CLUSTAL format seed alignment for MF_00033

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURG_ACICJ       ------------------------------MRGAMLNP------------IVIAAGGTGG
MURG_GRABC       -----------------------------MRRDQAQRP------------IIIAAGGTGG
MURG_GLUOX       ----------------------------------MNRP------------IVIAAGGTGG
MURG_RHILO       ---------------------------------MARGV------------ILLAAGGTGG
MURG_RHOPA       --------------------------------MTDAPL------------ILLAAGGTGG
MURG_BARBK       --------------------------------MTNKKV------------VVLVAGGTGG
MURG_ZYMMO       --------------------------------MNGSRQ------------YILAAGGTGG
MURG_SPHAL       --------------------------------MTATRH------------FLLAAGGTGG
MURG_MAGSA       --------------------------------MSTQKP-----------LIALAAGGTGG
MURG_RHORT       --------------------------------MNASMPRDGALLVNAPLHIALAAGGTGG
MURG_HYPNA       -----------------------------MADTGTEKL------------VIIAAGGTGG
MURG_MARMM       ---------------------------------MTPRR------------CLIAAGGTGG
MURG_CAUVC       ----------------------------------MSKL------------AVVAAGGTGG
MURG_JANSC       ---------------------------------MSKPH------------LIIAAGGTGG
MURG_PARDP       --------------------------------MSAAPL------------CLIAAGGTGG
MURG_WOLTR       ------------------------------------------------MDIVLATGGTGG
MURG_ANAMM       -----------------------------------------------MKKVVLAAGGTGG
MURG_RICTY       -----------------------------------------------MKKIILVAGGTGG
MURG_ORITB       -----------------------------------------------MKTIFLVGGGTGG
MURG_KORVE       ------------------------------------------------MRAILAGGGTGG
MURG_SOLUE       -------------------------------------MTHQQTLPTTAASFLMAGGGTGG
MURG_MYXXD       -----------------------------------------------MMKVLIAGGGTGG
MURG_SYNAS       ----------------------------------------------MTVRVIIAGGGTGG
MURG_PELCD       ------------------------------------------------MKLLLAGGGTGG
MURG_PELPD       ------------------------------------------------MKLIIAGGGTGG
MURG_MAGMM       -------------------------------------------MNNTPRRLLIAGGGTGG
MURG_BDEBA       --------------------------------------------MTVKKNIVIAGGGTGG
MURG_DESPS       ------------------------------------------MKETRRKRILLTGGGTGG
MURG1_BACC1      ------------------------------------------------MRVLVSGGGTGG
MURG1_BACAN      ------------------------------------------------MRVLVSGGGTGG
MURG_LISIN       ------------------------------------------------MKVAISGGGTGG
MURG_ENTHR       ------------------------------------------------MKILVTGGGTGG
MURG_LACLA       ------------------------------------------------MRIIITGGGTGG
MURG_LACSS       ---------------------------------------------------MISGGGTGG
MURG_LACP3       ------------------------------------------------MRLVISGGGTGG
MURG_LEUMM       ------------------------------------------------MKIILSGGGTGG
MURG_OENOB       ------------------------------------------------MRIIVSGGGTGG
MURG_LACJO       ------------------------------------------------MRVIFSGGGTGG
MURG_HUNT2       ------------------------------------------------MKVIISGGGTAG
MURG_CALS4       ------------------------------------------------MRYLFAGGGTGG
MURG_CLOD6       -----------------------------------------------MMKVLLSGGGTGG
MURG_CALS8       -------------------------------------------MNSGEISIVFSGGGTGG
MURG_DESHY       ------------------------------------------------MRVIVTGGGTGG
MURG_MOOTA       ------------------------------------------------MRVIITGGGTGG
MURG_SYNWW       ------------------------------------------------MKFIITGGGTGG
MURG_CARHZ       ------------------------------------------------MKLVFAGGGTGG
MURG_SYMTH       ------------------------------------------------MRYLITGGGTGG
MURG_FLAPJ       ---------------------------------------------MEQYKFILSGGGTGG
MURG_GRAFK       --------------------------------------------MKEGLRVILSGGGTGG
MURG_CYTH3       ------------------------------------------MPEQKPYRIIISGGGTGG
MURG_PORGI       ---------------------------------------MNNEESNAKLRFIISGGGTGG
MURG_CHLCH       ------------------------------------------------MKVLFAGGGTGG
MURG_SALRD       -------------------------------------------MSTRAPHILMVGGGTGG
MURG_DESVV       -----------------------------------------------MRRVILTTGGTGG
MURG_DESAG       -----------------------------------------------MKRVLLTTGGTGG
MURG_LAWIP       ----------------------------------------------MKYRIAITTGGTGG
MURG_ACIC1       ------------------------------------------------MHVVLAGGGTAG
MURG_THEFY       ------------------------------------------------MRVVLAGGGTAG
MURG_FRACC       ----------------------------------------------MLRSVVLAGGGTAG
MURG_SACEN       -----------------------------MSWQQAAGYGAGDAMARRAPSVVVAGGGTAG
MURG_CORJK       --------------------------------------MNPKPEADRKLSVVVAGGGTAG
