CLUSTAL format seed alignment for MF_00031

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RUVA_HELPY      MIVGLIGVVEKI-SA----LEVHIEVQGVVYGVQVSMRTAALL--EAG-QKARLKILQVI
RUVA_HELPJ      MIVGLIGVVEKI-SA----LEAHIEVQGVVYGVQVSMRTAALL--QTG-QKARLKILQVI
RUVA_CAMJE      MVVGIEGIITKKEPT----FIIVKCASGLSYGIFISLFCSAKI--QTQ-EKHEFFITQII
RUVA_BACHD      MIDYLRGTLTDIDHQ-----YAVVEVHGVGYQVYCPNPYEFE--KERD-SVITIYTFQYV
RUVA_BACSU      MIEFVKGTIDYVSPQ-----YIVIENGGIGYQIFTPNPFIY---KER--SQETIFTYHHI
RUVA_LISIN      MYDYIKGIVKTITPE-----YIVVETGQIGYQIITGNPFSFQ--RLEG-TEAQVFLYQHV
RUVA_LISMO      MYDYIKGTVTTITPE-----YIVVEAGQIGYQIITGNPFSFQ--RLEG-TEAQVFLYQHV
RUVA_STRPN      MYAYLKGIITKITAK-----YIVLETNGIGYILHVANPYAYS--GQVN-QEAQIYVHQVV
RUVA_STRP1      MYDYIKGQLTKITAK-----YIVVEANGLGYMINVANPYSFT--DSVN-QLVTIYLHQVI
RUVA_LACLA      MFEYLNGKLVKISPT-----NIVIDVAGIGYLISVANPYAWS--ALMN-TEVKIYVHQVI
RUVA_STAAM      MYAYVKGKLTHLYPT-----HVVVETAGVGYEIQTPNSYRFQ--KHLD-HEVLIRTSLIV
RUVA_CHLMU      MYEYIKGKLTHTDEA-----YVVIESFGIGYSIMLSERFLVDLRELMH-QEVLIYVHSVI
RUVA_CHLTR      MYEYIKGTLTHINES-----YVVIESFGIGYAIMLSERFLVDLRAFMH-QEVLIYVHSVI
RUVA_CHLPN      MYDYIRGTLTYVHTG-----AIVIECQGIGYHIAITERWAIECIRALH-QDFLVFTHVIF
RUVA_CLOAB      MYEYIKGKYIGINKD-----YIIVDNNGVGYKIFTSGNTMANMPKPE--EDVLIYLTQIV
RUVA_HATHI      MYEYIKGTYMGINKE-----YIVIENGDIGYKIHSSGYTIANMPNIG--EHIMLYLTQIV
RUVA_CLOPE      MYEYIRGQFQGISKD-----YVVIELNNIGYKIFTSGNTMSNMPKVG--DEVLLYLEQIV
RUVA_NOSS1      MISYLKGIVAGIQNVGSNRVILTLEVNGMGYDLQIPQRLAKQL-PTTG-DLVQIFTHYQV
RUVA_SYNY3      MIQFLQGQVVTVTKNIQNRWFLILSVNGVGYELQVPHSLAQQWTPPPP-EPQQVFTHLLV
RUVA_ECOLI      MIGRLRGIIIEKQPP-----LVLIEVGGVGYEVHMPMTCFYEL-PEAG-QEAIVFTHFVV
RUVA_SALTY      MIGRLRGIILEKQPP-----IVLLETGGVGYEVHMPMTCFYEL-PEAG-QEAIVFTHFVV
RUVA_YERPE      MIGRLRGIILEKQPP-----LVLLETNGVGYEVQLPMTCFYEL-PELG-QEAIIFTQFVV
RUVA_VIBCH      MIGRLRGTLIEKLPP-----QILIEVGGIGYEVQMPMSCIYEL-PNIG-EEAIIYTHFVV
RUVA_HAEIN      MIGRLQGILLEKQPP-----EILLNVQGVGYELLLPMTSFYDL-PEIG-QETTLFTHLVV
