CLUSTAL format seed alignment for MF_00030

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A0H2Z7X2_PSEAB      ---MPGAVDFKERISRQRPHDRETYGH----AG-NTDLQDIVYQLESDRGRIVNSAAVRR
A6V964_PSEA7          ---MPGAVDFKQRISRQRPHDRESFGH----AG-EDDLQEIVYQLESDRGRIINSAAVRR
A4VJX2_PSEU5          ---MPESVNFKHKISRQRPYGKAEPGL----RASEGNLGAVIDQLESDRGRIINSAAVRR
F6AJQ6_PSEF1          ---MSAAVNFKERICALRPGDQ------------AGGDVDLLYAFESDRGRIINSAAIRR
DGTP_YERPY            ----MSGIDFKQKISFQRPFSKPSSA---------EDEYEITRVFESDRGRIVNSAAIRR
DGTP_YERE8            ----MSGIDFKQKISVQRPFGKPSSA---------EDEYEITRVFESDRGRIVNSAAIRR
DGTP_SERP5            ----MSGIDFKQKISFQRPFSKPIEA---------EEEYDIVRQFESDRGRIVNSAAIRR
A0A0H3FEJ3_RAHSY      ----MSGIDFKTKFNFQRPFSAPIEA---------RDDYDVVRQFESDRGRIINSAAIRR
A0A0H3I5H8_PECPM      ----MSDIDFAKKMSFQRHFSRPKTA---------DNGYAIVRQFESDRGRIINSAAIRR
Q6D1Z5_PECAS          ----MSDIDFAKKMSFQRHFSRPKTA---------ESEYAIVRQFESDRGRIINSAAIRR
C6DC26_PECCP          ----MSDIDFAKKMSFQRHFSQSKTL---------NDGYAIVRQFESDRGRIINSAAIRR
C6CNJ2_DICC1          ----MSAIDFSTKLSFQRRFGRKKDK---------KDEYAIVQEFESDRGRIINSAAIRR
D2BUB6_DICZ5          ----MSAIDFSTKLSFQRRFGRKRDK---------KDEYAIVQEFESDRGRIINSAAIRR
E0SBJ5_DICD3          ----MSDIDFSKKISFQRPFSKPKDK---------KDAYAIEREFESDRGRIINSAAIRR
C6CB55_DICP7          ----MSDIDFARKISFQRPFSQPISA---------ENEDDIIRQFESDRGRIINSAAIRR
Q2NVP6_SODGM          ----MSEIDFSHKISFQRSYSPAIRA---------QDDYAIIRQFESDRGRIINSAAIRR
D0ZD43_EDWTE          -----MSIDFASKLSYQRPLRSAEEA------LFLNGAYEIGRQFESDRGRIINSAAIRR
C5BAP3_EDWI9          ---MSIGIDFASKLSYQRPLRSAEEA------LLLHGAYEIGRQFESDRGRIINSAAIRR
A0A198GRU5_9ENTR      ----MAQIDFRTKINWHRRFRSPQGD---------KSEHEILRIFESDRGRIINSPAIRR
A0A0H3CJ04_ENTCC      ----MSQIDFRTKINWHRRFRSPQGE---------KSEHEILRIFESDRGRIINSPAIRR
DGTP_ENT38            ----MAPIDFRNKINWHRRFRSPQGS---------KSEHEILRIFESDRGRIINSPAIRR
DGTP_SHIBO            ----MAQIDFRKKINWHRRYRSPQGV---------KTEHEILRIFESDRGRIINSPAIRR
DGTP_ECOLI            ----MAQIDFRKKINWHRRYRSPQGV---------KTEHEILRIFESDRGRIINSPAIRR
DGTP_ESCF3            ----MIQIDFRKKINWHRRYRSPQGV---------KTEHEILRIFESDRGRIINSPAIRR
D2TI48_CITRI          ----MAQIDFRKKINWHRRYRSPQGV---------KTEHEILRIFESDRGRIINSPAIRR
DGTP_CITK8            ----MAQIDFRNKINWHRRYRSPQGV---------KTEHEILRIFESDRGRIINSPAIRR
DGTP_SALCH            ----MASIDFRNKINWHRRYRSPQGV---------KTEHEILRIFESDRGRIINSPAIRR
DGTP_SALAR            ----MASIDFRNKINWHRRYRSPQGV---------KTEHEILRIFESDRGRIINSPAIRR
A0A0K0H7G8_SALBC      ----MASIDFRNKINWHRRYRSPQGA---------KTEHEILRIFESDRGRIINSPAIRR
DGTP_KLEP3            ----MAKIDFRNKINWRRRFRSPPRV---------ETERDILRIFESDRGRIVNSPAIRR
A0A0H3FS31_KLEAK      ----MANIDFRNKIHWRRRYRSPQGV---------ETEREILRVFESDRGRIINSPAIRR
A0A0H3H3L2_KLEOK      ----MAKIDFRNKINWRRRYRSPQGV---------ETEREILRIFESDRGRIINSPAIRR
E3G918_ENTLS          ----MAKIDFRSKINWRRRFRSPQSA---------ATEHEILRIFESDRGRIINSPAIRR
L0M6R0_ENTBF          ----MAKIDFRNKINWGRRYRSPEGV---------SSEHEILQIFESDRGRIINSPAIRR
DGTP_CROS8            ----MEKIDFRNKINWHRRYRSPQGV---------KSEHEILRIFESDRGRIINSPAIRR
I2BCL2_SHIBC          ----MEKIDFRSKINWHRCFRSPQGE---------KNEHEILRIFESDRGRIVNSAAIRR
D2T5A9_ERWP6          ----MTGIDFRSKINWQRCYRPDRGA---------KNEHEILRIFESDRGRIINSAAIRR
E3DCV8_ERWSE          ----MTGIDFRNKINWQRCYRPDRGA---------KNEHEILRIFESDRGRIINSAAIRR
D4HZ88_ERWAC          ----MTGIDFRSKINWQRCYRPDKGV---------KNEHEILRIFESDRGRIINSAAIRR
B2VE29_ERWT9          ----MTAIDFRNKINWQRCYRPDQGP---------KDEHEILRIFESDRGRIINSAAIRR
D8MNC7_ERWBE          ----MTEIDFRKKINYQRRYRPMQGM---------KDEHEILRIFESDRGRIINSAAIRR
E1SDX0_PANVC          ----MSAINFRKKISFSRPYTSRKDP---------EGEYYITRHFESDRGRIINSAAIRR
D4GKC2_PANAM          ----MAAINFRKKISFTRPYSNRKDP---------QGEYFITRHFESDRGRIINSAAIRR
E6W959_PANSA          ----MATINFRKKISFTRPYTSRKDP---------EGEYYITRHFESDRGRIINSAAIRR
C4K6C0_HAMD5          ----MPNIDFNQKIICKRLYPHDKDR-------VMKDEDSIIRFFESDRGRIINSAAIRR
Q7MB72_PHOLL          ----MSGIDFSQKLNYQRKYRQYH-------V-DPNDEEQVIRQFESDRGRIMNSAAIRR
C7BMT4_PHOAA          ----MSGIDFSQKLNYQRKYSQYD-------V-DPNNEEQVILQFESDRGRIINSAAIRR
D3VKK4_XENNA          ----MSKIDFKQKLNYRREFSNAA-------I-HPDDEEHVTRQFESDRGRIINSAAIRR
D3V546_XENBS          MGGLMTKIDFKQKLNYQRKYSNSS-------I-HPDDEDQVNRQFESDRGRIINSAAIRR
B4EUF1_PROMH          ------MIDFKLKLNYQRKYNSSD-------I-DIDDEMQISRQFESDRGRIINSAAIRR
A0A140NJS7_PROSM      ----MSEINFLTKLNYQRNYNSAKSPR----V-SAHNEDAVNRQFESDRGRIINSAAIRR
Q6LP60_PHOPR          -----MSINFNSKVRYNRLYRSNGDINEARPFHPSQKGSAELTSFESDRGRIINSAAIRR
F7YPY2_VIBA7          -----MMINFNQKVRGTRVY-YKGQTSPPQALKTLTR-VAEQENFESDRGRILNSAAVRR
                             ::*  :.   *                          :*******:**.*:**

A0A0H2Z7X2_PSEAB      LQQKTQVFPLERNAAVRSRLTHSLEVQQTGRFIVRTLFRQLGPRAA---EVGLDGLEGAL
A6V964_PSEA7          LQQKTQVFPLERNAAVRSRLTHSLEVQQTGRFIVRTLFAQLGPGAA---EVGLDGLEGAL
A4VJX2_PSEU5          LQQKTQVFPLERNAAVRSRLTHSLEVQQTGRFIVRTLYKQLGSRAA---TFGLDGLETAL
F6AJQ6_PSEF1          LQQRTQVFPLERNAAVRSRLTHSMEVQQTGRFIVRTLYAQLGERAA---DYGLDGLQGAL
DGTP_YERPY            LQQKTQVFPLERNAAVRSRLTHSLEVQQVGRYIAKEILNRFKQDKK-ITAYGLDKLLDPF
DGTP_YERE8            LQQKTQVFPLERNAAVRSRLTHSLEVQQVGRYIAKEILNRFKQDKK-ISAYGLDKLLDPF
DGTP_SERP5            LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRHIAKEILNRFKQDGR-VDALGLTKLLDPF
A0A0H3FEJ3_RAHSY      LQQKTQVFPLEKNAAVRSRLTHSLEVQQVGRHIAKEILHRLRRQNK-LEAYGLDEVTDPF
A0A0H3I5H8_PECPM      LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRYIAKEILHRLQTDDR-LASLGLADRQTPF
Q6D1Z5_PECAS          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRYIAKEILHRLQADER-LASLGLADRETPF
C6DC26_PECCP          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRYIAKEILHRLQGDGR-LAELGLDDRQTPF
C6CNJ2_DICC1          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRYIAKEIFRQLRKNGQ-LEALGLEPLETPF
D2BUB6_DICZ5          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRYIAKEIFRQLRKSGQ-LDVLGLEPLETPF
E0SBJ5_DICD3          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRYIAKEILGQLRKSGQ-LGALGLGTLETPF
C6CB55_DICP7          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRYIVKEVMKRLRKSGQ-LQTLGLARFETPF
Q2NVP6_SODGM          LQQKTQVFPLERNAAVRSRLTHSLEVQQVGRHIVKEIFHHLKNDGR-IGALGLSQLEAPC
D0ZD43_EDWTE          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRHIAREILHCLSSQGR-IAALGLADYTDAF
