPRIAN
COBQ_GLOVI       YTGVPVVGVLPWLEMALPEEDSMGLFDRRGARK-----------QAQLEIVVIRLPRIAN
COBQ_PROMM       ETGIPVIGVMPWLEELFPPEDSLDLLERRGKKN-----------DAEIEIAVLKLPSLSN
COBQ_SYNPX       HTGVPVLGVMPWLNDLFPPEDSLDLLERKPNRG-----------PTDLEIAVLKLPSISN
COBQ_PROMA       ESKIPVLGIMPWLNEIFPPEDSLDLLERKHKKT-----------KAEIQIAVIKLPSLSN
COBQ_PROMP       KTKIPVLGIIPWLDDKFPPEDSLDLLEKKSSLT-----------NPELKVGIIKLPSISN
COBQ_ACIAD       AFKIPVLGVLPYMPFNLGFEDNASLQNFVQQPR-----------QKKLKIGVIAYPYMSN
COBQ_CLOAB       RINIPCFGVVPYF-NLSLEDEDG----AVY---------FNTKVNSKIDVAVIKLPHISN
COBQ_CLOTE       IIKIPTVGVVPYL-KFQLEDEDG----AID---------FNRNINAPIDIAVIKLPRISN
COBQ_CALS4       IIQKEVLGVIPYM-DVHIDEEDG----ATDR-------FYTKCAQGEVDVAIINLPHISN
COBQ_LISMF       LTNVPVIGVIPYA-NLQLEEEDS----VSLSG-----KNYVPDSNALLDIAIICLPRISN
COBQ_LISMO       LTNVPVIGVIPYA-NLQLEEEDS----VSLNG-----KNYAPDSNALLDIAIICLPRISN
COBQ_LISIN       LTNVPVIGVIPYA-NLQLEEEDS----VSLSG-----KNYVLDSSALLDIAIICLPRISN
COBQ_SALTI       LTGVPVLGVMPWL-DVDLEDEDG----VALQN-----DKYRGNAPRDITIAIVQLPHISN
CBIP_SALTY       LTGVPVLGVMPWL-DVDLEDEDG----VALQN-----DKYRGNAPRDITIAIVQLPHISN
COBQ_PHOLL       LTGVPVLGVMPWL-DIDLEDEDG----VALQT-----GKYDGATEKALDITVIRLPHIAN
COBQ_CLOPE       IIKIPVLGVMPYF-DLDIEEEDS----ASIK--------LRKGNGKGIDIAIVRLPHMSN
COBQ_DESVH       RTGKPFLGVVPWLHDLGLPDEDS----VSFRETLAGRAPDVPAGGGMLDIVLVDLPHISN
COBDQ_LEPIN      YTNKPILGIVPYIKNLKLPEEDS----LEFK---SGALDDTSKLEERLDVVLIDIPRISN
COBQ_BACFR       LCGVPVVGVVPYYKDIYIEEEDS----VMLQTKNI---RAGQ---GKVNVAVVLLRHLSN
COBQ_CHLTE       MTGVPVLGVIPYFRGFTIDAEDA----VPLSSVVD---PKQEPSGDKIGVAAIYFPHISN
COBQ_BACHD       HLGVPVLGVLPHLPGVRIEGEDS----LSKGQ-----VTSVLPRDQSIDIAVLDLPYLSN
COBQ_GEOKA       HTGVPVLGVVPYLPDLAIDAEDS----LSLER-----FASSVGGEEAIDVAVIRCPKIAN
COBQ_BRADU       KTAWRGFGVLPWFARAGELPAED----ALGLSDARK--------PGQCKIACLALSRIAN
COBQ_RHOCA       RTGWRGFGTLPWFPLAHKLPAED----ALDIASGPA--------TGGTVIACLTLSRIAN
COBQ_AGRFC       KTDWSSIGLLPHFSDAAKLPAED----ALGLSGPAQRK-----PSAKIRIAVPILPHISN
COBQ_BRUME       FTGWRSFGVVPWLKAVSRLPAED----SVVLERAVRGD------KKALIVAVPMLPRIAN
COBQ_BRUSU       FTGWRSFGVVPWLKAVSRLPAED----SVVLERAVRGD------KKALIVAVPMLPRIAN
COBQ_RHILO       FTGWRCFGVVPWLKAAARLPSED----SVVLERLASGE------ARALKVAVPVLGRIAN
COBQ_SINSX       YTGWPCFGVVPWLKAAARLPAED----SVVLEKLTRGE------GRALKVAVPVLSRIAN
COBQ_RHIME       FTGWPCFGVVPWLKSAGRLPAED----SVVLERLTRGG------GKALKVAVPVLSRIAN
COBQ_BURMA       RTGKPVLGVLPYLHGL-TLDAEDMLPASARTSAARRDA-------GVLRIVVPALPRISN
COBQ_BURPS       RTGKPVLGVLPYLHGL-TLDAEDMLPASARTSAARRDA-------GVLRIVVPALPRISN
COBQ_RALSO       QTGKPVFGVLPYLQGL-HLDAED----AVQTAQSAASG-------EVLRVVIPVLPRISN
COBQ_PSEPK       RTGKPVLGVLPYVTDL-HLEAED----GIDVRQGVKHE-------RVLKVIVPVLPRISN
COBQ_PSESM       RTGKPVVGVLPYVMDL-HLEAED----GLDQRQTDKVE-------QVLNVVVPVLPRISN
COBQ_PSEAE       RTGKPVLGVLPYVSDL-HLEAED----AIDTRQAAKVG-------PRLKVVVPVLPRISN
COBQ_XANAC       ETGKPVLGVLPYLHGL-QLDAED----AVPRNAPQKPQ-------SQLRVVVPVLPRISN
COBQ_CHRVO       HTGKPVLGVLPYLYDL-HLEAEDSM-GLDKPGGAVGGG-------DKLRVAAPAAPRVSN
COBQ_METCA       RTGKPVVGVLPHLDGL-YLDAEDAV-VTKSRPAAPGQD-------TRLKVIAPRLPRISN
COBQ_VIBVU       KTGKPVIGVLPFLHGL-NLEAED----AITSQQELSGE-------VKLKVVVPVLTRISN
COBQ_VIBVY       KTGKPVIGVLPFLHGL-NLEAED----AITSQQALSDE-------VKLKVVVPVLTRISN
COBQ_VIBPA       KTGKPVLGVLPYLHGL-NLEAED----AITAQQELNSE-------VKLNVVVPVLTRISN
COBQ_VIBCH       KTGKPVIGVLPYLHGF-DLEAED----AIAAQQNLSAD-------RQLRVAVPVFTRISN
COBQ_PHOPR       KTGKPVLGVLPYLHGL-MLEAED----AINVQQVEAAD-------EQLNVVVPVLTRVSN
COBQ_SHEON       YTQKPVLGVLPYLHDL-HLDAED----ALTDSPTKQAK-------SCFKVRVLVYPRTSN
COBQ_CORDI       RLGVPTVAVLPFIHGL-WIDAEDSLQSTIGATVGPAA--APLG-TQRLRVAAIRLPRVSN
COBQ_COREF       LTGVETKAVIPFIDDI-WIDAEDSLQSPVGRMVGPGGR-HPLG-TQRLSVAAIRLPRMLG
COBQ_MYCPA       ITGRPTYGVLPYADRL-WLDAEDSLSVLAHRVVGAPD--PPLG-DDWLRVAAVRLPRISN
COBQ_NOCFA       LTGRPTLGVLPFAEEL-WLDAEDSLGTVADAPVGRPR--PPVG-TEWLTVAAVRLPRISN
COBQ_MYCBO       VTGRRVYGTLPWHPDL-WLDSEDALDLQGR---------RAAG-TGARRVAVVRLPRISN
COBQ_MYCTU       VTGRRVYGTLPWHPDL-WLDSEDALDLQGR---------RAAG-TGARRVAVVRLPRISN
COBQ_STRAW       LTGRPSYGVLPFQHGL-GIDEEDGLRVSLRGSVRESAVSSPVG-EDILRVAVCAIPLMSN
COBQ_STRCO       LTGRRTYGVLPFRHGL-GIDEEDGLRVSLRGTVRESVVAPPVG-EDVLRVAVCAVPLMSN
COBQ_CUTAK       RTGMPSFGVLPWVPGV-WLDGEDALEVGRWRHE-----GDAVD-PSSLRVAVVRFPRISN
COBQ_DEIRA       QTGVPTLGVVPWLNVA-LPE-EDGVAVEAPAAIIP-------S-PSTGFVAIPRLPRVSN
COBQ_HALMA       RTGVPVLGVLPHDDPG--LPEEDSVALPPVGERSVVGDDDAVPDAESVTVAVPRLPRISN
COBQ_HALSA       RTGVPVLGVIPHDDPG--LPAEDSVSLPDPSERVVDGGQDGVPDAASVTVAVPHLPHISN