RUVA_PASMU      MIGHLTGRLVEKHPP-----EILLDVQGVGYELLLPMTSFYQL-PDIG-QQTALFTHLVV
RUVA_PSEAE      MIGRLRGTLAEKQPP-----HLILDVNGVGYEVEVPMTTLYRL-PSVG-EPVTLHTHLVV
RUVA_XYLFA      MIGRLRGVLTSKTPP-----WLVVDVCGVGYELEVPMSTFYEL-PNVG-YEVNLFTHYTQ
RUVA_NEIMA      MISRLTGKLVEKNPP-----QIVIDVNGVGYEADVSMQTFYNL-PPVG-ESVQLFTQLII
RUVA_NEIMB      MISRLTGKLVEKNPP-----QIVIDVNGVGYEADVSMQTFYNL-PPVG-ESVQLFTQLII
RUVA_RALSO      MIGRIAGTLIEKNPP-----HLLVDCHGVGYEIDVPMSTFYNL-PATG-EKVALLTQQIV
RUVA_BRUME      MIGKLKGVIDEIAED-----HAVIDVHGVGYVAFCSARTLGNLG-GAG-EAAILFIETYV
RUVA_RHIME      MIGKLKGTIDEIGED-----HVVLDVHGVGYVAHCSARTLGKLG-SAG-EAAVLFIETYV
RUVA_RHILO      MIGKLKGTLDEIDED-----HCLVDIHGVGYVAYCSARTLAALP-SPG-EAVVLFIETYV
RUVA_RHIEC      MIGKLKGTIDEIGED-----YVLVDVQGVCYVAYCSARTLSKLG-SAG-EACVLFIETYV
RUVA_CAUVC      MIGRLRGAVAEVGEE-----EALIDVMGVGYLVRCGHRTLQRLP-ALG-EETLLHIESQW
RUVA_RICCN      MIGQLSGKVDSQGDD-----YVIIDVNGVGYLVYASGKTLGKL--AEG-EFYKLFIETHV
RUVA_RICPR      MIGKLNGKIDSHCDD-----YVIIDVNGVGYLVYASGKTLAKL--VEG-KFYKLFIETHV
RUVA_DEIRA      MIAYLSGVVREVREG-----SAVVVAGGVGYEVQCPAGMLARL--KPG-EAAEFSTRFIV
RUVA_THET8      MIRYLRGLVLKKEAG-----GFVLLAGGVGFFLQAPTPFLQAL--EEG-KEVGVHTHLLL
RUVA_MYCLE      MIFSVRGEVLEVALD-----HAVIEAAGIGYRVNATPSALATL--RQG-SQARLVTAMVV
RUVA_MYCTU      MIASVRGEVLEVALD-----HVVIEAAGVGYRVNATPATLATL--RQG-TEARLITAMIV
RUVA_STRCO      MIAFVSGTVAALAPD-----AAVIEVGGVGMAVQCTPNTLSTL--RLG-KPAKLATSLVV
RUVA_MYCGE      MITSIFGKVTFVGKR-----KIIVEHNWISYWFNTKENHKFEKNLEKNKQIFCHIIKKIV
RUVA_MYCPN      MIASIFGKITFVGKR-----KIIVEANCISYWFNVKENHSFEKNLEKPRQVFCQIIKRMV
RUVA_THEMA      MIAGISGRVLKKSGN----VLLVETKSGVVFEIVCDVQTSEEVK-EGG--ECFLHTFLSV
RUVA_TREPA      MFESISGILTLHERE-----RLCVEVHGIEWEIAVSAYSSAAF--GEVGSHVKVFTWLYH
RUVA_BORBU      MINKIHGKVIEKKES-----SLVLMTTVFEFELLVSAFCLANF--NLS-DKVELFTYLYT
RUVA_MYCPU      MLLYRLGKIIHVNKK-----YIIFESDSAGYTINITRAENFE---KD--RTLKLYIYELS
RUVA_UREPA      -MNYLIFKVIYANAN-----IVVGEHNFIGYQIRIPKDYELEINKFCKLYLYEYISIMPN
                                                                            