C5BAP3_EDWI9          LQQKTQVFPLERNAAVRSRLTHSMEVQQVGRHIAREILHCLSSQGR-IAALGLADYTDAF
A0A198GRU5_9ENTR      LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQRL-LETYGLDELTGPF
A0A0H3CJ04_ENTCC      LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQRL-LETYGLDELTGPF
DGTP_ENT38            LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQRL-LETYGLDELTGPF
DGTP_SHIBO            LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRMKELKL-LEAYGLDELTGPF
DGTP_ECOLI            LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKL-LEAYGLDELTGPF
DGTP_ESCF3            LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEILSRLKEQDL-LKTYGLDELTGPF
D2TI48_CITRI          LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEVLSRLKEMKL-LAQYGLDELTGPF
DGTP_CITK8            LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKL-LEQYGLDELTGPF
DGTP_SALCH            LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQNR-LEEYGLDALTGPF
DGTP_SALAR            LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKAQNL-LEEYGLDALTGPF
A0A0K0H7G8_SALBC      LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQNR-LEEYGLDALTGPF
DGTP_KLEP3            LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLSRLKEQKL-LEEYGLEELTGPF
A0A0H3FS31_KLEAK      LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLSRLKEQKL-LECYGLDELSGPF
A0A0H3H3L2_KLEOK      LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLSRLKEQKL-LESYGLDELTGPF
E3G918_ENTLS          LQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEVLSRLKQRKL-LESYGLDELAGPF
L0M6R0_ENTBF          LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLSRLKEKKL-LAAYGLDELTGPF
DGTP_CROS8            LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLSRLKEQGL-LEAYGLSELTGPF
I2BCL2_SHIBC          LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEIITRLKEQDC-LARYGLDELTGPF
D2T5A9_ERWP6          LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLTRLQEAGR-LESLGLAQLTAPF
E3DCV8_ERWSE          LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLTRLQEAGR-LESLGLAQLTAPF
D4HZ88_ERWAC          LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLTRLQEAGR-LGSLGLAQLTAPF
B2VE29_ERWT9          LQQKTQVFPLERNAAVRTRLTHSLEVQQVGRYIAKEVLTRLQEADR-LEALGLAQLTGPF
D8MNC7_ERWBE          LQQKTQVFPLERNAAVRSRLTHSLEVQQVGRYIAKEILTRLKESGQ-LENYGLDQLTGPF
E1SDX0_PANVC          LQQKTQVFPLERNAAVRSRLTHSLEVQQTGRYITKEILQTLKMQGG-LAQYGLDELEGAF
D4GKC2_PANAM          LQQKTQVFPLERNAAVRSRLTHSLEVQQTGRYISKEILQTLKMQGG-LAKYGLDDMEGAF
E6W959_PANSA          LQQKTQVFPLERNAAVRSRLTHSLEVQQTGRYIAKEVLQTLKTQGGGLAKYGLDELEGAF
C4K6C0_HAMD5          LQQKTQVFPLERNSSVRSRLTHSLEVQQVGRYISKEIIFYLKQKNQ-IDALGLQKLRVPF
Q7MB72_PHOLL          LQQKTQVFPLENNAAVRSRLTHSLEVQQVGRYISKTIINELKTRNL-LADYGLDKRLLSF
C7BMT4_PHOAA          LQQKTQVFPLEHNAAVRSRLTHSLEVQQIGRYISKTIISELKSRNL-LAHYGLDKRLLPF
D3VKK4_XENNA          LQQKTQVFPLERNAAVRSRLTHSLEVQQIGRYISKTIISDLTKQDL-LKKYGLNDRLLAF
D3V546_XENBS          LQQKTQVFPLERNAAVRSRLTHSLEVQQIGRYISKTIIAELTKQNL-LEKYGLSDRLLAF
B4EUF1_PROMH          LQQKTQVFPLEQNSAVRSRLTHSLEVQQIGRYIAKQIIGELKKHNK-LEEYGLNERIDSV
A0A140NJS7_PROSM      LQQKTQVFPLEQNAAVRSRLTHSLEVQQVGRYISKTVLHELKRKSY-WKKYGLHERCDAF
Q6LP60_PHOPR          LQQKTQVFPLERNSAVRSRLTHSMEVQQVGRYIVQEVFKQLNKEKK--EEYRLDILERQF
F7YPY2_VIBA7          LQQKTQVFPLERNAAVRSRLTHSLEVQQVGRFITQLIFKHLPKEEQ--EKYFLEGLDRQI
                      ***:*******.*::**:*****:**** **.* : :   :           *       

A0A0H2Z7X2_PSEAB      ESLVEMACLMHDVGNPP---FGHFGEYAINDWFERNLDALFERRVPP-------------
A6V964_PSEA7          ESLVEMACLMHDIGNPP---FGHFGEFAINDWFERNLDGLFQRRVPP-------------
A4VJX2_PSEU5          ESLVEMTCLMHDIGNPP---FGHFGEYAIGEWFERHLDELFAAAVPP-------------
F6AJQ6_PSEF1          ESLVEMTCLMHDIGNPP---FGHFGEFAIGGWFERALDGLFAVAVPQ-------------
DGTP_YERPY            ESIVEMACLMHDIGNPP---FGHFGESAINDWFTKRMDPNGGSGSEP---QSRDQCQVEV
DGTP_YERE8            ESIVEMACLMHDIGNPP---FGHFGESAINNWFTKQMDPNGG-GAEP---RGKDQCLVNT
DGTP_SERP5            ESIVEMACLMHDIGNPP---FGHFGESAINNWFSQRLDPASC-GSEP---ASNDRCQVSA
A0A0H3FEJ3_RAHSY      ESVVEMACLMHDIGNPP---FGHFGESAINNWFAKRMDTAGC-GETP---QETDACLVTC
A0A0H3I5H8_PECPM      ESLVEMACLMHDIGNPP---FGHFGESAINQWFRKLLDSHYLDSESP---ERVDDCNVPV
Q6D1Z5_PECAS          ESLVEMACLMHDIGNPP---FGHFGESAINQWFRKLLDSHYLDNESP---ERVDDCKVPT
C6DC26_PECCP          ESMVEMACLMHDIGNPP---FGHFGESAINQWFRKWLDSHYLDSEFP---EHVDDCKSPV
C6CNJ2_DICC1          ESLVEMACLMHDIGNPP---FGHFGEAAINNWFSQRLLPEETPRDSQ---P--DPCQVPC
D2BUB6_DICZ5          ESLVEMACLMHDIGNPP---FGHFGEAAINNWFRQRLSPGEKPRGSQ---P--DPCLVPC
E0SBJ5_DICD3          ESLIEMACLMHDIGNPP---FGHFGEAAINNWFSQRLAPEGKPPGAG---E--DPCQVAC
C6CB55_DICP7          ESLVEMACLMHDIGNPP---FGHFGEAALNNWFTQRLDPAFAHSDTG---RE-DACQVPC
Q2NVP6_SODGM          ESMVEMACLMHDIGNPP---FGHFGEAAINDWFRRWLDIAGLEQDAL---GN-DRCQVAS
D0ZD43_EDWTE          ESCVEMACLMHDMGNPP---FGHFGEAAIKAWFSRELG-VSADGHNR---LDDAACQVAF
C5BAP3_EDWI9          ESSVEMACLMHDMGNPP---FGHFGEAAIKAWFSRELG-VSADGHNR---LDDAACQVGF
A0A198GRU5_9ENTR      ESIVEMACLMHDIGNPP---FGHFGEAAINDWFKQRLFPSDAISQPL---SD-DRCVVRD
A0A0H3CJ04_ENTCC      ESIVEMACLMHDIGNPP---FGHFGEAAINDWFRQRLFPSDAVSQPL---SD-DRCVVRD
DGTP_ENT38            ESIVEMACLMHDIGNPP---FGHFGEAAINDWFKQRLFPLDAASQPQ---SD-DRCIVRD
DGTP_SHIBO            ESIVEMSCLMHDIGNPP---FGHFGEAAINDWFRQRLHPEDAESQPL---TD-DRCRVRG
DGTP_ECOLI            ESIVEMSCLMHDIGNPP---FGHFGEAAINDWFRQRLHPEDAESQPL---TD-DRCSVAA
DGTP_ESCF3            ESIVEMSCLMHDIGNPP---FGHFGEAAINDWFRQRLFPADAESQPL---SD-DRCIVAL
D2TI48_CITRI          ESIVEMSCLMHDIGNPP---FGHFGEAAINDWFRQRLHPADAESQPL---TE-DRCKVAS
DGTP_CITK8            ESIVEMSCLMHDIGNPP---FGHFGEAAINDWFRQRLHPADAESQPL---SD-DRCAVAA
DGTP_SALCH            ESIVEMACLMHDIGNPP---FGHFGEAAINDWFRQRLHPEDAESQPL---TH-DRCVVSS
DGTP_SALAR            ESIVEMACLMHDIGNPP---FGHFGEAAINDWFRQRLYPEDAESQPL---TH-DRCVVSS
A0A0K0H7G8_SALBC      ESIVEMACLMHDIGNPP---FGHFGEAAINDWFRQRLHPEDAESQPL---TH-DRCVISA
DGTP_KLEP3            ESVVEMACLMHDIGNPP---FGHFGEAAINDWFRQRLAPGDALGQPL---TD-DRCEVQA
A0A0H3FS31_KLEAK      ESVVEMACLMHDIGNPP---FGHFGEAAINDWFSKRLAPKDAASQPL---SQ-DRCQVDA
A0A0H3H3L2_KLEOK      ESIVEMACLMHDIGNPP---FGHFGEAAINDWFSQRLFPGDAASQPL---TD-DRCVVAA
E3G918_ENTLS          ESIVEMACLMHDIGNPP---FGHFGEAAINDWFRQRLWPADAASQPL---SD-DRCVEGA
L0M6R0_ENTBF          ESIVEMACLMHDIGNPP---FGHFGEAAINDWFRQRLVPADATQQPL---SH-DRCVVAT