COBQ_METJA       LTGIPVLGIVPYDENLVLPEEDSQVLQSMRSFGNA---------KSGVEINVVRFSKISN
COBQ_METMP       LTNIPVIGTIPYDETLVLPEEDSQALDGKRVFGNL---------KSPIEVNVVKFSKIAN
COBQ_METTH       ITGVPVLGVLPYDEGLKLPEEDSASLSQRKYRG-----------RGDIRVGVMRLPRISN
COBQ_METKA       RLGVRYLGTVRHVGDFWMPWEDSEALDT-HSPG-----------RGSVRIAVIRLPRISN
COBQ_PYRFU       KYGKPVLGVVPYIDH-RLPEEDS-----LAEFPRA---------KGEVHIQIIKLPHISN
COBQ_THEKO       RCGKPVLGVVPYIEH-RLPEEDS-----LAEFPKV---------RGDLHIQIIKLPHISN
COBQ_METAC       ITGIPVLGVLPHFKL-RIPSEDSVSLGDKEGAKN----------EKEVEIAVIRLPRISN
COBQ_METMA       KTGIPVLGVLPHFKL-RIPSEDSVSLGDKEDSKA----------EKEIEVAVIRLPRISN
COBQ_ARCFU       LTGIRVLGVLPYLDY-NFPSEDSLNIEEWGA---------------EGTVGIVRLPRVSN
COBQ_PICTO       LTGKKCLGIVPYIDL-KLPGEDSLDYNFSGS---------------GS-IGIVRYPYMEN
COBQ_THEAC       LTGKRVIGVVPYSEN-RLPGEDSFDYDHPRAR--------------GSKITIVRYPFMEN
                        . :           .                           :         .

COBQ_NOSS1       FTDFDPLESEPTVAVKYIS-------PKQDLGHPDAVILPGTKTTIADLILLQKTGMAEA
COBQ_SYNY3       FTDFEPLEAESGVYVDYLP-------LEKQLGNPDAVIIPGSKTTIADLQALQNSGMAQQ
COBQ_SYNP6       FTDFDPLESEPSVQVRYVG-------LQDELGYPDAVILPGSKTTISDLLDLQRSGLAQA
COBQ_THEEB       FTDIDPLLAEPSVAVEFLP-------PHRPLGRPDAVILPGTKTTIADLQVLRETGMAEQ
COBQ_GLOVI       FTDFDALEAEPSVRVRYVS-------PDGYLGHPDAIILPGSKATIPDLLALEASGMAAQ
COBQ_PROMM       FSDLDPLEAEPTVQLRWVE-------PGTFLGMPDAVIIPGSKQTLRDLNSLNRSGLGSQ
COBQ_SYNPX       FSDLDPLEAEPSLRLRWVH-------PGDSLGSPDAVLLPGSKQTLRDLETLRSSGLDRQ
COBQ_PROMA       FADLDPLEAEPTIQLNWIQ-------PGDYLGNPNAVIIPGSKQTLKDLQSLQSSGLGNQ
COBQ_PROMP       FSDFDPLENEESILIKWVM-------ESQNLNQYDFLIIPGSKQTIKDQKFLRDSGLSED
COBQ_ACIAD       YNDFEPLIADDEVLLEFIN-------SPISLEHFDGVILPGSKLVIEDLHWLKTNGLFEQ
COBQ_CLOAB       FTDIDALKIEEDVSLRYIT-------SSENFGTPDLLIIPGSKNTIGDLLYIRKNGIENK
COBQ_CLOTE       FTDFDALKVEEDVSIRYIT-------SKEDFGKPDLLIVPGSKNTIEDLLALRKCGLEEK
COBQ_CALS4       FTDFDPLTKVPGVKIKYVN-------KGERIGDCDVLIIPGTKNTIGDLKVLKDYGLDKE
COBQ_LISMF       FTDFHSLEIQPEISLRYIR-------NLADFGKPDLVIIPGSKNTLEDMAFLEESGLKKA
COBQ_LISMO       FTDFHSLEIQPEISLRYIR-------NLADFGKPDLVIIPGSKNTLEDMAFLEESGLKKA
COBQ_LISIN       FTDFHILEIQPDISVRYIR-------NLADFGNPDLVIIPGSKNTLEDMAFLEQSGLKKA
COBQ_SALTI       FTDFNALAAQPDVRIRYIR-------RPEALTDADLVILPGSKNTLSDLAWLRESGMADA
CBIP_SALTY       FTDFNALAAQPDVRIRYIR-------RPEALTDVDLVILPGSKNTLSDLAWLRESGMADA
COBQ_PHOLL       FTDFNALAVQPDVRLRYVT-------QPSALQPSDLIILPGSKNTLGDLQWLRQNGLADA
COBQ_CLOPE       FTDFNSLGRIKDVGIRYAE-------NPKDLENANMIIIPGSKNTIDDLIYLKESGFKEA
COBQ_DESVH       FTDLDALRREPDVAVRVVR-------SPEQLGSPDAIILPGSKNTLGDLAALRSRGMAEA
COBDQ_LEPIN      HTDIDALRAEPDVRVRIVR-------TVEDLGEPDVLILPGSKNVISDLNHLYDVGLVNK
COBQ_BACFR       FTDFNVLERDPRVHLFYTN-------NTDELMKADIILLPGSKSTLSDLYELRRNGVAQA
COBQ_CHLTE       FTDLAPLERDPSVELHYLH-------RPKSLDGYKALILPGSKNVRGDLAWLETMGWRDE
COBQ_BACHD       YTDLEPFRYEEDVAIRFVS-------SVDALGRPDAIILPGTKSTFHDLQILKEKGFKER
COBQ_GEOKA       FTDIDPLLAEPDCRVRLVT-------HGDELGAPDVIVLPGSKNTIEDLIYMKKRGLASR
COBQ_BRADU       FDDLDPLKLEAAVDLVMVR------PGEAIPGDVRLVIIPGSKSTRGDLAFLRAQGWDID
COBQ_RHOCA       FDDLDPLAAEPGVRMVMVQ------PGQPIPAEARLVILPGSKSTRGDLAFLREQGWDID
COBQ_AGRFC       FDDLDPLDMEPDVELIRVR------PGETIPADCRLVLLCGSKSTIADLAVLKDAGLDID
COBQ_BRUME       FDDLDPLKAEPAVEVVMVP------PGSSLPADAGLVVLPGTKSTIADLLALRENGWDRE
COBQ_BRUSU       FDDLDPLKAEPAVEVVMVP------PGSSLPADAGLVVLPGTKSTIADLLALRENGWDRE
COBQ_RHILO       FDDLDPLKAEPQVEVVFVP------PGKPLPSDAGLVVIPGSKSTIGDLIRFRENGWDRD
COBQ_SINSX       FDDLDPLAAEPEIDLVFVR------PGSPIPVDAGLVVIPGSKSTIGDLIDFRAQGWDRD
COBQ_RHIME       FDDLDPLAAEPDVDIVFVR------PGTPLPDDAGLIVIPGSKSTIADLDDFRRQGWDRD
COBQ_BURMA       HTDFDALRAHPRVDFTYWK------RG-PVPD-ADLLILPGSKNVLADLAWLRDAGWDAL
COBQ_BURPS       HTDFDALRAHPRVDFTYWR------RG-PVPD-ADLLILPGSKNVLADLAWLRDAGWDAL
COBQ_RALSO       HTDFDALRAHPQVDVRMVG------PGRPIPP-ADLVILPGSKSVQADLAWLRAHGWDAA
COBQ_PSEPK       HTDFDPLRLHPQVDLQFIG------PGQPIPA-ADLIILPGSKSVRGDLAQLRERGWDKA
COBQ_PSESM       HTDFDPLRLHPQVNLQFIG------PGQPIPP-ADLIILPGSKSVRSDLNYLRANGWETA
COBQ_PSEAE       HTDFDPLRLHPQVELSFVG------PGQALPS-ADLIVLPGSKSVRADLAALRERGWDEA
COBQ_XANAC       HTDIDALLAHPQVDVRLIG------PGQTPPP-CDLILLPGSKSTRHDLQWLRTHGWDAA
COBQ_CHRVO       HTDFDPLRLHPQVEFTLVR------AGQAIPP-ADLIVLPGSKNVLADLAWLRAQGWDEA
COBQ_METCA       HTDFDALRLHPQVDFRFIG------TGAPPPP-ADLVILPGSKSVRADLAWLREAGWEGA
COBQ_VIBVU       HTDFDVLRLHPQIDLRYVG------KGERLEH-ADLIILPGSKSVRDDLRYLREQGWDKD
COBQ_VIBVY       HTDFDVLRLHPQIDLRYVG------KGERLEH-ADLIILPGSKSVRDDLRYLREQGWDKD