RUVA_HELPY      KEDA-HLLYGFLEEGEKILFERL-LKINGVGGRIALAILSSFSP-NEFESIIATKEVKRL
RUVA_HELPJ      KEDA-HLLYGFLEESEKILFERL-LKINGVGGRIALAILSSFSP-NEFENIIATKEVKRL
RUVA_CAMJE      KEDS-NKFYGFLDKDEQKMFEML-LKVNGVGANTAMAVCSSLDV-NSFYKALSLGDESVL
RUVA_BACHD      REDV-IRLYGFRTKEKRSLFEKL-LNVSGIGPKGALAILATGQP-EHVIQAIEEEDEAFL
RUVA_BACSU      REDA-FSLYGFSTREEKALFTKL-LNVTGIGPKGALAILGSGDP-GAVIQAIENEDEAFL
RUVA_LISIN      REDN-ISLFGFQSTEERYLFKKL-LSVSGIGPKSALAIIASGDV-VPLITAIESEDDVYL
RUVA_LISMO      REDN-ISLFGFQTTEERYLFKKL-LSVSGIGPKSALAIIASGDV-VPLISAIESEDDVYL
RUVA_STRPN      REDA-HLLYGFRSEDEKKLFLSL-ISVSGIGPVSALAIIAADDN-AGLVQAIETKNITYL
RUVA_STRP1      REDA-HLLFGFHTEDEKDVFLKL-ISVSGIGPTTALAIVAVDDN-EGLVNAIDNSDIKYL
RUVA_LACLA      REDA-HSLYGFVNEAEKALFLRL-ISVSGIGPKSALAIIAAADN-EGLITAIDNSDIKYL
RUVA_STAAM      REDA-QLLYGFSSEEEKDMFLSL-IKVTGIGPKSALAILATSTP-NEVKRAIENENDTYL
RUVA_CHLMU      RETE-HSLYGFSSRAERECFRLL-ISFSGIGPKTGLAILNMFPL-QELCSVARLENVKAI
RUVA_CHLTR      RETE-HVLYGFSSRAERECFRLL-ISFSGIGPKTGLSILNMFPL-QELCSIARLENVKAI
RUVA_CHLPN      RETE-HLLYGFHSREERECFRIL-ISFSGIGPKLALAILNALPL-KVLCSVVRSEDIRAL
RUVA_CLOAB      RQDF-IGLYGFLTKDELEMFNKL-LTINGVGAKASLSLLSICTV-NNLKYAIITGDEKTI
RUVA_HATHI      REDF-IGLYGFGSKEELELFNKL-LTVNGIGAKASLSLLSITNV-ENLKRAIVLEDEKLL
RUVA_CLOPE      REDF-IGLYGFTTREELEMFKLL-LSINGVGAKAALSLLSISTV-NNLKYAIMMGDEKHI
RUVA_NOSS1      REEI-PLLYGFSSPAERDLFRHL-LSVSGVGAASAIALLDTLEL-PDLVQAIIAANVQIL
RUVA_SYNY3      RQDQ-IALFGFGRLAERDLFGQL-MGVTGIGAQLAIALIETLGL-EGLVQAVVTGNVKQL
RUVA_ECOLI      REDA-QLLYGFNNKQERTLFKEL-IKTNGVGPKLALAILSGMSA-QQFVNAVEREEVGAL
RUVA_SALTY      REDA-QLLYGFNNKQERTLFKEL-IKTNGVGPKLALAILSGMSA-QQFVNAVEREELGAL
RUVA_YERPE      REDA-QLLYGFNNKQERALFREL-IKVNGVGPKLALAILSGMSA-QQFVGAVEREDITTL
RUVA_VIBCH      REDA-QLLYGFNTVSERALFREV-IKANGVGPKMGLAILSGMTA-NQFVTCVEKEDISTL
RUVA_HAEIN      REDA-HLLFGFAQKTDRTLFREL-IKTNGVGPKLALAILSAMSV-EQFAYAIEREELSKL
RUVA_PASMU      REDA-HLLFGFSQKTDRTLFREL-IKTNGVGPKLALAILSAMSV-EEFAYAIEREELSKL