DGTP_CROS8            ESIVEMSCLMHDIGNPP---FGHFGEAAINDWFSQRLFPADAENLPV---SQ-DRCTVQT
I2BCL2_SHIBC          ESIVEMSCLMHDIGNPP---FGHFGEAAINDWFRQRLFPDDASICPG---SK-DRCRVEA
D2T5A9_ERWP6          ESIVEMACLMHDIGNPP---FGHFGESAINDWFCQQLDAGWLPNSG----RE-DRCVPRV
E3DCV8_ERWSE          ESIVEMACLMHDIGNPP---FGHFGESAINDWFCQQLDAGWLPDSG----RE-DRCIPRV
D4HZ88_ERWAC          ESIVEMACLMHDIGNPP---FGHFGESAINDWFCQQLDASWLPESG----RE-DRCVPRV
B2VE29_ERWT9          ESIVEMACLMHDIGNPP---FGHFGESAINDWFCQQLDAGWSLESG----RE-DRCATGL
D8MNC7_ERWBE          ESIVEMACLMHDIGNPP---FGHFGESAINDWFRQRMDNDFLPPDD----RA-DRCEPEV
E1SDX0_PANVC          ESLIEMACLLHDVGNPP---FGHFGEAAINDWFEENLAAELV------------DPLVAG
D4GKC2_PANAM          ESLVEMACLLHDVGNPP---FGHFGEAAINDWFEDNLAAELV------------DPLVAG
E6W959_PANSA          ESLIEMACLLHDVGNPP---FGHFGEAAINDWFDDNLPAELV------------DPLVAG
C4K6C0_HAMD5          ESLVEMACLMHDIGNPP---FGHFGESAIKNWFKEKTDPYKGDN--------------PL
Q7MB72_PHOLL          ESLIEMACLMHDIGNPP---FGHFGEAAIKDWFAKKLDLNFSLEN----IKREDRCEISA
C7BMT4_PHOAA          ESLIEMACLMHDIGNPP---FGHFGEAAIKDWFTRKLDPNFDPKN----MGQKDQCEILA
D3VKK4_XENNA          ESLIEMACLMHDIGNPP---FGHFGEAAIRDWFSRRLDPDYSSDM----TERQDNCNVAA
D3V546_XENBS          ESLIEMACLMHDIGNPP---FGHFGEAAIRDWFSRRLDPDYFSDCVSESTARQDGCKVAA
B4EUF1_PROMH          ESLIEMACLMHDIGNPP---FGHFGEAAIKHWFRKVLAPDASIEF--------DNCPFLP
A0A140NJS7_PROSM      ESLVEMSCLMHDIGNPP---FGHFGEAAIQSWFRQLLAPQYQYTP-----DYPDPCKIAA
Q6LP60_PHOPR          ESIVEMACLMHDIGNPP---FGHFGEQAINDWFGKQLYKLIKTDLPD-------------
F7YPY2_VIBA7          ESIVEMSCVMHDIGNPPFGHFGHFGEQAINDWFTRNLPSLITNSKGE-------------
                      ** :**:*::**:****   ****** *:  **                           

A0A0H2Z7X2_PSEAB      ---GQGDG----LLQQRMLTDLKHFEGNAQAIRLVVKLLRLNLTYTQTAGLLKYVRPAYE
A6V964_PSEA7          ---GQGDA----PLQQRMLTDLKHFEGNAQAIRLVVKLLRLNLTYTQTAGLLKYVRPAHE
A4VJX2_PSEU5          ---GQGDT----GLRQRMLEDLNHFEGNAQAIRLVVSLQRLNLTYTQTAGLLKYVRPAYM
F6AJQ6_PSEF1          ---HQANS----ELQARMRADLRNFEGNAQAVRLAVNLQRLRLTYTQTAGLLKYLRPAYQ
DGTP_YERPY            LKLREGET-ELNILRSKIRHDLSQFEGNAQAIRLVHSLLKLNLTYAQVGCILKYTKPAYW
DGTP_YERE8            LKLREGET-ELNILRSKIRQDLSHFEGNAQAIRLVYSLLKLNLTYAQVGCILKYTKPAYW
DGTP_SERP5            LRLHEGES-DLNRLRSRIRHDLSHFEGNAQAIRLVHTLLKLNLTYAQVGCILKYTRPAYW
A0A0H3FEJ3_RAHSY      LRLTPDDA-ELNQLRSKIRYDLSNFEGNAQAIRLVFTLLKLNLTYSQTACILKYTRPAYS
A0A0H3I5H8_PECPM      LRMRQDG---LDDLRGQIRQDLSHFEGNAQAIRLVHTLLKLNLTYGQVACILKYTRPAYW
Q6D1Z5_PECAS          LRMQQDG---LDDLRGQIRQDLSHFEGNAQAIRLVHTLLKLNLTYGQVACILKYTRPAYW
C6DC26_PECCP          LRMQQDG---LDELRGKIRQDLSHFEGNAQAIRLVHTLLKLNLTYGQVACILKYTRPAYW
C6CNJ2_DICC1          LKLDEKDSVELNALRGRIRHDLSNFEGNAQAIRLVHSLLKLNLTYAQIGCILKYTKPAYW
D2BUB6_DICZ5          LKFDEQDSAELNALRDRIRHDLSNFEGNAQAIRLVHSLLKLNLTYAQIGCILKYTKPAYR
E0SBJ5_DICD3          LRLDDEGEAELNALRSRIRHDLSNFEGNAQAIRLVHSLLKLNLTYAQVGCILKYTKPAYW
C6CB55_DICP7          LQLRSGQE-ELNRLRLRIRQDLSHFEGNAQAIRLVHTLLKLNLTYAQVGCILKYTRPAYW
Q2NVP6_SODGM          LRLRAGDE-DNNALRSRIRLDLCHFEGNAQAIRMVHSLLKLNLTYAQVGCILKYTRPAYW
D0ZD43_EDWTE          LRRDGRDA-ELDTLRARLRIDLSNFEGNAQSIRLIHTLLKLNLTYAQTACVLKYTRPAYW
C5BAP3_EDWI9          LRRDGQDA-ALDELRARLRIDLSNFEGNAQSIRLIHTLLKLNLTYAQTACVLKYTRPAYW
A0A198GRU5_9ENTR      LRLREGEE-ALNELRRKVRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGCILKYTRPAWW
A0A0H3CJ04_ENTCC      LRLREGED-GLNDLRRKVRQDLCHFEGNAQGIRLVHSLMRMNLTWAQVGCILKYTRPAWW
DGTP_ENT38            LRLREGEE-PLNDLRRKVRQDLCQFEGNAQGIRLVHSLMRMNLTWAQVGCILKYTRPAWW
DGTP_SHIBO            LRLRDGEE-PLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
DGTP_ECOLI            LRLRDGEE-PLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
DGTP_ESCF3            LRLREGEE-TLNELRRKVRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
D2TI48_CITRI          LRLREGEE-SLNDLRRKVRQDLCHFEGNAQGIRLVQTLMRMNLTWAQVGGILKYTRPAWW
DGTP_CITK8            LRLREGEE-SLNDIRRKVRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
DGTP_SALCH            LRLQEGEE-NLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
DGTP_SALAR            LRLQEGEE-SLNDIRRKVRQDICYFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
A0A0K0H7G8_SALBC      LRLREGEE-SLNDIRRKIRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWW
DGTP_KLEP3            LRLHEGET-ALNALRRKVRQDLCSFEGNAQGIRLVHTLMRMNLTWAQVGCILKYTRPAWW
A0A0H3FS31_KLEAK      LRLHDGEG-MLNELRRKVRQDLCCFEGNAQGIRLVHTLMRMNLTWTQVGCILKYTRPAWW
A0A0H3H3L2_KLEOK      LRLQEGDS-QLNELRRKVRQDLCWFEGNAQGIRLVHTLMRMNLTWAQVGCILKYTRPAWW
E3G918_ENTLS          LRLREGEE-SLNELRRKIRQDVCHFEGNAQGIRLVHTLMRMNLTWAQVGCILKYTRPAWW
L0M6R0_ENTBF          LRLQEGDE-ALNELRRKVRQDLCHFEGNAQGIRMVHTLMRMNLTWAQVGCILKYTRPAWW
DGTP_CROS8            LRLQEGEE-ALNALRGNVRRDLCHFEGNAQGIRLVHTLLRMNLTWAQVGGILKYSRPAWH
I2BCL2_SHIBC          LRCREGEE-PLNRLRRDVRQDLCHFEGNAQGIRLVHSLLRMNLTWAQVGGILKYTRPAWF
D2T5A9_ERWP6          LHRQ--DD-GLDPLRAKVRQDLAHFEGNAQAIRVVHTLMKMNLTWAQVGCILKYTRPAWQ
E3DCV8_ERWSE          LHCQ--DD-GLDPLRAKVRQDLAHFEGNAQAIRMVHTLMKMNLTWAQVGCILKYTRPAWQ
D4HZ88_ERWAC          LHHQ--DD-GLDPLRAKVRQDLAHFEGNAQAIRIVHTLMKMNLTWAQVGCILKYTRPAWQ
B2VE29_ERWT9          LHRQ--DD-GLDPLRTKVRQDLAHFEGNAQAIRMVHTLMKMNLTWAQVGCILKYTRPAWL
D8MNC7_ERWBE          LRYQ--TD-GFNDLRAKIRQDLSQFEGNAQAIRMVHSLLRMNLTWAQVGCILKYTRPAWH
E1SDX0_PANVC          VEGDAQRK-AFDELNAMIRQDLCHFEGNAQAIRMVHTLLQLNLSYSQVACILKYTAPAWW
D4GKC2_PANAM          VESEEQRQ-SFNQMNAMIRQDLCHFEGNAQAIRMVHTLLQLNLSYSQVACILKYTAPAWW
E6W959_PANSA          VENELQRA-DFDRLNAMIRQDLCHFEGNAQAIRMVHTLLQLNLSYAQVACILKYTAPAWW
C4K6C0_HAMD5          LRLRENEK-ELNLLRQKIHQDLSQFEGNAQAIRLVHTLLKLNLSYPQIACILKYSKPAYW
Q7MB72_PHOLL          LRLCGDVK--KDRFRRQLRKDLCQFEGNAQAIRMVHSLLKLNLTYAQLGCILKYTCPAFR
C7BMT4_PHOAA          LHLSGDLK--KDLFRRQLRKDLCQFEGNAQAIRMVHSLLKLNLTYAQIGCILKYTLPAFR
D3VKK4_XENNA          LCLTGEEK--KDLFRRQLRKDLCQFEGNAQAIRLAHNLLRLNLTYAQIGCILKYTCPAYR
D3V546_XENBS          LSYNGETK--KDLFRRQLRKDLCEFEGNAQAIRLAHNLLKLNLTYAQIGCILKYTCPAYR
B4EUF1_PROMH          IRYSADRH--LNELKQTLRQDLCHFEGNAQAIRMAHHLLKLNLTYAQIGCVLKYTRPAYW
A0A140NJS7_PROSM      MRLTGDER--LDLFRRQLKQDLCSFEGNAQGIRMVHRLLKLNLTYAQVGSILKYTRGAYD
Q6LP60_PHOPR          ---------PRIDLPEPLYRDLSNFEGNAQGIRLVHTLLGLNLTYSQVSAILKYTRRGDQ
F7YPY2_VIBA7          ---------PRVDLPPEIKKDLENFEGNSQAIRLVHTILGLNLTYSQVSGVFKYTRRGDQ
                                   :   :  *:  ****:*.:*:   :  :.*:: * . ::**   .  