COBQ_VIBPA       HTDFDVLRLNPDINLSYVG------KGEKIDK-ADLIILPGTKSVRDDLAYLKSQGWDKD
COBQ_VIBCH       HTDFDPLRLNPNIDFRYVG------QGESLSG-ADLIILPGSKSTRADLAYLRSQGWDKE
COBQ_PHOPR       HTDFDPLRMHPQVNLQFVG------KGQPIPP-TDLIIIPGTKSVRSDLAFLREQGWDKQ
COBQ_SHEON       HTDVDPLRLHPDIDFDYVSLQTQALAQTPEIA-ADLLILPGSKNVRADLAFLREQGWDKQ
COBQ_CORDI       ATDVEALACEPGVTVTWTV-------DPDSVAEADLVVIPGSKATLSDLAWLRSTGVADA
COBQ_COREF       VTDVEALAVEPGVTVTWVD-------DVDAVWDSDLVIIPGTTATVADLAWLRHRGLDRA
COBQ_MYCPA       STDVEALACEPGVLVRWVS-------EPSDVADADLVVIPGSKATVADLSWLRERGLAAA
COBQ_NOCFA       STDVEALACEPGVAVRWVS-------EPSRLADADLVVVPGSKSTVSDLAWLRRTGLGEA
COBQ_MYCBO       FTDVDALGLEPDLDVVFAS-------DPRALDDADLIVLPGTRATIADLAWLRARDLDRA
COBQ_MYCTU       FTDVDALGLEPDLDVVFAS-------DPRALDDADLIVLPGTRATIADLAWLRARDLDRA
COBQ_STRAW       FTDVDALAAEPGVVVRFVD-------RPEELADADLVVIPGTRGTVKALEWLRERGLAEA
COBQ_STRCO       FTDVDALAAEPGVVVRFVD-------RPEELADADLVIVPGTRGTVRALEWLRERGLADA
COBQ_CUTAK       ATDVDAMAGETGVDVQVTT-------NPDTCQAADVLVLPGSRSTVSDLEWLRRSGIADV
COBQ_DEIRA       LDEFAPL----GELARWVT-------SPQELAGARAVILPGSKSTAADLAWLRATGLAGA
COBQ_HALMA       FTDLQPLAHEPGVRVAYIP-------PDAALDDADAVVLPGSKNTVDDLRALTDAGFGDR
COBQ_HALSA       FTDLAPLARTPGVRVAYQP-------LDAPLAAADAVVLPGTKNTVDDLRAAREAGLGRA
COBQ_METJA       FTDLDPLRY--DAFIKFIDFD------DDITG--DILIFPGTRSSTKEAYYLKQHNFDEK
COBQ_METMP       FTDVDPFSS--DCLMKYIDFN------ENITG--DILILPGTRCSTVEMDLMKKYGMDKK
COBQ_METTH       FTDIDPLEYEEDVAVRLIETG------DSLDDL-DAIIIPGTRNTISDLIHLEENGFADE
COBQ_METKA       FTDFEPLAMEPDVRVEFVDPR------DNLPEDADAVILPGTRTTISDLEELRKRGMDEE
COBQ_PYRFU       FTDFEPLHW--ANGVDYVTKA------EEIKG--DIIIIPGSKNTVEDLIWMRENGIEDA
COBQ_THEKO       FTDFEPLHW--ANGVDYVTRA------EEIKG--DLIIVPGSKNTVEDLLWMRENGIEDA
COBQ_METAC       FTDFEPLEGLVKVHYVDIDE---------DLGNPDAIMIPGTKNTINDLLDLRASGMDKK
COBQ_METMA       FTDFEPLEGLVKVRYVDINE---------ELGNPDAIMIPGTKNTVNDLLDLRASGMDKK
COBQ_ARCFU       FTDFEPLRE--HARFLSLNS---------SLNGCEVVIIPGSKDTIADLKALKSSKLGEE
COBQ_PICTO       YSDFDPLIFNEKAFYIKNKE---------DLKRCDVIILPGSKDVFHDLEYINSNGIADS
COBQ_THEAC       YSDLDPLVYTSTGYNYVTAEN------ASDLSDADLIVLPGSKNVFADLEYMRKNGIDKI
                   :.  :                             ::. *:                  

COBQ_NOSS1       IQNYAASGG-----TVLGICGGYQILGQMIADPEGIEGQ-----AGRYQGLNLLPIRTVI
COBQ_SYNY3       IMDYAQAGG-----TVMGICGGYQMLGQTIADPENIEGN-----VSNCQGLGLLPLTTVI
COBQ_SYNP6       IRDYAAAGG-----TVLGICGGFQMMGQHILDLEGTEGI-----EGQFEGLHLFPTQTWF
COBQ_THEEB       LKTYAAQGG-----TILGICGGWQMLGTAISDPLGLEGC-----PGTYEGLGLMPLHTQL
COBQ_GLOVI       IRAY---GG-----VILGICGGLQILGSTIDDPEGFEGH-----PGRHPGLGLIEATTVF
COBQ_PROMM       LQTYAQSGG-----HVFGICGGMQMLGRTLADPLGLEGVTTTDPSSSMAGLNLLPLDTVF
COBQ_SYNPX       LTAYATNGG-----SLLAICGGMQLLGQELHDPEQLEG---GDGAGPWPGLGLLPLTTEF
COBQ_PROMA       IKEFASSGG-----TVFGICGGLQILGEKLEDPLGIEQSFLETSISELEGLSLIPIKTIF
COBQ_PROMP       IKNYSTNKG-----NIFGICGGLQMLGTILEDPFFKEGS-KINCEKSINGIGLLPLKTTF
COBQ_ACIAD       LQQR---RK-----PIFAICGGYEMLFEQLHDPERIENL----EPTTATGLGLIDDEIYF
COBQ_CLOAB       IKQYAEKNG-----LIFGICGGYQMLGRLIEDPFKVETELG-----EINGMGLLDIRTVF
COBQ_CLOTE       IKEYS-KTG-----TIIGICGGYQMLGKTLKDPYKVESEEL-----ETQGMGLLNVDTVF
COBQ_CALS4       ILNLREKGK-----FIVGICGGFQMLGKVIKDPYHIESDTE-----EMEGLGLLSIETVI
COBQ_LISMF       IQNFAENAG-----KVIGICGGYQMLGKKMLDPNQVESKQL-----EIAGLGLLDTETIF
COBQ_LISMO       IQNFAENAG-----KVIGICGGYQMLGQKMLDPDQVESKQL-----EIAGLGLLDTETIF
COBQ_LISIN       IQNYAENAG-----KVIGICGGYQMLGKRMLDPNQVESEKV-----EIAGLGLLDTETIF
COBQ_SALTI       VLQTHRQGV-----PVMGICGGYQMLGDTIVD--EVESGLG-----TQPGLGLLNTITRF
CBIP_SALTY       VLQTHRQGV-----PVMGICGGYQMLGDTIVD--EVESGLG-----TQPGLGLLNTITRF
COBQ_PHOLL       LLTAHQAGV-----PVIGICGGYQMLGKRIID--GVESGIE-----QMDGLGLLDMETRF
COBQ_CLOPE       LINESSNGK-----LIFGICGGYQILGEKIIDSLGVEGDIR-----EEEGLGLLNIVTSF
COBQ_DESVH       LCALRSAEGGHLGPVIVGICGGFQMMGRFLADPQGVESDHA----CTEAGLGLLPVTTEM
COBDQ_LEPIN      IFALSRNQ----KTDIVGICGGYQMLGKNIFDPYRIESDQG-----SIQGISLLQIETIL
COBQ_BACFR       IVRAHREGA-----TVMGICGGYQLMGREVCDPDHVEGEIE-----RLPGLGLLPVSTRM
COBQ_CHLTE       IEKFRKRGG-----IIVGLCGGYQMLGASIADPYGVEGAPG-----ASAGLAMLPVETVL
COBQ_BACHD       LHEYVTT-D----GTVVAICGGFQMLGHRLIDVAGSDTGIKG--A-TIDGLDLAPVETRF
COBQ_GEOKA       IVSLVNEGK----ARVVGLCGGYQMLGAVIRDPYGVETPL----P-EVKGLGLLPIETTL
COBQ_BRADU       LLAHYRRGG-----HVLGLCGGYQMLGRSVADPDGIEGPAG-----DTPGLGLLDVQTVM
COBQ_RHOCA       LAAHVRRGG-----HVLGICGGYQMLGRSVADPEGIEGPAG-----TTPGLGLLDVETVM
COBQ_AGRFC       IKAHVRRGG-----YVLGLCGGYQMLGKTVADPDGIEGPPA-----TVEGLGLLDVDTVL