RUVA_PSEAE      REDA-HLLYGFAEKRERELFREL-IRLNGVGPKLALALMSGLEV-DELVRCVQAQDTSTL
RUVA_XYLFA      KDDS-AALYGFLSESERRLFRHL-QRVSGIGTKIALAVLSSVSV-DTFAGLIQAGDVNAL
RUVA_NEIMA      REDA-HLLFGFATAEERKTFRQL-IKVGGIGAKTALGILSAMTA-DELAQAVAEEDVKRL
RUVA_NEIMB      REDA-HLLFGFATAEERKTFRQL-IKVGGIGAKTALGILSAMTA-DELARAVAEEDVKRL
RUVA_RALSO      REDA-HLLYGFGTAAERETFRQL-IKISGIGARIALAVLSGMSV-AELAQAVTLQEAGRL
RUVA_BRUME      REDM-IRLYGFATQLEREWFRLL-QNVQGVGAKVALAVLGTLSP-SELANAIALRDIAMV
RUVA_RHIME      REDQ-LKLFGFLSALEREWFRLL-QSVQGVGSKVALAVLSTLTP-GELANAIALQDKTSI
RUVA_RHILO      REDM-LRLYGFQSALEREWFRLLLNNVPGVGAKVALAILSTLAP-ADLANAIALRDIAMV
RUVA_RHIEC      REDQ-LKLFGFMTALEREWFNLL-QSVQGVGAKVALAVLSTLTP-GELANAIALQDRAAV
RUVA_CAUVC      SESAGLRLYGFLTREDRRAFVLL-QAIQGVGPKAAMAVLDVLSP-AELASAVAREDKAAV
RUVA_RICCN      REEH-IHLYGFLTLEEKIFFNLL-QSVNGIGTRMALFILSSLTP-SDIQIAVNNEDKNIF
RUVA_RICPR      REEH-IHLYGFLTLEEKNFFNLL-QSVNGIGTKMALSILSNLTP-TDIQIAINNDDRNIF
RUVA_DEIRA      REDA-QLLFGFPDADHLKLFDLL-TSVSGVGPKLGLALLSAMPV-SALAAGLIGGDVKLL
RUVA_THET8      KEEG-LSLYGFPDEENLALFELL-LSVSGVGPKVALALLSALPP-RLLARALLEGDARLL
RUVA_MYCLE      REDS-MTLYGFSDAENRDLFLAL-LSVSGVGPRLAMATLAVHDA-AALRQALADSDVASL
RUVA_MYCTU      REDS-MTLYGFPDGETRDLFLTL-LSVSGVGPRLAMAALAVHDA-PALRQVLADGNVAAL
RUVA_STRCO      REDS-LTLYGFADDDERQVFELL-QTASGVGPRLAQAMLAVHQP-DALRRAVATGDEKAL
RUVA_MYCGE      ANQIIEEAFAFNTLEEKEWFCRL-IELNGIGSKTALNLLNNDLE--EIKQYILENNYSAL
RUVA_MYCPN      TNQILEEGFAFNTLEEKEWFSKF-IELNGIGSKTALNLLNNNLE--EMRDYIKNSNYHAL
RUVA_THEMA      SQDG-ITLYGFSNEMKKELFLSL-TKVSRLGPKTALKIISNEDA-ETLVAMIASQDVEGL
RUVA_TREPA      REDA-LRLFGFSNVQERTLFLSL-TKVEGIGPKQALKVLSSISS-QALCAALDTGDLCAL
RUVA_BORBU      RENE-LKLFGFLNSDEREIFKEL-IGVSGVGPRAALRVLSNIRY-NEFKEAIDKEDIELV
RUVA_MYCPU      NEYQ-KTLYGFTHFKERVLFEDL-ISINGIGPRIALILLNDGWE--KIASLIANGNWETL
RUVA_UREPA      KNLIIKDLYGFRTYNERLLFIDL-ISINSIGPKTAINILKYDID--TIIDAIATKNIDYL
                 :      :.*        *  .       .                        :   .