A0A0H2Z7X2_PSEAB      P--------KPDKAAANHYLNKKPGFYLSEEAFVDELRQVLGMRPGTRHPVAYIMEAADD
A6V964_PSEA7          P--------RPDKAAPNHYLNKKPGFYLSEEAFVGDLRQALGMRPGTRHPVAYIMEAADD
A4VJX2_PSEU5          P--------RPDKGTPGAYLQKKPGFYLSEEPFVRALQAALEMQPCTRHPLAYVMEAADD
F6AJQ6_PSEF1          P--------KPGKGMAGAYLNKKPGFYLSEEGFVAELQAVLGQAPGTRHPVAYIMEAADD
DGTP_YERPY            ---------SAPIPASHNYLMKKPGFYLAEENYVKELRRELNMEEFDRFPLTYIMEAADD
DGTP_YERE8            ---------SGDIPTSHNYLMKKPGFYLAEEEYVKDLRRELNMGEFNRFPLTYIMEAADD
DGTP_SERP5            ---------ASDIPASHNYLMKKPGFYLAEEAFVDRLRRELNMGEFDRFPLTYIMEAADD
A0A0H3FEJ3_RAHSY      ---------MTKLP-SHDYLMKKPGFYLAEEPFIKKLRSELGLGEFNRFPLTYIMEAADD
A0A0H3I5H8_PECPM      ---------RGELPADYDYLMKKPGYYLSEEAFVVRLREELEMGEFHRHPLSYIMEAADD
Q6D1Z5_PECAS          ---------HGELPADYNYLMKKPGYYLSEEAFVAKLREELDMGEFHRHPLSYIMEAADD
C6DC26_PECCP          ---------HGKLPPDYDYLMKKPGYYLAEEAFVAKLREELDMGEFHRHPLSYIMEAADD
C6CNJ2_DICC1          ---------AQPVPSAYSYLMKKVGFYLSEEPFVQQLRSELNMAEFHRHPLTYIMEAADD
D2BUB6_DICZ5          ---------AQPTPSQYSYLTKKVGFYLSEEAFVQQLRSELNMAEFHRHPLTYIMEAADD
E0SBJ5_DICD3          ---------AQSIPHEYSYLMKKAGFYLSEETFVRQLRSELEMGEFHRHPLTYIMEAADD
C6CB55_DICP7          ---------QDDVPAVYRYLMKKPGFYLAEEPFVRTLRRELNMGEYQRFPLTYIMEAADD
Q2NVP6_SODGM          ---------HGPAPAPFSYLMKKPGFYLAEEEYVQTLRRELSLGEFHRFPLTYIMEAADD
D0ZD43_EDWTE          ---------QGPLPAGFDYLMKKPGYYWAEEAFVEQLRQQVDLLPHHRFPLTYIMEAADD
C5BAP3_EDWI9          ---------QGPLLAGFDYLMKKPGYYWSEEAFVEQLRQQVDLLPYHRFPLTYIMEAADD
A0A198GRU5_9ENTR      ---------MGEPPASHSYLMKKPGYYLSEEVYIERLRKELLLTPNGRFPLTWIMEAADD
A0A0H3CJ04_ENTCC      ---------MGETPASHSYLMKKPGYYLSEEAYIERLRKELSLTANGRFPLTWIMEAADD
DGTP_ENT38            ---------MGEPPASHSYLMKKPGYYLSEEAYIERLRKELSLTPHGRFPLTWIMEAADD
DGTP_SHIBO            ---------RGETPETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADD
DGTP_ECOLI            ---------RGETPETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADD
DGTP_ESCF3            ---------RGQPPATHHYLMKKPGYYLSEEPYIARLRKELNLALYSRFPLTWIMEAADD
D2TI48_CITRI          ---------RGETPATHNYLMKKPGYYLSEESYIARLRRELDLALYSRFPLTWIMEAADD
DGTP_CITK8            ---------RGETPATHRYLMKKPGYYLSEAPYIERLRKELALAPYSRFPLTWIMEAADD
DGTP_SALCH            ---------RGPVPDSHHYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAADD
DGTP_SALAR            ---------RGPVPDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAADD
A0A0K0H7G8_SALBC      ---------RGPVPDSHCYLMKKPGYYLSEEKYIARLRKELQLATYSRFPLTWIMEAADD
DGTP_KLEP3            ---------FEATPASHSYLMKKPGYYLAEEEYVARLRKELDLAPYNRFPLTWIMEAADD
A0A0H3FS31_KLEAK      ---------RGETLASHSYLMKKPGYYLAEEEYIARLRKELDLAPYNRFPLTWIMEAADD
A0A0H3H3L2_KLEOK      ---------RGEAPASHNYLMKKPGYYLAEEGYVARLRKELDLAPYNRFPLTWIMEAADD
E3G918_ENTLS          ---------RGETPATHSYLMKKPGYYFAEEAYIDRLRKELDLAPYNRFPLTWIMEAADD
L0M6R0_ENTBF          ---------ASDVPASHSYLMKKPGYYLSEEHYIARLRKELDLAPYNRFPLTWIMEAADD
DGTP_CROS8            ---------HGPVPETHSYLMKKPGFYLSEDQYISRLRKELQLDTYSRFPLAWIMEAADD
I2BCL2_SHIBC          ---------CDPVPESHSYLMKKPGYYLSEADYIVQLRKELSLAEYSRFPLAWIMEAADD
D2T5A9_ERWP6          ---------TSPIPASHNYLMKKPGFYLAEEEFIAKLREELDLQPHCRFPLTYIMEAADD
E3DCV8_ERWSE          ---------TSPIPASHNYLMKKPGFYLAEEEFIAKLREELDLQPHSRFPLTYIMEAADD
D4HZ88_ERWAC          ---------SSPIPASHDYLMKKPGFYLAEEQFIAKLREELDIQPYCRFPLTYIMEAADD
B2VE29_ERWT9          ---------TDPIPAGHDYLMKKPGFYLAEEEYIERLRNHLDIQPHCRFPLTYIMEAADD
D8MNC7_ERWBE          ---------RGKIPPGHDYLMKKPGYYLAEAEYVARLRKELDLQPHCRFPLTYIMEAADD
E1SDX0_PANVC          ---------QGEKPAEFSVLMKKPGFYLSEQDYIADLRAATNMEEHHRFPLTYIMEAADD
D4GKC2_PANAM          ---------QGEKPAEFSVLMKKPGFYLSEREYISDLRAATHLTEHHRFPLTYIMEAADD
E6W959_PANSA          ---------QGDKPAEFSVLMKKPGFYLSEREYVADLRAATDIPEHHRYPLTWIMEAADD
C4K6C0_HAMD5          ---------SVDIPKNFDYLMKKCGFYLSEEPFVIELRNALNMERFARFPLSYIMEAADD
Q7MB72_PHOLL          ---------LEEIPNQFNYLMKKPGFYWSEEHFVCELRRELKMGEFCRFPLTYIMEAADD
C7BMT4_PHOAA          ---------LETEPEQFNYLMKKPGFYWSEESFVRELCRELKMGEFCRFPLTYIMEAADD
D3VKK4_XENNA          ---------LEETPPEFSYLMKKKGYYWSEDSFIRELRKELQMGDFCRFPLTYIMEAADD
D3V546_XENBS          ---------LEGSPDEFSYLMKKKGYYWSEDSFIHELKKALQLGDFCRFPLTYIMEAADD
B4EUF1_PROMH          ---------QGATPKEFSYLMKKPGYYWSEAEFVKEVQEKLAMKDFCRFPLTYIMEAADD
A0A140NJS7_PROSM      ---------LEPIPEEFDYLMKKPGYYWSELGFVNELCKKLEMGEHCRFPLSYIMEAADD
Q6LP60_PHOPR          LSPKELKKIDPTSTDDLSYLKKKVGYYVCEDDFVSKLRCCLSIEEGCRSPFSYIMEAADD
F7YPY2_VIBA7          TKPDPKNEQDP--FKDYSYLMKKVGYYLSEHQYIESMKLSLSMDEHCRSPFSYIMEAADD
                                         * ** *:* .*  ::  :          * *.:::******

A0A0H2Z7X2_PSEAB      ISYCLADIEDSVEKGILDIRQLADLLVKKFAVHHSPDAPIPGDADNMSFQRMVDYSLEKA
A6V964_PSEA7          ISYCLADIEDSVEKGILGIGQLADLLVDKFAVHQSPDAPVPGDREGMSFRRMVAYSLEKA
A4VJX2_PSEU5          IAYCLADIEDSVEKGIFSIEQLAQLLLDKFALHGDVDAPVPGPER--SFRSMVSYALERA
F6AJQ6_PSEF1          ISYCLADIEDSVEKGILTVTELAPLLVSTFEKLKSPDTPIPGTRQ-QSFRSLVEQALEGY
DGTP_YERPY            ISYCIADLEDAVEKNIFSVEQLYDHMSQEW----------GAVTPGDLFDKVVGAAFRQL