COBQ_BRUME       LVAHVKRGG-----HVLGICGGFQMLGRRISDPAGIEGNVR-----DIEGLGLLDIETMT
COBQ_BRUSU       LVAHVKRGG-----HVLGICGGFQMLGRRISDPAGIEGNVR-----DIEGLGLLDIETMM
COBQ_RHILO       LATHRKRGG-----HVVGICGGFQMLGRRVRDPDGIEGSVT-----EAEGLGLLDIETMM
COBQ_SINSX       LERHVRRGG-----RVIGICGGYQMLGRRVTDPLGIEGGER-----AVEGLGLLEVETEM
COBQ_RHIME       LDRHMRRGG-----RVVGICGGYQMLGSRVADPLGIEGGKR-----EIEGLGLLSVETEM
COBQ_BURMA       IKRHLRYGG-----KVIGICGGMQMLGRTLADPHGVEGAAGA----TSAGLGLLDYATTL
COBQ_BURPS       IKRHLRYGG-----KVIGICGGMQMLGRTLADPHGVEGAAGA----TSAGLGLLDYATTL
COBQ_RALSO       IARHLRYGG-----KLIGICGGMQMLGRRLRDPLGLEGRPG-----SLDGLGYLDFETTL
COBQ_PSEPK       IERHLRYGG-----KLIGICGGLQMLGREVHDPLGLEGAAG-----SSQGLGLLDYATVL
COBQ_PSESM       IDRHLRYGG-----KLMGICGGLQMLGEHLHDPLGLEGAAG-----SSAGLGLLAMSTVL
COBQ_PSEAE       ILRHLRYGG-----RLLGICGGLQMLGERLHDPLGLEGAAG-----SSAGLGLLALETTL
COBQ_XANAC       IARHLRYGG-----KLLGICGGLQMLGTHLHDPDGIEGAAG-----SSPGLGWLPLQTTL
COBQ_CHRVO       LRRHLRYGG-----KVLGICGGLQMLGKKLHDPDGLEGEPG-----SGDGLGWLDMETTL
COBQ_METCA       IRRHLRYGG-----KLLGLCGGFQMLGQAIHDPAGLEGPPG-----SSPGLGLLDFETTL
COBQ_VIBVU       ILRHLRFGG-----KVLGICGGYQMLGESISDPFGVEGEPG-----ESVGLGLLKTRTEL
COBQ_VIBVY       ILRHLRFGG-----KVLGICGGYQMLGESIRDPFGVEGEPG-----ESVGLGLLKTRTEL
COBQ_VIBPA       ILRHIRLGG-----KVMGICGGYQMLGKTIDDPDGVEGEPG-----SSEGLGLLNVHTVL
COBQ_VIBCH       ILRHLRLGG-----KVMGICGGFQMLGEWVHDPLGIEGEAG-----SSEGLGLFAMQTEL
COBQ_PHOPR       IERHLRLGG-----KVMGICGGYQMLGESIADPDGIEGDAG-----ESQGLGYLQTSTIL
COBQ_SHEON       IAKHLRYGG-----KVLGICGGYQMLGERIADPLAIEDVFG-----TSQGLGYLPISTEF
COBQ_CORDI       IMERARSQR-----PILGICGGFQMMCSHIDDP--VESGST----TPVEGLGIFDVDIEF
COBQ_COREF       LGERATRGM-----PILGIGGGYQMMATTITD----EGDSP----SSVAGLALFDVHIAL
COBQ_MYCPA       ITAHAAAGR-----PVLGICGGFQMLCRRIDDR--VESGA-----GEVAGLGLLDADIAF
COBQ_NOCFA       LRARVTAGR-----PVLAICGGYQMLGRRIVDE--VESGA-----GEVAGLGVFDLETEF
COBQ_MYCBO       LLVHVAAGK-----PLLGICGGFQMLGRVIRDPYGIEGPGGQ-V-TEVEGLGLLDVETAF
COBQ_MYCTU       LLVHVAAGK-----PLLGICGGFQMLGRVIRDPYGIEGPGGQ-V-TEVEGLGLLDVETAF
COBQ_STRAW       LRRRAAAGR-----PVLGICGGFQVLGEHIED--DVESRRG-----HVEGLGLLPVRVRF
COBQ_STRCO       IARRAAERR-----PVLGICGGYQLLGEHIED--EVESRAG-----HVDGLGLLPVRVRF
COBQ_CUTAK       VARRAEQGR-----TVVGICGGYQMLCRTILDPDGQETTPG----SVVEGLGLLPVEVDF
COBQ_DEIRA       VTRLAVQGV-----PVLGICGGLQMLGQTLSDPQGVEGGSAA-SGGKVYGLGLLDLHTAF
COBQ_HALMA       LRSF---DG-----PVVGLCGGYQMLGEAITNATIEGTGDA----DRVEGLGLLPVTTEF
COBQ_HALSA       LRAF---DG-----PIVGLCGGYQMLGDRITDAATESTADDL---GAVDGVGVLPVETAF
COBQ_METJA       VLEFLKDGG-----IVIGICGGYQVLGKELIDKEKKESDVG-----DIEGLKIFDAKTYF
COBQ_METMP       ILEFVENGG-----IVLGICGGYQALGKMLFDEDFSEGDVG-----TISGLGLFDMETTF
COBQ_METTH       IRDLSREI------PVFGICGGFQMLGKRILDDARQESSEG-----SVDGLGLLDCETHF
COBQ_METKA       VVQAADEGT-----VVLGVCGGYQMLGRELVDESGGELDPGE----SVPGLGLLDAVTVF
COBQ_PYRFU       IIEAHREGS-----FIVGICGGFQMLGEKIIDNV--ESKRG-----EVKGIGLLPAKTIF
COBQ_THEKO       IIEAHREGS-----FVVGICGGFQMLGKEIIDEV--ESKRG-----RVEGIGLLPAKTVF
COBQ_METAC       IQAFKGKI------PIFGICGGYQMLGRTIFDSG-VENGVEA----EFEGLRLLDIGTKF
COBQ_METMA       IQAFKGKV------PIFGICGGYQMLGRTIFDSG-VENGVEA----EFEGLGLLDIGTRF
COBQ_ARCFU       IVRKAGEI------PVIGICGGYQIMCRELVDMG-VEHG-RI----RAKGLGLLDAVTEF
COBQ_PICTO       IKRCSGEK------MIIGICGGYQMLGKRINDAS-GVESDGV----SIPGLGLLDIETYY
COBQ_THEAC       IIENAGRA------KILGICGGYQMLGQRIT-------MGEI----SADGLGLLRAKTNY
                 :              :..: ** : :   :                   *:         

COBQ_NOSS1       TGQKIARQRQVSSNFPQ-------------------------QGLPVNGFEIHQGRSRVE
COBQ_SYNY3       NQEKITRQCQTITHAPP-------------------------SGLTVTGYEIHQGLSRRS
COBQ_SYNP6       TAEKTLRQRQTTARSPQ-------------------------AGLPITGYEIHQGQTRLD
COBQ_THEEB       GPTKCTQQQQTQSLYFN-------------------------CPEPILGYEIHQGQSEYT
COBQ_GLOVI       EPLKITRQVQVESRLP--------------------------AGEPVVGYEIHQGQTTFA
COBQ_PROMM       KRNKALSQCQRITQWP--------------------------DNAKVKGFELHHGNSQLI
COBQ_SYNPX       GGTKALRQREVQALWP--------------------------GTTPISGFELHHGST---
COBQ_PROMA       HSKKSLTKKDVISKWP--------------------------DESRIMGFELHHGESTPT
COBQ_PROMP       FQKKITRQINSESIWP--------------------------QVTEINGFEIHNGVTELD
COBQ_ACIAD       AKNKILNKAE----YPI-------------------------FGLNIAGFEMHHGISQKY
COBQ_CLOAB       AEKKVTTRVQGSVIDKQIP---------------------------VYGYEIHMGISSYG
COBQ_CLOTE       EKEKVTTRVKAN--SEDTE---------------------------VYGYEIHMGICNYK
COBQ_CALS4       EREKTTSETKAFLGEELPDT------------------LSSLKGLFVTGYEIHMGESYIL