RUVA_HELPY      QQVPGIGKKLADKIM-VDLIGFFIQDENRP-----------------------ARNEVFL
RUVA_HELPJ      QQVPGIGKKLADKIM-VDLIGFFIQDENRP-----------------------ARNEVFL
RUVA_CAMJE      KKVPGIGPKSAKRII-VELSDTKTKLENVSD----------------------DKSEALA
RUVA_BACHD      VKFPGVGKKTARQII-LDLKGKVDELHPGLFSQKEEQPKP-----HEKNDGNQALDEAME
RUVA_BACSU      VKFPGVGKKTARQII-LDLKGKLADVVPEMIENLFNHEER-----LEKQTAETALEEALE
RUVA_LISIN      TKFPSVGKKTARQII-LDLKGKLADVVASEIVYKAAEND-------IVTGLSPQLEEAVL
RUVA_LISMO      TKFPSVGKKTARQII-LDLKGKLADVVASEIVYVAPEND-------MVAGLSPQLEEAVL
RUVA_STRPN      TKFPKIGKKTAQQMV-LDLEGKVVVAGDDLPAKVAVQAS----------AENQELEEAME
RUVA_STRP1      MKFPKIGKKTAQQMV-LDLAGKFVEAPQETGHTKARSNK----------AGNTQLDEAIE
RUVA_LACLA      TKFPGVGKKTAMQMV-LDLAGKF-DATGTVGISLLDAGP----------AGNLALEEAIE
RUVA_STAAM      TKFPGIGKKTARQIV-LDLKGKVKITEEDSDSLLQVDAT--------STVQDQFVQEAML
RUVA_CHLMU      ASVPGIGKKTAEKLM-VDLKQKLPALMPLYLEEPVVASS----------STTTSFKEGIG
RUVA_CHLTR      ASVPGIGKKTAEKLM-VDLKQKLPTLMPLYLEEPVVPSS----------TANSSFKEGIG
RUVA_CHLPN      ASVSGIGKKTAEKLM-VELKQKLPDLLPLDSRVETSQTH----------TTSSCLEEGIQ
RUVA_CLOAB      VKAPGIGKKTAQRII-LELKDKFKSTDISKGNSEINNLD------VDYDEHSKKLEEVRF
RUVA_HATHI      IKAPGIGKKTAQRII-LELKDKL-DVNLDEGIQTDSN---------DIKVSSKILEEAKE
RUVA_CLOPE      TRAPGIGKKTAQRII-LELKDKLKPDELTSEEGQLIEGI------NDNSDYSFNINETLS
RUVA_NOSS1      IQAPGVGKKIAERVC-LELKAKLIEWRKSAGFFVATEG----P--APGILE-----EVQM
RUVA_SYNY3      CQTPGVGKKGAERLA-LELKTKLSQWHKLQMGTGETDSTL--P--TTALLE-----DLEM
RUVA_ECOLI      VKLPGIGKKTAERLI-VEMKDRFKGL-HGDLFTPAADLVLTSP--ASPATD-DAEQEAVA
RUVA_SALTY      VKLPGIGKKTAERLI-VEMKDRFKGL-HGDLFTPAVDLVLTSP--ASPTSE-DAEQEAVA
RUVA_YERPE      VKLPGVGKKTAERLV-VEMKDRFKGL-NGDLFNNTGDISLPTA--SPQTSDADIEAEAAS
RUVA_VIBCH      IKLPGVGKKTAERLV-VEMKDRLKGWGAGDLFTPATDAAPVDS--TPVIAQ-NAQEEAMS
RUVA_HAEIN      TKIPGVGKKTAERLL-VELKGKFKGVKQSDFFVESTHIPLSPS--IESHSE-SSSDEAIS
RUVA_PASMU      VKIPGVGKKTAERLL-VELKGKFKGIQQEDFFIESQHLKQPEH--ALNEQD-IPASEAIS
RUVA_PSEAE      VKIPGVGKKTAERLL-VELKDRFKAW---ENMPTIAPLVMEPR--ASATVS-SAEADAVS
RUVA_XYLFA      TVIPGIGKKTAERML-VELRDRAADF--NNGISTSGKLNL-------DTVS-----EAAL
RUVA_NEIMA      SSAPGIGKKTAERMV-LELRGKLVAH------AVTDGLFAAAP--AADETE-----DIVG
RUVA_NEIMB      SSAPGIGKKTAERMV-LELRGKLVAH------TVTDGLFAAAP--AADETE-----DIVS
RUVA_RALSO      TRIPGIGKKTAERLL-LELKGKLGAD------LGTVP--GGPA--VSDDAV-----DVLN
RUVA_BRUME      SRAPGVGKKVAERIV-TELKNKAPAFAGEASGTIGLKQEL------GAGAAPAPVADAVS
RUVA_RHIME      SRAPGVGPKVAVRIV-TELKNKAPAFSGEMAPSIGLKQEL------GEGVAAAPVADAVS
RUVA_RHILO      SRAPGVGKKVAERIV-TELKNKAPAYAGAASGTIGLKQEL------GEGVAPAPITDAVS