DGTP_YERE8            ISYCIADLEDAVEKNIFSVEQLYDHMVQEW----------GETTHGDLFDKVVGGAFRQL
DGTP_SERP5            ISYCVADLEDAVEKNIFTVEQLYQHLTQEW----------GEVTPGDLFDKTVASAFRKI
A0A0H3FEJ3_RAHSY      ISYCIADLEDAVEKSIFSVEQLYNYLCREW----------GAIEKNDFFDKVVRTAYEKM
A0A0H3I5H8_PECPM      VSYCIADLEDAVEKDILTIEELYDRLRENW----------GAGAEKDIFAKTIERAYKER
Q6D1Z5_PECAS          VSYCIADLEDAVEKDILTIEELYDRLRENW----------GTGAEKDIFAKTIERAYKER
C6DC26_PECCP          VSYCIADLEDAVEKDMLTIEELYDRLRENW----------GEGEEKDIFAKTIERAYKER
C6CNJ2_DICC1          ISYCIADLEDAVEKKIITYQQLYERLEEAW----------GERAEKDVFNRTVDLAYEER
D2BUB6_DICZ5          ISYCIADLEDAVEKKIITYQQLYHRLKEAW----------GERAEKDVFSRTVDLAYEER
E0SBJ5_DICD3          ISYCIADLEDAVEKKIVTYQQLYERLEDAW----------GTREEKDVFSRTIERAYTER
C6CB55_DICP7          ISYCIADLEDAVEKDIVSVDRLYQFMCAVW----------GDVKPGDLFRDTIGRAFESM
Q2NVP6_SODGM          ISYCIADLEDAVEKKIFTVEQLYLFLQKEW----------GSVVKGDLFDKVIGQAFNKI
D0ZD43_EDWTE          ISYCVADLEDTVEKHLLSVEQLYALLKDEW----------GAVTSGDLFSVTVQDAFDRC
C5BAP3_EDWI9          ISYCVADLEDTVEKHLLSVEQLYAFLKDEW----------GAVTSGDLFSITVQDAFERC
A0A198GRU5_9ENTR      ISYCVADLEDAVEKRIFSVEELYQHLYEAW----------GKHEKGSLFAQVVENAWEKS
A0A0H3CJ04_ENTCC      ISYCVADLEDAVEKRIFSVEELYQHLYDAW----------GKHEKGSLFAQVVENAWEKS
DGTP_ENT38            ISYCVADLEDAVEKRIFSVEELYQHLYDAW----------GTHEKGSLFSQVVENAWDKS
DGTP_SHIBO            ISYCVADLEDAVEKRIYTLEQLYHHLHDAW----------GQHEKGSLFSLVVENAWEKS
DGTP_ECOLI            ISYCVADLEDAVEKRIFTVEQLYHHLHEAW----------GQHEKGSLFSLVVENAWEKS
DGTP_ESCF3            ISYCVADLEDAVEKNIFSVEQLYHHLHEAW----------GEHEKGSLFAQVVENAWEKS
D2TI48_CITRI          ISYCVADLEDAVEKRIFSAEQLYHHLQEAW----------GVHEKGSLFALVVENAWEKS
DGTP_CITK8            ISYCVADLEDAVEKRIFSVEQLYHHLYEAW----------GHHEKGSLFTQVVENAWEKS
DGTP_SALCH            ISYCVADLEDAVEKRIFSVEQLYHHLYHAW----------GHHEKDSLFELVVGNAWEKS
DGTP_SALAR            ISYCVADLEDAVEKRIFSVEQLYHHLYHAW----------GHHEKDSLFELVVGNAWEKS
A0A0K0H7G8_SALBC      ISYCVADLEDAVEKRIFSVEQLYHHLYKAW----------GHHEKDSLFELVVGNAWEKS
DGTP_KLEP3            ISYCVADLEDAVEKRIFSAEQLYQHLYDAW----------GNHEKGSLFSQVVENAWEKS
A0A0H3FS31_KLEAK      ISYCVADLEDAVEKRIFSAEQLYQHLYDAW----------GTHEKGSLFAQVVENAWEKS
A0A0H3H3L2_KLEOK      ISYCVADLEDAVEKRIFSVEQLYQHLYEAW----------GVHEKGSLFNQVVENAWEKS
E3G918_ENTLS          ISYCVADLEDAVEKRIFSIEQLYQHLYDAW----------GQHQKGSLFSQVVENAWEKS
L0M6R0_ENTBF          ISYCVADLEDAVEKRIFSVEQLYQHLHDAW----------PEHGKGSLFAQVVENAWDKS
DGTP_CROS8            ISYCVADLEDAVEKRIFSVEQLYQHLYDAW----------GEHAPGDLFNLVVQNAWDKS
I2BCL2_SHIBC          ISYCVADLEDAVEKRIFTTGRLYQHLSGAW----------GDITAGDLFSQVVVDAWEKS
D2T5A9_ERWP6          ISYCVADLEDAVEKNIFTVEQLYQYLFQIW----------PHHQQDDLFASVVTSALDKS
E3DCV8_ERWSE          ISYCVADLEDAVEKNIFTVEQLYQYLFQIW----------PNHQQDDLFASVVTSALHKS
D4HZ88_ERWAC          ISYCVADLEDAVEKNIFTVEQLYQFLFQIW----------PNHQPGDLFASVVTSALDKS
B2VE29_ERWT9          ISYCVADLEDAVEKNIFDVEQLYHHLFKIW----------PEHQPGDLFATVVTSALDKS
D8MNC7_ERWBE          ISYCVADLEDAVEKNIFSVEQLYEHLYALW----------PSHKPNDLFNLVVTNALDKS
E1SDX0_PANVC          ISYCIADLDDAVEKDIFNVESLFEFLNKAW----------GPVKNNDAFSRTIGEAWREA
D4GKC2_PANAM          ISYCIADLDDAVEKAIFNVDSLYEFLSKAW----------GPINNNDAFSRTVGEAWREA
E6W959_PANSA          ISYCIADLDDAVEKDIFNVDTLYDYLLKAW----------GPIKPGDAFSRTIGEAWKEA
C4K6C0_HAMD5          ISYCIADLEDAVEKNIFNIDQLFHYLKEMA----------GAFVKNEIFDTVIHNAFKEA
Q7MB72_PHOLL          ISYCIADLDDAVEKAIFSVDTLMGYLEQEWQEN-------GGHRAGDLFDLTVRKAYKGT
C7BMT4_PHOAA          ISYCIADLDDAVEKDIFGVDMLMEYLKQEWQES-------GGHRAGDLFETTINEAYERT
D3VKK4_XENNA          ISYCIADLDDAVEKGIFNVEQLVEYLKKEWDDN-------GGHRKGDLFESTVTQAYKKT
D3V546_XENBS          ISYCIADLDDAVEKGIFNVEQLVEYLKKEWEEN-------GGHSKGDLFEFTVMQAHKKT
B4EUF1_PROMH          ISYCIADLDDAVEKGIFDINRLVQLLKNAWSES-------GAVTEGDLFDITVNRAFKKV
A0A140NJS7_PROSM      ISYCIADLDDAAEKGIFTVEQLINYLRNEW----------GVVEKGDLFDETIMSAFNNI
Q6LP60_PHOPR          ISYGIADIEDAVEKNIINRTHLGQILIKEYADL----FAEYESATANEMADIVKLASESA
F7YPY2_VIBA7          ISYGIADIEDAIEKGILNLQQLSDALNQEYHNI----ALKFGVKELNVMEDILNNVNKST
                      ::* :**::*: ** :     *   :                      :   :       

A0A0H2Z7X2_PSEAB      EREPINKVSE--FFIRLRVKMIHPLVQHAAQQFIDNLEAVHAGTLGRALMEDG-SLPHAI
A6V964_PSEA7          EQEPINKVSE--FFIRLRVKMIHPLVRHAARQFIDNLEAVHAGTLGRALVEDG-SLPHAI
A4VJX2_PSEU5          QKEPINKAGE--FFIWLRVNMIHPLVQHAARQFIDNIEAVYHGTLDRALLEDD-SLPNAI
F6AJQ6_PSEF1          HREEINKAGE--FFVKLRVSMIHPLVQHAARQFIDNIEAVHAGILDRALIEDD-SLPHAI
DGTP_YERPY            GREQGRRSSEDQFFMYLRVNTVGKLVPHAAQRFIENLPAVFSGSFNQALLEDS-SAACKL
DGTP_YERE8            GRGQGRRSSEDQFFMYLRVNTVGKLVPHAAQRFIENLPAVFSGSFNQALLEDS-SPACKL
DGTP_SERP5            AHGGARRSSEDQFFMYLRVFTVARLVPHAAQRFIDNLEAVYQGNFNQALLEDS-SPAYQL
A0A0H3FEJ3_RAHSY      DKAKTFRNPVDYFFMELRVQTVKQLVPHAARRFIDNIEDIYQGTFNHALLEDD-SQANRL
A0A0H3I5H8_PECPM      ERFQW-RSHDDQFFMNLRVYTVGQMVPHAALRFIDNLPAVYAGSFNQALLEDD-SPQNRL
Q6D1Z5_PECAS          ERFQW-RSHDDQFFMNLRVYTVGQMVPHAALRFIDNLPEIYTGSFNQALLEDD-SPQNRL
C6DC26_PECCP          KRLQW-RSQDDQFFMNLRVYTVGQMVPHAALRFLDNLPEVYAGSFNQALLEDD-SPQNRL