COBQ_LISMF       LDQKRTTQITGVTHS----------------------------GEAVEGYEIHMGETKRG
COBQ_LISMO       LDQKRTTQITGVTHS----------------------------GEAVEGYEIHMGETKRG
COBQ_LISIN       LDQKRTTQITGVTFS----------------------------SEPVEGYEIHMGQTKRG
COBQ_SALTI       AQDKTTTQVNATMSGELPGW------------------LAAAAGLPVRGYEIHMGETVLQ
CBIP_SALTY       AQDKTTTQVNATMSGELPGW------------------LAAAAGLPVRGYEIHMGETVLQ
COBQ_PHOLL       AHEKVTTRVNGNCLLALPGL------------------LSECVEQPIRGYEIHMGSSLLG
COBQ_CLOPE       NKEKTTKQVVAFDLE----------------------------GNEVSGYEIHNGES--V
COBQ_DESVH       GSAKVLRRTSAKTVSGWCGAGVAAGLMPGTGGGHGGAEVCPGEGYAVHGYEIHHGVTTPD
COBDQ_LEPIN      EKNKSLKRVFATHIP---------------------------TKTEVEGYEIHHGKTKSI
COBQ_BACFR       QGEKVTRQVRFRFLED---------------------------SAVCEGYEIHMGTTTPL
COBQ_CHLTE       EREKALCNSVGKIAGT---------------------------PFFVSGYEIHMGRTALE
COBQ_BACHD       AEKKKTVRSLGQLLHPF------------------------GTAKDIYGFEIHLGETDIV
COBQ_GEOKA       ERTKITIRTEGMLTWA-------------------------GERFSVQGYEIHMGRSAPL
COBQ_BRADU       SPQK---TLTRVTAVH------------------------AATNQPIQAYEIHIGRTDGP
COBQ_RHOCA       TPDKRL-TRVRVRATH------------------------AGSGLAVEGYEIHIGRTEGA
COBQ_AGRFC       TGDK---RLVSVRGT-------------------------SFDGVGLSGYEMHVGETTGI
COBQ_BRUME       EPEK---VVRNVEAVS------------------------LLHDEPLEGYEIHIGRTSGP
COBQ_BRUSU       EPEK---VVRNVEAVS------------------------LLHDEPLEGYEIHIGRTSGP
COBQ_RHILO       EPEK---TVRNVSARS------------------------VQFDLPLEGYEIHLGRTTGP
COBQ_SINSX       APEK---TVRNSRAWS------------------------LEHDVVLEGYEIHLGKTQGA
COBQ_RHIME       APEK---TVRNSRAWS------------------------REYDVALEGYEIHLGKTTGA
COBQ_BURMA       TPEKTLVNAAGRLAF--------------------------GGDARVAGYEIHMGRTEGP
COBQ_BURPS       TPEKTLVNAAGRLAF--------------------------GGDARVAGYEIHMGRTEGP
COBQ_RALSO       APAKQLRQVRGTLAD--------------------------GGAA-LAGYEIHMGVTEGP
COBQ_PSEPK       EAEKQLRNVAGTLSL--------------------------EAAT-VTGYEIHAGVTTGP
COBQ_PSESM       ETEKQLRNVRGRLTL--------------------------EDAE-VSGYEIHAGVTTGA
COBQ_PSEAE       EADKQLRNVQGRLSL--------------------------EDAP-LSGYEIHAGVTRGE
COBQ_XANAC       QPHKQLHRVHGRLLL--------------------------GDAG-VSGYEIHCGISSGA
COBQ_CHRVO       APEKRLTRMRGRLTL--------------------------GDAE-AAGYEIHMGVSQGP
COBQ_METCA       ELEKQLRTVSGILIL--------------------------EGAT-VSGYEIHAGVSSGP
COBQ_VIBVU       TQDKCLINTKGQLSLN------------------------GK-HVNVTGYEIHVGRSQVN
COBQ_VIBVY       TQDKCLINTKGQLSLN------------------------GK-HVNVTGYEIHVGRSQVN
COBQ_VIBPA       TGSKQLTKTEAVLNLN------------------------NQ-KAKVKGYEIHVGRSQVL
COBQ_VIBCH       TAEKRLTNVKGHLTLD------------------------GQ-TVAAQGYEIHAGHSSWA
COBQ_PHOPR       APEKQLKQTVGTLQLP------------------------EQPAVPVRGYEIHAGITSGI
COBQ_SHEON       KAEKQLRCVAGELTLI------------------------GQ-TVAVKGYEIHCGESQYL
COBQ_CORDI       HPEK---TLIRHEN---------------------------------GGYEVHHGRVERS
COBQ_COREF       TPHN---IMVNHGD---------------------------------GSYEVHHGQVRHH
COBQ_MYCPA       HPAK---TLRRWQ-------------------------------RPLAGYEIHHGRVSRC
COBQ_NOCFA       AAPK---VLRRVTGM--------------------------GAGNPVRGYEIHHGRVRRS
COBQ_MYCBO       SPHK---VLRLPRGE--------------------------GLGVPASGYEIHHGRITRG
COBQ_MYCTU       SPHK---VLRLPRGE--------------------------GLGVPASGYEIHHGRITRG
COBQ_STRAW       AREK---TLTRPVGE--------------------------ALGEHVEGYEIHHG-VADV
COBQ_STRCO       DREK---TLTRAVGE--------------------------ALGEPVEGYEIHHG-VAEV
COBQ_CUTAK       AATK---TLALSHGT--------------------------WRGIEVGGYEIHHGVCRSL
COBQ_DEIRA       AADK---TTRLSEVRD------------------------PETGLRLQGYEIHHGQTRSG
COBQ_HALMA       SESKTVEHVQRNIDGVGPL---------------------SGASGTVEGYEIHMGDSTLT
COBQ_HALSA       QPDKRVEAVTRELADCGAL---------------------GGATGAVTGYEIHMGRTTVP
COBQ_METJA       GNDKVVKNSCGFLEIDNKTFN-------------------------VKGYEIHEGFTYSK
COBQ_METMP       GNKKAIKNSTGKISIFNQNFD-------------------------VSGYELHEGYSVSN
COBQ_METTH       TGEGKIISQSQGRVLGNGIFSGMRG-------------------ETVEGYELHEGTTVLG
COBQ_METKA       PSDAGKVTVRSEGVVNHPHLRGIR----------------------VEGFEIHEGRTYTD
COBQ_PYRFU       AREKRTNHLKAEVLWEPARGMR------------------------VEGYEIRFGRSTTR
COBQ_THEKO       TGEKRTNHLKAEVLWEPARGMW------------------------VEGYEIRMGRSTSE
COBQ_METAC       GEYKKRTIQVTKKVNGYGPILKS-----------------------IDG-EDIKGYEIHM
COBQ_METMA       GEYKKRTVQVTKKVNGYGPILRP-----------------------IDG-EEIKGYEIHM