RUVA_RHIEC      SRAPGVGPKVAMRLV-TELKNRAPAYAGEAI-NIALKREL------GEGVAAAPVADAVS
RUVA_CAUVC      GRANGVGPKLALRIV-TELKDK-PITDGPVLMSAPTSSAP------SAPAKPAPTGDAVA
RUVA_RICCN      KAISGVGAKLAERIV-LELKGKVAKISSGSA--IIKESLN------IKNITPVASNEVIK
RUVA_RICPR      KAISGVGAKLAERIM-LELKDKITKIFSSSA--IIKDS----------NISSIAINEVMK
RUVA_DEIRA      SSVSGVGKKTAERLA-LELSSKVPEHLAAAA-SGAAGGKR------PARVSSTAGHDAVD
RUVA_THET8      TSASGVGRRLAERIA-LELKGKVPPHLLAGE-----------------KVESEAAEEAVM
RUVA_MYCLE      TRVPGIGKRGAERIV-LELRDKVGPVGASGL-T-VG----------TAADGNAVRGSVVE
RUVA_MYCTU      TRVPGIGKRGAERMV-LELRDKVGVAATGG----A-----------LSTNGHAVRSPVVE
RUVA_STRCO      TAVPGIGKKGAQKLL-LELKDRLGEPIGAP----AV----------GAPVSTGWRDQLHA
RUVA_MYCGE      CGINGVNNKIARALLSLEIFEKSENNKNIK-----------------GVQVADGYDELFE
RUVA_MYCPN      TKLTGSNSKVARALLALELYDRDDGGKRIKP----------------NTAMANDYDEMFD
RUVA_THEMA      SKLPGISKKTAERIV-MELKDEFESAGIKDM-------------------R--IYHESLE
RUVA_TREPA      QRIPGIGKKTAQRML-LALKGTLALTDAASCAQSQTDDRAAHPSNLGCAPHAREIEDLVT
RUVA_BORBU      SKIKGIGKKMAGKMF-LHLQGKLLINSELE----S--------------TGLFRFKELEE
RUVA_MYCPU      SRYPYINVKNCHQII-FELQNKWAKFLEKDE----------K----VPSANIQNISDATE
RUVA_UREPA      ITIKGINQRNANLIC-DQLNYKYINKVNDKN---------------------NWAKELSI
                      . : .  :    :                                         

RUVA_HELPY      ALESLGFKSAEINQVLKTLKPN---------LSIEAAIKEALQQLRS-----------
RUVA_HELPJ      ALESLGFKSAEINPVLKTLKPH---------LSIEAAIKEALQQLRS-----------
RUVA_CAMJE      ALLTLGFKQEKIISVLVSAQAT---------GTSEL-IKEALKKLG------------
RUVA_BACHD      ALKALGYVEKELKKVKPKLEQET--------LTTDAYIKKALQLMLNR----------
RUVA_BACSU      ALRVLGYAEKEIKKVLPHLKEEIG-------LTTDQYVKKALQKLLK-----------
RUVA_LISIN      ALEALGYSTRELKKVIPKMAKEND-------LTSDAYIKLALRLMTK-----------
RUVA_LISMO      ALEALGYSTRELKKVIPKLAKEAD-------LTSDAYIKLALQLMTK-----------
RUVA_STRPN      AMLALGYKATELKKI-KKFFEGTT-------DTAENYIKSALKMLVK-----------
RUVA_STRP1      ALLALGYKAKELKKI-RAFFEGTS-------ETAEQYIKSALKLLMKG----------
RUVA_LACLA      ALQALGYKATELKKIEKKLAQETG-------LTSEEYIKSALKLMMK-----------
RUVA_STAAM      ALEALGYSKRELAKVEKTLNKNKY-------DSVDEAVKAGLQLVVS-----------
RUVA_CHLMU      ALMNLGFSRLAADRMMTEAVKELSED-----ASVAELLPVALRKG-------------
RUVA_CHLTR      ALMNLGFSRLAADRMMTEAVKELSEE-----ASVAELLPIALRKS-------------
RUVA_CHLPN      ALAALGYSKIAAERMIAEAIKDLPEG-----SSLTDILPIALKKNFSGVNKD------
RUVA_CLOAB      ALNSLGYSEKETDRAINNVDKSE---------GIENIIKSCLRFLMN-----------
RUVA_HATHI      ALMSLGYSEKECEKALKNVEEKE---------SLEIIIKESLKFLMN-----------