C6CNJ2_DICC1          QHLPG-RSESDQFFMKLRVNTVNTMVRYATRRFIENLPAIYDGSFNHSLLEEDKDDYGRL
D2BUB6_DICZ5          QHLPG-RSESDQFFMKLRVNTVNTMVRYATWRFIDNLPAIYEGSFNHSLLEEEKDDYGRL
E0SBJ5_DICD3          QHMQG-RSESDQFFMKLRVNTVNTMVGYVTRRFIEHLPAIYDGSFNRSLLEEDKDDYGRL
C6CB55_DICP7          SRRRW-RSENDQFFMNLRVNTVASLVPHAAQRFIRNLPAIFDGSFNQSLLEDD-GPHNRL
Q2NVP6_SODGM          RRYQG-LRSGDQFFMYLRVNTVARLVPHAAQRFLDNLAPIYDGRFNQALLEDS-SPAFRL
D0ZD43_EDWTE          NKKYGHRSADDIFFMYLRVNVVKRLVPYAADCFLNNLQHIFIGAFNEPLLSAG-AEEYRL
C5BAP3_EDWI9          NKKYGRRSADDIFFMYLRVNVVKRLVPYAADCFLKNLQHIFIGAFNEPLLSAG-AEEYRL
A0A198GRU5_9ENTR      RSNSLSRSTEDQFFMYLRVNTLNKLVPYAASRFIDNLPLIFSGEFNHALLEDD-SGFSQL
A0A0H3CJ04_ENTCC      RANTLSRSTEDQFFMYLRVNTLNKLVPYAASRFIDNLPMIFSGEFNHALLEDD-SSFSQL
DGTP_ENT38            RSNTLSRSTEDQFFMYLRVNTLNKLVPYSAARFIDNLPAIFSGDFNHALLEDD-SSFSQL
DGTP_SHIBO            RSNSLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDA-SECSDL
DGTP_ECOLI            RSNSLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDA-SECSDL
DGTP_ESCF3            HVNSLSRSTEDQFFMYLRVNTLNKLVPHAAQRFIDNLAEIFEGTFNHALLEDN-SSYSRL
D2TI48_CITRI          RANTLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLEQIFAGTFNQALLEDG-SSFSRL
DGTP_CITK8            RSNSLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFDGSFNHALLEDA-SSFSQL
DGTP_SALCH            RANTLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDA-SGFSRL
DGTP_SALAR            RANTLSRSTEEQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDA-SGFSRL
A0A0K0H7G8_SALBC      RANTLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIYAGNFNYALLEDA-SGFSRL
DGTP_KLEP3            RANYLRQSAEDQFFMYLRVNTLNKLVPYAARRFIDNLPAIFTGDFNHALLEDD-SDCSQL
A0A0H3FS31_KLEAK      RANSLSRSTEDQFFMYLRVNTLNKLVPYAAHRFIENLPAIFSGDFNHALLEDD-SDCSQL
A0A0H3H3L2_KLEOK      RANSLSRSTEDQFFMYLRVNTLNRLVPYAARRFIDNLAKIFSGDFNHALLEDD-SDCSQL
E3G918_ENTLS          RSNSLKHSAEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQVFAGDFNHALLEDD-SDCSQL
L0M6R0_ENTBF          RSNSLSRSTVDQFFMYLRVNTLNKLVPFAAQRFIDNLPDIYRGDFNHALLEDE-SDYSQL
DGTP_CROS8            GTNQLHHSAEDQFFMYLRVNTLNRLAPYAAQRFIDNLPDVFNGSFNHALLEDD-SPYSRL
I2BCL2_SHIBC          RTEHASSIAEDQFFMYLRVNTLNALVPYAARRFIDNLEAIYAGSFNQGLLEDG-GACSRL
D2T5A9_ERWP6          RSQQTHCYSEDQFFMYLRVNTVAQLVPYAASRFIDNLPAVYRGDFNQALLEDS-SPHSQL
E3DCV8_ERWSE          RSQQTHCYSEDQFFMYLRVNTVAQLVPYAASRFIDNLPAVYRGEFNEALLEDG-SPHSQL
D4HZ88_ERWAC          RSQQPHCYSEDQFFMYLRVNTVAQLVPYAADRFIDNLPAVYRGEFNEALLEDC-SPHSQL
B2VE29_ERWT9          RSQQTHCYSEDQFFMYLRVNTVAQLVPYAASRFIDNLPAVYRGDFNAALLEDG-SPHSQL
D8MNC7_ERWBE          RSSQTSRSSEDQFFMYLRVNTVSRLVPHAASRFIDNLPEVFDGKFNGALLEDG-NAQSQL
E1SDX0_PANVC          CSKK-RRSRSDQFFMSLRVNVQSVLVSYAVKRFVDNLPAIFEGSFNHALLEDE-GEEGRL
D4GKC2_PANAM          GSKK-RRSRSDQFFMSLRVNVQNVLVTYAVKRFIDNLPAIFDGNFNHALLEDG-GEEGRL
E6W959_PANSA          CQKK-WRTKGDQFFMALRVNVQNVLVSHAVRRFIDNLPAIFTGDFNHALLEDD-GEEGRL
C4K6C0_HAMD5          --KESWRNEEAEFFMCLRVQTMKVLVPYAVERFVNNLPEIFAGTFNQALLEDI-GPCSTL
Q7MB72_PHOLL          HGNELRRSQQDQFFMYLRVYITGKLVPYTARRFIDHLPAVFEGSFNQALLEDK-SEEHRL
C7BMT4_PHOAA          VGNELRRSQQDQFFMYLRVYITGKLVPYTARRFIDHLPTVFAGTFNQALLEDK-SEEHRL
D3VKK4_XENNA          ANNEARRNIHEQFFMYLRVFITGKLVPYTARLFIENLPEIYAGIFNHALLEGN-GDEHRL
D3V546_XENBS          ASNEARRSIHEQFFMYLRVFITGKLVPYTAKRFIENLPEIYAGTFNHALLEED-GDEHRL
B4EUF1_PROMH          DQNEAKRSMQDQFFMYLRVYITGKLVPYTAYRFIKNLPQVYEGNFNHALLEGK-SAEHRL
A0A140NJS7_PROSM      SDNHTRRIQQDQFFMYLRVNITSKLARYSAQRFIQNLPEIYAGRFNSALLEDK-SPEHRL
Q6LP60_PHOPR          ERAK--NCATSHFFITLRVEINRRLPKYAASQFIENIEAIYHGRFNRALIEDK-STQHAL
F7YPY2_VIBA7          KRSE--TCGNSQFFIGMRVEINKRLPQHACKQFIEHIEEVFNGNFNRALIEDK-SSHHTL
                                  **: :**     :  .    *: ::  :. * :.  *:.        :

A0A0H2Z7X2_PSEAB      VQTFKDVAMEWVFCHPEVETLELQGYRIIQGLLDFYAPLLRLPAEEFQALAE-GRQAAAP
A6V964_PSEA7          VQTFKDVAMERVFCHPEVETLELQGYRIIQGLLDFYAPLLRLPAEDFQALAE-GRQAATP
A4VJX2_PSEU5          VQTFKDVAMDKVFCHREVETLQLQGYRILQGLLDFYAPLLRVPAPVFDALTL-GGCRSEP
F6AJQ6_PSEF1          VQTFKDVAMARVFCHREVETLQLQGHRIIQGLLDSYGALLRVDAQTFVELTE-GSCRREA
DGTP_YERPY            LQIFKRVAVKHVFNHPEVEQLELQGYRVISGLLDIYSPLLAMPETAFTQLVADDRHRKYP
DGTP_YERE8            LQIFKKVAVKHVFNYPEVEQLELQGYRVISGLLDIYSPLLAMPQTAFTQLVAEDSHREYP
DGTP_SERP5            LKIFKNVAFKHVFNHPEVEQLELQGYRVISGLLDIYSPLLAMPLADFTLLVQEDSHRAYP
A0A0H3FEJ3_RAHSY      LEIYKAVAFKQVFNHHEVEELELQGYRVISGLLDIYSPLLDMPLTDFNQLVQEDTHRKYP
A0A0H3I5H8_PECPM      LGIFKHVALKHVFNHHEVEQLELQGDRVIRGLLDIYSPLLEMPYLDFSQLVREDTHRRYP
Q6D1Z5_PECAS          LGIFKHVALKHVFNHHEVEQLELQGDRVIRGLLDIYSPLLDMPYQDFSQLVSADTHKRYP
C6DC26_PECCP          LGIFKRVALKHVFNHHEVEQLELQGDRVIRGLLDIYSPLLEMPYQDFSQLVRDDTHRRYP
C6CNJ2_DICC1          LKIFKDVARKFVFNHHEVEQLELQGDRIISGLLEIYSPLLNMPYRDFCRLVTDDTHKRYP
D2BUB6_DICZ5          LKIFKDVARKFVFNHHEVEQLELQGDRIISGLLEIYSPLLNMPYRDFCQLVADDTHKRYP
E0SBJ5_DICD3          LKIFKDVARKFVFNHHEVEQLELQGDRIISGLLEIYSPLLNMPYHDFCQLVNDDTHKRYP
C6CB55_DICP7          LKVFKEVAVKHVFNHHEVEQLELQGYRVIGGLLDIYSPLLNMPYEDFRKLVAEESHRGYP