COBQ_ARCFU       REYRKRTVQVEKRVNGNAVILDR-----------------------IRG-EKVWGYEIHK
COBQ_PICTO       NKTKTTGSVKYRFAENQLKINGS-----------------------GTGYEIHYGSIVKN
COBQ_THEAC       ERTKTTRSVRYR-VDNTLMSGTW-----------------------EEGYEIHYGAVISL
                                                                 . *   *     

COBQ_NOSS1       PQGDSQAF------------QPLFDDVNLGLVDSC---QSVWGSYLHGLFDNGPWRRAWL
COBQ_SYNY3       E--HSQDF------------LPMFDQEELGMVNAQ---QNLWGCYLHGLFDNGAWRRCWL
COBQ_SYNP6       S--DSEEF------------LPIFDDPKLGLCDRN---GNLWGTYLHGIFDNGAWRRAWL
COBQ_THEEB       G--DRQGW------------HPLFAAPELGLVNRA---GTLWGTYLHGLLENGPWRRHWL
COBQ_GLOVI       P-----TL------------EALFAEPHLGVVSSN---RRVWGTYLHGLLDNHAWRRHWL
COBQ_PROMM       Q-GSHESV------------LPMADDPSMGWVSKNESCGQVAGTYLHGIFENGRWRRLWL
COBQ_SYNPX       --WASDDL------------QPICNEPGLGWWCATPAGGCIAGTYLHGLLDNGPWRRRWL
COBQ_PROMA       N-SQKVKV------------KDLCNETSLGWVNEECNPIKAAGTYLHGIFDNGTWRRLWI
COBQ_PROMP       NSQDTFKI------------KPIFKDLDLGWYKENIQGGTIAGTYIHGIFENDDWRDHYL
COBQ_ACIAD       P---------------------------LYFQKDN-----IQGTFIHQVFDHNAFRTQYL
COBQ_CLOAB       EKAKPFIK-----------IEN----KVGIDDGAVNEGGNIMGTYIHGIFDGANFREYII
COBQ_CLOTE       EGAKPLFN-----------IYDENGKKVNRNDGAINEKGNVMGTYIHGVFDGVEFREKVL
COBQ_CALS4       GKGKHFSI-----------VVERNKEKVKVLDGAVSEDGRVFGTYIHGIFENSLFTKEFI
COBQ_LISMF       ESTSPFCE-----------IKAVNGNEETHQDGAISVNKNIIGTYIHGIFDNDVFLGNLF
COBQ_LISMO       ESTSPFCK-----------IKAVNGNEETHQDGAISANKNIIGTYIHGIFDNDVFLGNLF
COBQ_LISIN       ENTQPFCK-----------IKAVNGNQETHEDGAISANKNIIGTYIHGIFDNDIFLGNLF
COBQ_SALTI       EGCCTAMT-----------LQ-KNG--CSVADGAVTADGLAFGTYLHGLFDSDAFTRAVV
CBIP_SALTY       EGCCTAMT-----------LQ-KNG--CSVADGAVTADGLAFGTYLHGLFDSDAFTRAVV
COBQ_PHOLL       ADATPFID-----------ITERNGQSGGWCDGAVNREGSVMGSYIHGLFDSANFTRALL
COBQ_CLOPE       PTAKENIW-----------IKEKNGNVLGMN----NKEQNVFGTYIHGIFDEGDFGEKLI
COBQ_DESVH       AGGGAVLV-----------CLHESDG---SPAGWTTPDGQVWGTYLHGVFDADGFRRGWL
COBDQ_LEPIN      GNTRVILL-----------NEKAEE------LGHSDPTGRIWGTYIHGIFDKDEFRRKYL
COBQ_BACFR       ADVP---------------VSPLNHLADGREDG-YFVDRTCMGTYVHGILDNPSVIDYLL
COBQ_CHLTE       PGASPLLE-----------VTERNGVATDDFDGAKSADGQVTGTYFHGFFDRPEVRTWFL
COBQ_BACHD       DPSIPAFL-----------RVGNHT------DGVYLHEGRLIGTYFHHLFFNDDFRSGWL
COBQ_GEOKA       -PGYAPLI-----------EADGRH------EGAKHSDERVLGTYMHDLFHNDAFRTAFF
COBQ_BRADU       DRAR---------------PFAKLNGE---PEGAISSDGRVQGSYLHGLFTSDDFRKAFL
COBQ_RHOCA       DRAR---------------PFAIVEGQ---NEGAMSADGRVIGSYLHGLFGADAFRAAFL
COBQ_AGRFC       AGSL---------------VFSTIDGH---ADGTISPDGRVFGTYIHGLFADDRQRSAWL
COBQ_BRUME       DMAR---------------PFARIGDH---DDGAVSPDGRIMGTYLHGVFSADRFRHHFL
COBQ_BRUSU       DMAR---------------PFARIGDH---DDGAVSPDGRIMGTYLHGVFSADRFRHHFL
COBQ_RHILO       DTMR---------------PSAIINGV---ADGAISADGKVIGTYMHGLFGADAFRGKFL
COBQ_SINSX       DCGR---------------PSVRIDNR---ADGALSADGRVMGTYLHGLFTSDAYRGALL
COBQ_RHIME       DCSR---------------APVEIDGR---PDGAMSADGRVMGTYLHGLFGSDAYRSALL
COBQ_BURMA       ALAS--------------PALMLAGRGGERPDGAVSADGQILATYLHGLFDTPHACAALL
COBQ_BURPS       ALAS--------------PALMLAGRGGERPDGALSADGQILATYLHGLFDTPHACAALL
COBQ_RALSO       ALAR--------------PAVRLDDG---RTDGAVSADGQILATYLHGLFDAPEACRALL
COBQ_PSEPK       ALAQ--------------PAVQLADG---RHDGAVSADGQILATYLHGLFEGSQSCAALL
COBQ_PSESM       ALEQ--------------AAVQLDDG---RCDGAQSADGQILGTYLHGLFESPAACSALL
COBQ_PSEAE       ALAR--------------PAVVLDDG---RADGARSVDGNVMGTYLHGLFESTAACSALL
COBQ_XANAC       ALAR--------------PLLQLDDG---RTDGAISDDGQVLGTYVHGVFDHPQALAALL
COBQ_CHRVO       ALAR--------------PAVRFDDGS---ADGARSEDDQIFATYLHGVFDEPAACQAIL
COBQ_METCA       ALER--------------PACRLERG----AEGALSDDGQILGTYVHGLFDEPEALTALL
COBQ_VIBVU       EYQ----------------PITNDDGQ---LEGALSECGQIMGSYLHGFLDSEAVLELIC
COBQ_VIBVY       EYQ----------------PITKDDGQ---LEGALSECGQIMGSYLHGFLDSEAALELIC
COBQ_VIBPA       DEQ----------------PLELDNGE---CDGAISECGQIMGTYLHGFFDEAEALNLIT
COBQ_VIBCH       ADQK--------------SPIILSDGS---LDGLVSDCNQGFGTYLHGIFDRPETALRIC
COBQ_PHOPR       QTN---------------APVQLQDG----PDGQLGIDNQVFGTYLHGIFEQTEACNAIL
COBQ_SHEON       TSSDAAKGAPLRLINELTCDEQAEKSF---ADGCLSEDGQVLGTYLHGLFDSPDACQLIL
COBQ_CORDI       TEQPWIG-------------------------NEGARTQSNFGTHRHGYLEDDEARRDFL
COBQ_COREF       GEQTWIE-------------------------GEGARREALFGTHRHGYLQDDPARRRFL
COBQ_MYCPA       AEHSWF------------DSDAE---------PQGLVRGAVFGTHWHGLLDNDDFRRAWL
COBQ_NOCFA       GDAPWLGLVDAP------EAAVDGGEDAVPLTPEGSVTGGAWGTHVHGLLESDGFRRAWL