RUVA_CLOPE      ALMALGYTEKEAQKALEKVDKTL---------SIENMIKESLKLLMR-----------
RUVA_NOSS1      TLFALGYTAHEVSHALHVVSEDIGLP-KD--AYVEDWIKQAIAHLSSSEQVSH-----
RUVA_SYNY3      TLLALGYTQTEIQQAIAMVSQVPDVA-QS--EDPEVWIRQAIGWLSDH----------
RUVA_ECOLI      ALVALGYKPQEASRMVSKIAR------PD--ASSETLIREALRAAL------------
RUVA_SALTY      ALVALGYKPQEASRMVSKIAR------PD--ASSETLIRDALRAAL------------
RUVA_YERPE      ALVALGYKPQEASRLVSKIAK------PG--ADCETLIRDALRAAL------------
RUVA_VIBCH      ALLALGYKPPQASKAVSQVAK------AG--MSSEELIREALKSMV------------
RUVA_HAEIN      ALIALGYKPVEAEKMVKRVAK------PE--LTSEQVIREALKVAL------------
RUVA_PASMU      ALIALGYKAAEAEKLVKKISK------PA--LSSEQLIREALKAAL------------
RUVA_PSEAE      ALIALGFKPQEASRAVAAVPG------ED--LSSEEMIRQALKGMV------------
RUVA_XYLFA      ALQQLGYKPAEAARMARDAGT------ES--DDVASVIKKALQAALR-----------
RUVA_NEIMA      TLLALGYSEREAKAAVKGVP-------EG--TDVGEGVRLALKNLLK-----------
RUVA_NEIMB      TLLALGYSEREAKAAVKGVP-------EG--TDVGEGVRLALKNLLK-----------
RUVA_RALSO      ALLALGYSDKEAAQAIKQVP-------AG--TGVSEGIKLALKALSKG----------
RUVA_BRUME      ALSNLGYSRDQAANAVAAALKETGEG-----ADSAKLIRLGLKELSQ-----------
RUVA_RHIME      ALTNLGYSRDQAANAVAAALKNGGEG-----GDSAKLIRLGLKELSR-----------
RUVA_RHILO      ALVNLGYSRDTAANAVAAALKTAGED-----ADASKLIRFGLKELAR-----------
RUVA_RHIEC      ALTNLGYSRDQAANAVAAAMKTAGEG-----ADSAKLIRLGLKELAR-----------
RUVA_CAUVC      ALMGLGVAEVNARRVVEAAAAELGEE-----ATVQALIKAGLKELGR-----------
RUVA_RICCN      ALVNLGFSRFEAQNAVQGIITQNPE------ISIDELIKTALKNRNSNF---------
RUVA_RICPR      ALVNLGFTRFEAQNTVQGIITQNPK------ISIDELIKTALKNRNSSF---------
RUVA_DEIRA      ALLALGFREAQVRAAVAELLGADP----E--ASADTLIRKALGRLR------------
RUVA_THET8      ALAALGFKEAQARAVVLDLLAQNP----K--ARAQDLIKEALKRLR------------
RUVA_MYCLE      ALVGLGFAAKQAEEATDQVLDGELGKDGA--VATSSALRAALSLLGKTR---------
RUVA_MYCTU      ALVGLGFAAKQAEEATDTVLAANH-D--A---TTSSALRSALSLLGKAR---------
RUVA_STRCO      ALIGLGYATREADEAVSAVAPQAEAAGGT--PQVGALLKAALQTLNRAR---------
RUVA_MYCGE      TLKSLGYKQQEIQDALKMIEVKPD-------FDISQLVAEVIKLMSFKNNEITNKTA-
RUVA_MYCPN      TLKSLGYKPQDIQNALSKIEIKPN-------FDVSEVIAEVIKLMSFQNNEVTNKTA-
RUVA_THEMA      ALVSLGYPEKQAREAVKQVYRE-G-------MKTSELIKEALKFLSHR----------
RUVA_TREPA      ALVQMGYDRKMAAEVIAQESAALCSVGRSLYEEEATVLKRAILALSIAHPHAVAPAAE
RUVA_BORBU      SIVSMGFDRKIVNSKIREAFNLAEFANLKDSEKEQFLFKEVLKRISN-----------
RUVA_MYCPU      TLKMLGFKREQIKYALESANLQ---------DDVETLVENAIKKISTVNGKEARN---
RUVA_UREPA      GLENLGYTKKDIEYAITKVKINSQQD-----IDISEIISSAIKEISLRHEN-------
                 :  :*                               .   :