Q2NVP6_SODGM          LKIFKSVAFKHVFNHLEVEQLELQGYRVISGLLEIYNPLLEMSQADFQRLVTEDYHPAHP
D0ZD43_EDWTE          LNIFKQVALKHVFNHFEVEQLELQGYRVIKGLLDIYSPLLAMPQSDFLRLLRDDRHPDYL
C5BAP3_EDWI9          LNIFKQVALKHVFNHFEVEQLELQGYRVIKGLLDIYSPLLAMPQSDFLRLMRDDHHPDYL
A0A198GRU5_9ENTR      LELYKNVAMRHVFSHPDVEQLELQGYRVISGLLEIYRPLLQLSVDEFSELVEKERVRRLP
A0A0H3CJ04_ENTCC      LELYKHVAMRHVFSHPDVEQLELQGYRVISGLLEIYRPLLQLSVDEFSELVEQERVRRIP
DGTP_ENT38            LELYKNVAIRHVFSHPDVEQLELQGYRVISGLLDIYQPLLKLSVEEFTELVETDLMKRLP
DGTP_SHIBO            LKLYKNVAVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFP
DGTP_ECOLI            LKLYKNVAVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFP
DGTP_ESCF3            LELYKNVAQKHVFSHPEVEQLELQGYRVISGLLEIYRPLLSLPLSDFAELVEKERLKRFP
D2TI48_CITRI          LKLYKNVAIKHVFSHPEVEQLELQGYRVISGLLDIYRPLLSLPLADFSELVEKERLMRFP
DGTP_CITK8            LELYKNVAIKHVFSHPDVEQLELQGYRVISGLLEIYQPLLRMSLVDFRELVEKERVKRFP
DGTP_SALCH            LELYKNVAVEHVFSHPDVEQLELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKRFP
DGTP_SALAR            LELYKNVAVEHVFSHPDVEQLELQGYRVISGLLDIYQPLLSMSLNDFSELVEKERLKRFP
A0A0K0H7G8_SALBC      LELYKNVAIEHVFSHPDVEQLELQGYRVISGLLDIYQPLLAMSSGDFRELVEKERLKRFP
DGTP_KLEP3            LELYKNVAMKQVFSHPDVEQLELQGYRVISGLLDIYQPLLKLSLEDFSELVAQERVRRLP
A0A0H3FS31_KLEAK      LELYKNVAIKQVFSHPDVEQLELQGYRVISGLLDIYEPLLKLSLEEFSQLVEQDRVRSLP
A0A0H3H3L2_KLEOK      LELYKNVAVKHVFSHPDVEQLELQGYRVISGLLDIYQPLLKLSLDEFSLLVEKERVRSLP
E3G918_ENTLS          LELYKSVAVKHVFSHPDVEQLELQGYRVISGLLDIYQPLLKLSLRDFSELVEKDRLRHLP
L0M6R0_ENTBF          LDLYKKVAIKHVFSHSDVEMLELQGYRVISGLLEIYSPLLKLSQTDFTLLVEKERIVSLP
DGTP_CROS8            LELYKNVAVRHVFNHPDVEQLELQGYRVISGLLDIYSPLLALTLAQFRELVEKESVRSLP
I2BCL2_SHIBC          LDIYKQVAMQHVFNHPDVEQLELQGYRVITGLLDIYNILLTMPLSDFSELVKKETLRAFP
D2T5A9_ERWP6          LNIFKKVAFRHVFNHPDVEQLELQGYRVIRGLLDIYRPLLLLTREEFSELAARDYLKGYP
E3DCV8_ERWSE          LDIFKKVAFRHVFNHPDVEQLELQGYRVIRGLLDIYRPLLLLTREEFSELAARDYLKGYP
D4HZ88_ERWAC          LDIFKKVAFRHVFNHPDVEQLELQGDRVIRGLLDIYRPLLLLTREEFRELAARDYLKGYP
B2VE29_ERWT9          LDIFKKVAVRHVFNHPDVEQLELQGYRVIRGLLDIYRPLLQLTRKEFGELAANDYLKGYP
D8MNC7_ERWBE          LEIFKKVAFRHVFNHPDVEQLELQGYRVIKGLLDIYHPLLMLSQDEFSELIEKDYLKGYP
E1SDX0_PANVC          LQLFKTVARQQVFNHSEVEQLELQGYRVIKGLLEIYQPLMRLNYEAFTTLMNEDFLRQHP
D4GKC2_PANAM          LQIFKTVARQQVFNHSEVEQLELQGYRVIKGLLEIYQPLMMLNYEDFTTLINEDFLRNHP
E6W959_PANSA          LTLFKTVARQQVFNHPEVEQLELQGYRVIKGLLEIYQSLMLLDYEQFTTLMNDDFLAKHP
C4K6C0_HAMD5          LKLFKKVAQKYVFTHPEVEQIELQGYRIIIGLLNIYHPLLMMPFDSFSQLVFDNHHAEYA
Q7MB72_PHOLL          LRTLKNIACKRVFNHPEIEKLELQGYRIINGLLDFYYPLLKMPRQDFVELNQNNFHKDYF
C7BMT4_PHOAA          LKTLKNVACKRVFNHPEVEELELQGYKVINGLLDFYYPLLKMPRQHFVELDQNNCHEKYF
D3VKK4_XENNA          LRTLKNVTRKRVFNHPEVEELELQGYRIINGLLDVYSPLLALSRQDFMELNQNNFHKKYF
D3V546_XENBS          LQILKSVTRKWVFSHPEVEELELQGYRIITGLLDVYSPLLELSRQDFMSLHRNNFHKKYF
B4EUF1_PROMH          LTTLKRVAQKWVFSHPEVEELEMKGYRVISGLLDIYKPLLLLSTDDFLRLHKYNEHPHYV
A0A140NJS7_PROSM      LKVLKTVAFKHVFSHHEVEELELQGYRIIGGLLDFYRPLLMLEREDFISLVENNYHKQFF
Q6LP60_PHOPR          VQTLKNIAVKYAFCAPEVEARELQGYRIITGLLDIYKPILRLERNTFEQMIEGKRG-TPL
F7YPY2_VIBA7          VEALKSVARKYAFCDPDVEQSELQGYRIITGLLEAYKPLLMLDSNTFRNISE-----APL
                      :   * ::   .*   ::*  :::* ::: ***: *  :: :    *  :          

A0A0H2Z7X2_PSEAB      HPQLLVRRLPSQQIKAYLEAMKGVA----------EDPLQRQ-WEFYHRCRMLQDFVSGM
A6V964_PSEA7          HPQLLVRRLPSQQIKAYLEAMKSLD----------GAAPRQQ-WEFYYRCRMLQDFVSGM
A4VJX2_PSEU5          HLQMLARRLPNQLVKAYHEALKPHA----------ETSADRPLWEFYYRNRMLQDFISGM
F6AJQ6_PSEF1          YLQMLVRRLPSQLIKAYRQAVRECD----------EVD--RAAWEFYHRCRLVQDFISGM
DGTP_YERPY            IETRLFHKLSIKHRLAYAESAERIRN---------LPSEQYEIYEYYYRARLIQDYISGM
DGTP_YERE8            IETRLFHKLSTKHRLAYAESTERLRH---------LSPEQHEIYEYYYRARLIQDYISGM
DGTP_SERP5            IETRLFHKLSTKHRLAYIEAIEGLQH---------LSPEQLAIREYYFRARLLQDYISGM
A0A0H3FEJ3_RAHSY      IETRLLHKISAKHRLAYNNAVAALEG---------LPVAEHAAQEFYYRARMIQDYISGM
A0A0H3I5H8_PECPM      IETRLYHKLSSKHCLAYREAITELEG---------LPESERIVREYYYRARLIQDYISGM
Q6D1Z5_PECAS          IETRLYHKLSSKHCLAYREAVTELDG---------VAEPERIIREYYYRARLIQDYISGM
C6DC26_PECCP          IETRLYHKLSSKHCLAYCEAVAALEA---------LPENERIVREYYYRARLIQDYISGM
C6CNJ2_DICC1          IETRLYHKLSSKHCHAYREATRSLAA---------LSDKEQEVWEYYYRARLILDYISGM
D2BUB6_DICZ5          IETRLYHKLSSKHCHAYREATRPLAA---------LSDKEQEVWEYYYRARLILDYISGM
E0SBJ5_DICD3          IETRLYHKLSSKHCHAYREATCALPA---------LPAAEQEVWEYYYRARLILDYISGM
C6CB55_DICP7          IETRLYHKLSRKHCLAYCEATEGTAR---------LSAAEQEVWEYYYRARLILDYISGM
Q2NVP6_SODGM          IASRLYHKLSAKHRLAYGEAMETVNR---------YPAGQQSMMEFYYRARLIQDYISGM
D0ZD43_EDWTE          IETRLFHKLSVKHRLAYREAVDGLAA---------FDGTELQAREYYYRARLIQDYISGM
C5BAP3_EDWI9          IETRLFHKLSVKHRLAYREAVDSLAA---------FDGAQLQAREYYYRARLIQDYISGM
A0A198GRU5_9ENTR      IESRLYHKLSTRHRLAYVEAISKID----------RHSVQWPVLEYYYRCRLIQDYISGM
A0A0H3CJ04_ENTCC      IESRLYQKLSTRHRLAYVEAIGKLD----------RHSPQWPVLEYYYRCRLIQDYISGM