COBQ_MYCBO       DTAEEFL--------------------------GGARDGPVFGTMWHGSLEGDALREAFL
COBQ_MYCTU       DTAEEFL--------------------------GGARDGPVFGTMWHGSLEGDALREAFL
COBQ_STRAW       TGGDPFL--------------------------DGCRVGAVWGTHWHGSLESDGFRRAFL
COBQ_STRCO       TGGAPFL--------------------------DGCRVGRTWGTHWHGSLESDGFRRAFL
COBQ_CUTAK       EDAEAFL--------------------------DGVHVGPVWGTMWHGAFEHDEFRRTWL
COBQ_DEIRA       PGVQTLV------------------------PGLLWRSGNVRGTYLHGLLENSAYLEHFL
COBQ_HALMA       GAAARPFD------------------------GDGAGTDTVLGTYLHDLFSNDTARDAFV
COBQ_HALSA       DGVPQPVG------------------------PASAARGRVLGTYLHGLFGNDAARRGFR
COBQ_METJA       E-KPLIKI----------ERGFGNCGNGFDGSIKKFGDGLAIGTYFHGIFENYEFRNYII
COBQ_METMP       E-TPLISL----------SKGFGNCGDSYDGSFKMIGDSYIFGTYFHGILENFEFRNYLV
COBQ_METTH       DVKPLLRV----------DRGFGNTRS---GGFDGAVDGNVAGTYFHGIFHNFRFRRYFT
COBQ_METKA       E-PHLVRL----------RSGYGNRGCFLDGAYRT--DRPVLGTYLHGIFFNRRFRHEFL
COBQ_PYRFU       R--PFSVI----------KWVNGRRVEEFEGAVGE----RTFGTYLHGIFHNFEFTEAFL
COBQ_THEKO       K--PFSVI----------TSINGARAFEPEGAIGK----RAFGTYLHGIFHNFAFTERFL
COBQ_METAC       G-----------------VTDSNRTVFGDDGAIDE--EGLVIGTYLHGLFDNENIRNALV
COBQ_METMA       G-----------------VTDSNRTVFGDDGAIDE--DGFVIGTYLHGLFDNRNIRNALV
COBQ_ARCFU       G-----------------ITRASNPIFEDDGCASE--DGMCWGTYLHGLFWNENVLRALG
COBQ_PICTO       N-----------------EMPLLITDHGPEGSVSS--NGMVIGTNVHGILENNEFYRYIT
COBQ_THEAC       G-----------------GERMNETDKGPEGNVDA--NRLVFGTNIHGILANRSVFRFMT
                                                           .   *  :          

COBQ_NOSS1       NRLRQQRGLKSLP-TGVANYREQREQMLDNIATEVENHLDLTPFLP--------------
COBQ_SYNY3       NNLRQRRGLDPLP-TSIGNYQEQREGMLDSLADFVETHVNLEPILQSLPEENETP-----
COBQ_SYNP6       NSLRHRRGLKALP-TSIGHYQAQRDDLIDALSDAVEPYLNLSPLLTAL------------
COBQ_THEEB       NGLRSRRQLPPLP-TAIPHYGEQRTVALDELTKTVMAHLNLRGICKLC------------
COBQ_GLOVI       NALRERRGLPQLP-VQSGHYREQREEMFERLADAWEPHLPIDGFAQLAGFASQV------
COBQ_PROMM       NLIRKQKGLADLP-TDISNHEQQREQLLNRLADVFEEHVNINPLLGT-------------
COBQ_SYNPX       NQLRERKGLAPLI-TGLPHHGEHRHQLLERLADAFEQHVDLTPLLQP-------------
COBQ_PROMA       NQIRKKANLYELP-LLEENHDAKREKVINRLTDVFEENINLEYLLKT-------------
COBQ_PROMP       NLIRKGKNLPLLK-KRTRSYKMKRENIIDNLANEFKKNFNISSLLN--------------
COBQ_ACIAD       RAICAQ--------YQGFDFQLYKTEQINNFIEACRKRLNVKLILEAIQDQ---------
COBQ_CLOAB       NFLRDKKG-IER--KKSVVYEDVRNGEIDRLADIVRNSLDMNSIYSVMG------IEGKK
COBQ_CLOTE       NNIRKSKN-MEE--RNAINYENLREKNLDMLADLVRENIDMDYIYKIIG------M----
COBQ_CALS4       NIVRKEKG-LTPL-EEVINYREFREKEYDRLANIVRNSLDMERIYQIME------RYRDK
COBQ_LISMF       DELLTRKNKSVYP-HEIINLKEHKEQEYDKLAALLEANIQMDQLEKIMKGEKICVSTQKP
COBQ_LISMO       DELLTRKNQSIYP-HEIINLKEHKEQEYDKLAALLEANIQMDQLEKIMKGEKICVSTQKP
COBQ_LISIN       NELLTQKNKSIYP-HEIIKLKEHKETEYDKLAALLEANIQMDQLEKIMKGEKICVSTQKP
COBQ_SALTI       NGLRARKGLAPWE--TTFCYAEHKARQFDLLAEAMRQHIDIDKIYTIMQ------QHQEP
CBIP_SALTY       NGLRARKGLAPWE--TTFCYADHKARQFDLLAEAMRQHIDIDKIYTIMQ------QHQEP
COBQ_PHOLL       NALRQRKGLAAYQ-GEILDYTHYKQTQFDLLAKAMREHLDIERIYQCMK------THRQG
COBQ_CLOPE       NKLKKELNIEES---NEVNYKDYKMSQYDKLCELLEENIDMAYVENLIRS----------
COBQ_DESVH       DALRVRRGLEPVG-RVVARYDLDPA--LDRLADVVREAVDMGHIYSVLGLSPKGRRQT--
COBDQ_LEPIN      DQIRIRKGKSPLV-KVQVSYNLEKS--LDRLARYVRQSLNINLIYRKLGLG---------
COBQ_BACFR       EPFADKLK------ETAFDYKAFKEEQYDKLAAHVRKHVDLPLIYQILTDND--------
COBQ_CHLTE       RLLDGGYE------SPR---GASVADPFELLAKHFSENLDLEKLFAIAGLSVKGEKES--
COBQ_BACHD       NTLRRKKGLRER---PTVELEKCRRASYDQLADEVERVLHVDSLLEKMERWGETS-----
COBQ_GEOKA       NNIRRQKGIAPS---GVRLFRSLKEKAFDRLAAHVRQHVAVERIEQMMRQFGCRDHS---
COBQ_BRADU       TKLDIPA--------GDEPYHSRVESALDALADHIEKHLDVEGLLSLAR-----------
COBQ_RHOCA       RGLGIRA--------SGQSHAAGVEAALDALADHLETHLDVTGILALAR-----------
COBQ_AGRFC       ERLGGQG--------TDLNYDAQVDAVLDRLAAHMEQHLDLDRLLAIAR-----------
COBQ_BRUME       RALGVEG--------GQMNYRESVEEALGELAEGLEASLDIDGLFALA------------
COBQ_BRUSU       RALGVEG--------GQMNYRESVEEALDELAEGLEASLDIDGLFALA------------
COBQ_RHILO       ESLGIKG--------GGIDYRVEVERALDDVAAELEGHLDCDALFGLAR-----------
COBQ_SINSX       KSFGIEG--------GANNYRQSVDAALDDVANELEAVLDRRWLDELLRH----------
COBQ_RHIME       KSFGIEG--------GGGNYRRSVDAALDEIALELETVLDRAWLGTLLG-----------
COBQ_BURMA       EWAGLDGA-------EALDYPALREASLERLADTFAEHLDLDRVFAAFA-----------
COBQ_BURPS       EWAGLDGA-------EALDYPALREASLERLADTFAEHLDLDRVFAAFA-----------
COBQ_RALSO       AWAGVREA-------RAQDYAALREASLERLADTLRAHLDLPALFASLAVRG--------