DGTP_ENT38            IETRLLHKLSTRHRLAYVEAVSKID----------RTTAQWPVMEYYYRCRLIQDYISGM
DGTP_SHIBO            IESRLFHKLSTPHRLAYVEAVSKLP----------SDSPEFPLWEYYYRCRLLQDYISGM
DGTP_ECOLI            IESRLFHKLSTRHRLAYVEAVSKLP----------SDSPEFPLWEYYYRCRLLQDYISGM
DGTP_ESCF3            IESRLFQKLSTRHRLAYVEAVGKLS----------SDSPEYPILEYYYRCRLLQDYISGM
D2TI48_CITRI          IESRLFQKLSTRHRLAYIEAVSKLA----------PDSLEYPVMEYYYRCRLIQDYISGM
DGTP_CITK8            IESRLFQKLSTRHRLAYVEAVSKLS----------PEAPEYPTLEYYYRCRLIQDYISGM
DGTP_SALCH            IESRLFQKLSTRHRLAYVEVVSKLP----------TDSAEYPVLEYYYRCRLIQDYISGM
DGTP_SALAR            IESRLFQKLSTRHRLAYVEVVSKLP----------MDSAEYPVLEYYYRCRLVQDYISGM
A0A0K0H7G8_SALBC      IESRLFQKLSTRHRLAYVEAVRKLA----------ADSAEYPVLEYYYRCRLIQDYISGM
DGTP_KLEP3            IASRLYQKLSTRHRLAYVEAVNKLV----------RTAPEFALMEYYYRCRLIQDYISGM
A0A0H3FS31_KLEAK      IASRLFQKLSTRHRLAYVEAVNKLS----------RDTEEYPVLEYYYRCRLIQDYISGM
A0A0H3H3L2_KLEOK      IASRLFQKLSTRHRLAYIEAVNKIS----------RNNPEFPVMEYYYRCRLIQDYISGM
E3G918_ENTLS          IESRLFHKLSTRHRLAYVEAVNKLE----------RHAAEFPIMEYYYRCRLIQDYISGM
L0M6R0_ENTBF          IESRLFQKLSRNHRLAYIEAVNKVS----------RDTAEFPVMEYYYRCRLIQDYISGM
DGTP_CROS8            IESRLYHKLSSRHRLAYIEAVSHLH----------PQAADFPVWEYYYRCRLIQDYISGM
I2BCL2_SHIBC          IASRLFHKLSSRHRLAYIDAVARLD----------NRASTFAVQEYYYRCRLIQDYISGM
D2T5A9_ERWP6          IETRLFHKLSSRFRLAYSEAVAQLD----------KNQQEEEIWEYYYRVRLLQDYISGM
E3DCV8_ERWSE          IETRLFHKLSSRFLLAYSEAVAQLD----------KNQQEEEIWEYYYRVRLLQDYISGM
D4HZ88_ERWAC          IETRLFHKLSSRFRLAYSEAVEQLD----------KNQQEEEIWEYYYRVRLLQDYISGM
B2VE29_ERWT9          IETRLFHKLSSRFRLAYSEAVEQLD----------KSPQEEAIWEYYYRARLLQDYISGM
D8MNC7_ERWBE          IETRLFHKLSTRFRLAYSEAVGRLD----------NRAGDIAIWEYYYRARMLQDYVSGM
E1SDX0_PANVC          IETRLFHKLSGKHRKAYLHKMRNLVV---------EHKYQRLLWERYYRFRLIQDYISGM
D4GKC2_PANAM          IETRLFHKLSGKHRKAYLYKMRTLVV---------EHKYERLLWERYYRFRLIQDYISGM
E6W959_PANSA          IETRLFHKLSGKHRKAYQQKMRTLVV---------AHKYERLLWERYYRSRLIQDYISGM
C4K6C0_HAMD5          IETRLFHKLPDKHRLAYQEAVKKLKD---------VSIEEKKIYEYYYRARLIQDYISGM
Q7MB72_PHOLL          METRLLHKLSTKHRLAYGEAVEKIVA---------TDQAEKDLLEFYYRARLIQDYISGM
C7BMT4_PHOAA          IETRMLHKLSTKHRLAYSEAVEKIIA---------TDESEKDLIEFYYRARLIQDYISGM
D3VKK4_XENNA          IETRLLHKLSTKHRLAYAEAVEGIVA---------TDETEKEVLEFYYRARLIQDYISGM
D3V546_XENBS          IETRLLHKLSTKHRLAYEEAVENIVA---------TDEVEKDVLEFYYRARLIQDYISGM
B4EUF1_PROMH          IETRLYHKLSIKHKLAYNEALEKIYD---------INSEEGKTLEFYYRTRLIQDYISGM
A0A140NJS7_PROSM      IETRLFHKLSNKHRLSYSEAIEGICA---------TNEIEKSILEFYYRARLIQDYISGM
Q6LP60_PHOPR          YETRLFKKLPNKHLRAYINAMETDA------INALPYKYNVDIWEFYFRVRLIQDYISGM
F7YPY2_VIBA7          YECRLYKKLPNKHLKAYNNAMQSLSKKNGADIPFVPFDFNEDVWEFYFRVRLIQDYISGM
                          : :::.     :*                           * *.* *:: *::***

A0A0H2Z7X2_PSEAB      TDQHAQDEYRALSAL--
A6V964_PSEA7          TDQHAQDEYRALSAL--
A4VJX2_PSEU5          TDQLAQDEYRALSAL--
F6AJQ6_PSEF1          TDQHAHDEYRTLFAL--
DGTP_YERPY            TDLYAYDEYRRLMAAE-
DGTP_YERE8            TDLYAYDEYRRLMAAE-
DGTP_SERP5            TDLYAYDEYRRLMAAE-
A0A0H3FEJ3_RAHSY      TDLYAYDEYRRLMAAE-
A0A0H3I5H8_PECPM      TDLYAYDEYRKLMAAD-
Q6D1Z5_PECAS          TDLYAYDEYRMLMAAD-
C6DC26_PECCP          TDLYAYDEYRKLMAAD-
C6CNJ2_DICC1          TDLYAYDEYRRLMAVD-
D2BUB6_DICZ5          TDLYAYDEYRRLMAVD-
E0SBJ5_DICD3          TDLYAYDEYRRLMAVD-
C6CB55_DICP7          TDLYAYDEYRRLMAAD-
Q2NVP6_SODGM          TDLYAWDEYRRLMAAE-
D0ZD43_EDWTE          TDLYAYDEYRRLMAAE-
C5BAP3_EDWI9          TDLYAYDEYRRLMAAE-
A0A198GRU5_9ENTR      TDLYAWDEYRKLMAVE-
A0A0H3CJ04_ENTCC      TDLYAWDEYRKLMAVE-
DGTP_ENT38            TDLYAWDEYRRLMAVE-
DGTP_SHIBO            TDLYAWDEYRRLMAVEQ
DGTP_ECOLI            TDLYAWDEYRRLMAVEQ
DGTP_ESCF3            TDLYAWDEYRRLMAVEQ
D2TI48_CITRI          TDLYAWDEYRRLMAVEQ
DGTP_CITK8            TDLYAWDEYRRLMAVE-
DGTP_SALCH            TDLYAWDEYRRLMAVEQ
DGTP_SALAR            TDLYAWDEYRRLMAVEQ
A0A0K0H7G8_SALBC      TDLYAWDEYRRLMAVEQ
DGTP_KLEP3            TDLYAWDEYRRLMAVE-
A0A0H3FS31_KLEAK      TDLYAWDEYRRLMAVE-
A0A0H3H3L2_KLEOK      TDLYAWDEYRRLMAVE-
E3G918_ENTLS          TDLYAWDEYRRLMAVE-
L0M6R0_ENTBF          TDLYAWDEYRRLMAVE-
DGTP_CROS8            TDLYAWDEYRKLMAVE-
I2BCL2_SHIBC          TDLYAWDEYRKLMAVE-
D2T5A9_ERWP6          TDLYAWDEYRRLMAVE-
E3DCV8_ERWSE          TDLYAWDEYRRLMAVE-
D4HZ88_ERWAC          TDLYAWDEYRRMMAVE-
B2VE29_ERWT9          TDLYAWDEYRRLMAVE-
D8MNC7_ERWBE          TDLYAWDEYRRLMAVE-
E1SDX0_PANVC          TDLYAWDEYRRLMAVE-
D4GKC2_PANAM          TDLYAWDEYRRLMAVE-
E6W959_PANSA          TDLYAWDEYRRLMAVE-
C4K6C0_HAMD5          TDLYAYDEYRRLMTSG-
Q7MB72_PHOLL          TDNYVYEEYRKFIVCT-
C7BMT4_PHOAA          TDNYAYEEYCKFTVRN-
D3VKK4_XENNA          TDHYAYEEYRKFMVTK-
D3V546_XENBS          TDHYAYEEYRKFMVSK-
B4EUF1_PROMH          TDHYAYEEYRKLMVCD-
A0A140NJS7_PROSM      TDHYAYEEYRKCMVSN-
Q6LP60_PHOPR          TDQFAFDEYRALMVID-
F7YPY2_VIBA7          TDQFAFDEYRAFHVID-
                      **  . :**    .