COBQ_PSEPK       RWAGLEDV-------QVIDYEALREHDIERLADLVEKHLDTVQLRQLCGVA---------
COBQ_PSESM       RWAGLENV-------QSVDYHALRERDIERLADLVEKHLDGTLLRELCGLEAT-------
COBQ_PSEAE       RWAGLREV-------QAVDYQALRERDIERLADLVERHLDTGRLLALCGEPHA-------
COBQ_XANAC       AWAGLAQA-------APLDLAALREASLERLADAVHTHLDTAALTRLISREAACST----
COBQ_CHRVO       RWAGLKEP-------EALDYPALREANIDKLADMLERHLDLEPIRRWLPETR--------
COBQ_METCA       RWAGLPQP-------RVFDVRLERERGIDRVAAAVEAELNMELIMDLLSGSGRREGHAPA
COBQ_VIBVU       EWVNGVRI-------KAQNHQQLKEQAIDRIADAIEEHLDLSQLGI--------------
COBQ_VIBVY       EWVNGVRI-------KAQNHQQLKEQAIDRIADAIEEHLDLSQLGI--------------
COBQ_VIBPA       EWVNGTQV-------KQQDFEVLKEQGINRIADAIEQHMNLDFLFK--------------
COBQ_VIBCH       QWAGAKEI-------EAYDHRAAQERAIDRIADAIEQHLDLTLLWPDL------------
COBQ_PHOPR       SWAGLEAT-------QTPDFDLIREQGIDRVADTLEEYMKLDKLWPEWADKFAK------
COBQ_SHEON       RWAGLEDA-------QAIDINAIREQQLDRLADVLAEHLDLPQLQAILTASVKP------
COBQ_CORDI       GTVSTLAQRPGFVVAPATSFEAERNKQLDVIADAIEQHWDLDQLIAALT-----------
COBQ_COREF       TEVATHAGKPGFLVSPDTSFHGVRLQQLDRIADVLEEHWDLDQLLDEVSRPANAANTPET
COBQ_MYCPA       VRVADAAGRR--FVPGDTDVAARRDAQLDLAADLLAAHLDVDAVLGLLDGPPPRPRLATR
COBQ_NOCFA       REVAARAGRHGFQVAPDTSVAAVRAGQLDLLADLVEKHLDQDALERILTDGAPTGLPVLT
COBQ_MYCBO       RETLGLAP-------SGSCFLAARERRLDLLGDLVERHLDVDALLNLARHGCPPTLPFLA
COBQ_MYCTU       RETLGLAP-------SGSCFLAARERRLDLLGDLVERHLDVDALLNLARHGCPPTLPFLA
COBQ_STRAW       REVAAAAGRRFVP-AAGTSFAGLREEQLDRLGDLIEEHADTDALWRLIESGAPSGLPFIP
COBQ_STRCO       REVAAAAGRRFVP-APDTSFAALREEQLDRLGDLIEHHADTDALWRLIESGAPQGLPFIP
COBQ_CUTAK       ADAARHAGSSWRPHSDELGYQARREAMIETLADALEAHVDVDRILHLVR-----------
COBQ_DEIRA       RWADLPVP----------ACLDSLDARLDAIAAQVQAGLSWDRVRALL------------
COBQ_HALMA       RNTFESAGTV-----LPAATGRADGDPYERAAGLITDHVDLGPLGLSDQ-----------
COBQ_HALSA       DAVFAAAGVE-----QPAPADTPDQSPSDAAAALVDAHVDLDPLGVPPAPDA--------
COBQ_METJA       NLIRKRKGLDEIY---GDSYKDSIEKSLNYFAEVVERSVNLKPLGI--------------
COBQ_METMP       NLARSKKNLSKIE---DDTYAELFNENMDKLSKIIEENLDFSKIIG--------------
COBQ_METTH       NLLRERKGIEPLEY-LDDNFSASRRFSIDRLAEIVEENMDLSIIEEILEG----------
COBQ_METKA       RWVSGGRWKPPER----DVVREAVKRNLQVALEIVESTDLPELLGE--------------
COBQ_PYRFU       NLIRREKGLEPIK-----IREWSIEDEINRFAKIVRESIDVDYIIEFLGL----------
COBQ_THEKO       NMLRAEKGLEPVK-----VEEWSIEEEIEKFTRVVRESVDVEYIIQRLGL----------
COBQ_METAC       RYLCEKKGLEYRP-----EEIISENDAYEELANRFEQNIDMEKLYEIAGI----------
COBQ_METMA       RYLYEKKGLEYEP-----DEAISENDAYEELANVVEQNIDMEKLFEIAGV----------
COBQ_ARCFU       GYL----GIKFR----------QKEDWADLIADEVEGRLDLGVLGL--------------
COBQ_PICTO       GEYL--------------DYDNIIENSIETLAGIVKKSINIEGFLELLNDA---------
COBQ_THEAC       GRDIG-------------EPEEYLRSEIDRFADVVKSSIDVADLIEYASSRE--------
                                                            .                

COBQ_NOSS1       -----
COBQ_SYNY3       -----
COBQ_SYNP6       -----
COBQ_THEEB       -----
COBQ_GLOVI       -----
COBQ_PROMM       -----
COBQ_SYNPX       -----
COBQ_PROMA       -----
COBQ_PROMP       -----
COBQ_ACIAD       -----
COBQ_CLOAB       -----
COBQ_CLOTE       -----
COBQ_CALS4       -----
COBQ_LISMF       AIKE-
COBQ_LISMO       AIKE-
COBQ_LISIN       AIKE-
COBQ_SALTI       V----
CBIP_SALTY       V----
COBQ_PHOLL       SVP--
COBQ_CLOPE       -----
COBQ_DESVH       -----
COBDQ_LEPIN      -----
COBQ_BACFR       -----
COBQ_CHLTE       -----
COBQ_BACHD       -----
COBQ_GEOKA       -----
COBQ_BRADU       -----
COBQ_RHOCA       -----
COBQ_AGRFC       -----
COBQ_BRUME       -----
COBQ_BRUSU       -----
COBQ_RHILO       -----
COBQ_SINSX       -----
COBQ_RHIME       -----
COBQ_BURMA       -----
COBQ_BURPS       -----
COBQ_RALSO       -----
COBQ_PSEPK       -----
COBQ_PSESM       -----
COBQ_PSEAE       -----
COBQ_XANAC       -----
COBQ_CHRVO       -----
COBQ_METCA       GQP--
COBQ_VIBVU       -----
COBQ_VIBVY       -----
COBQ_VIBPA       -----
COBQ_VIBCH       -----
COBQ_PHOPR       -----
COBQ_SHEON       -----
COBQ_CORDI       -----
COBQ_COREF       R----
COBQ_MYCPA       LCR--
COBQ_NOCFA       VGQA-
COBQ_MYCBO       PGAP-
COBQ_MYCTU       PGAP-
COBQ_STRAW       PGAPA
COBQ_STRCO       PGAPA
COBQ_CUTAK       -----
COBQ_DEIRA       -----
COBQ_HALMA       -----
COBQ_HALSA       -----
COBQ_METJA       -----
COBQ_METMP       -----
COBQ_METTH       -----
COBQ_METKA       -----
COBQ_PYRFU       -----
COBQ_THEKO       -----
COBQ_METAC       -----
COBQ_METMA       -----
COBQ_ARCFU       -----
COBQ_PICTO       -----
COBQ_THEAC       -----