MURG_NOCSJ       ------------------------------------------------MRVLLAGGGTAG
MURG_ARTS2       -------------------------------------------MNAESLSVVLAGGGTAG
MURG_LEIXX       -----------------------------------------------MTAYLLAGGGTAG
MURG_BIFLO       -------------------------------------------MNQGTPHIVLAGGGTAG
MURG_CUTAK       -----------------------------------------------MVNVVLAGGGTAG
MURG_COREF       -----------------------------------------MSSPKEPLSVVVAGGGTAG
MURG_CORDI       -----------------------------------------MNTPR----VVVAGGGTAG
MURG_TROWT       -----------------------------------------------MSRILLAGGGTAG
MURG_DEIRA       -----------------------------------------------MSLVVMATGGTGG
MURG_THET2       -------------------------------------------------MILLTGGGTGG
MURG_ACISJ       MTSRFGHSQHPRRGRSARARAGRREGVQSNFPATQVLERSAHSLPARQRTALVMAGGTGG
MURG_BORA1       ---------------------------------------------MSAPTILIMAGGTGG
MURG_DECAR       ----------------------------------------------MSKTILVMAGGTGG
MURG_THIDA       -------------------------------------------MAAANRTLMVMAGGTGG
MURG_NITEC       ---------------------------------------------------MIMAGGTGG
MURG_NITMU       ----------------------------------------------MSHTILIMAGGTGG
MURG_METFK       ----------------------------------------------MSKTLLIMAAGTGG
MURG_NEIG1       ---------------------------------------------MGGKTFMLMAGGTGG
MURG_HAHCH       ---------------------------------------------MSGKTFLVMAGGTGG
MURG_MARHV       ------------------------------------------MTDSPRRRFLMMAGGTGG
MURG_CHRSD       ------------------------------------------MSYREVSRVLIMAGGTGG
MURG_PSEU5       ----------------------------------------------MAANVLIMAGGTGG
MURG_XYLFT       ---------------------------------------MVQSAVTHFRPVMILAGGTGG
MURG_ALCBS       ----------------------------------------------MSGTVLIMAGGTGG
MURG_ALKEH       ----------------------------------------------MTMPVLIMAGGTGG
MURG_NITOC       ----------------------------------------------MAIRVLIMAGGTGG
MURG_HALHL       ---------------------------------------------MSVRTVAIAAGGTGG
MURG_METCA       ----------------------------------------------MARRIVILAGGTGG
MURG_DICNV       -------------------------------------------MILKGKKLLFMAGGTGG
MURG_HYDCU       -----------------------------------------------MKKILIMAGGTGG
MURG_SACD2       -------------------MSRSQADSTSASEKRTVRKVVARKFIERPKTVVIMAGGTGG
MURG_ACIAD       ---------------------------------------MTDPSQVKPKHVMMMAAGTGG
MURG_PSYCK       ---------------------------------------------MKTPHILMMAAGTGG
MURG_IDILO       -----------------------------------------------MNKVLIAAAGTGG
MURG_HAES1       --------------------------------------------MSKRKKLLVMAGGTGG
MURG_VIBCH       -------------------------------------------MMNKNKKLMVMAGGTGG
MURG_BLOPB       --------------------------------------------MNQKKKIMIVAGGSGG
MURG_BAUCH       ---------------------------------------------MIRKRLIIVAGGTGG
MURG_BUCAP       ---------------------------------------------MNSKRIIILAGGSGG
MURG_BUCBP       -----------------------------------------------MKKIIIMAGGTCG
MURG_WIGBR       -------------------------------------------MKNTKIKIIITGGGSGG
MURG_PSEA6       ------------------------------------MSNRIASDSVMTHTLLVMAGGTGG
MURG_PSYIN       ------------------------------------MRNK--------KTLVVMAGGTGG
MURG_SHEFN       ------------------------------------MNSNISS----SPKILIMAGGTGG
MURG_COLP3       -----------------------------------MSVNHGQGNKDLAKTLLVMAGGTGG
MURG_PSEHT       ----------------------------------------------MSKKCVVVAGGTGG
MURG_COXBU       -----------------------------------------------MNRILIIAGGTGG
MURG_FRATN       -------------------------------------------MSLENKNIIITAGGTGG
MURG_VESOH       -------------------------------------------MFNTAKKILIMAGGTGG
MURG_TRIEI       -----------------------MGKGEFTFNLLCCYNREAETLTNKPVKLLIAASGTGG
MURG_SYNY3       --------------------------------------------MTEPIRLLIAASGTGG
MURG_SYNE7       -------------------------------------------MSVAQPRLLFAASGTGG
MURG_SYNJA       -------------------------------------MNGDRRDPTSPPRLLVAASGTGG
MURG_GLOVI       ---------------------------------------------MPKPRLLIAASGTGG
MURG_THEEB       --------------------------------------------MLGQRKLLIAASGTGG
MURG_PROMA       -------------------------------------------MPR----LLIAASGTGG
MURG_PROMT       -------------------------------------------MPR----LLIAASGTGG
MURG_SYNR3       -------------------------------------------MPR----LLIAASGTGG
MURG_PROMP       -------------------------------------------MSKKRNNLLIAASGTGG
MURG_CHLPN       -------------------------------------------MMKKIRKVALAVGGSGG
MURG_CHLAB       -------------------------------------------MMKKINKIALAVGGSGG
MURG_CHLMU       -------------------------------------------MMKKISKVVLAVGGTGG
MURG_CAMFF       -------------------------------------------------MIAITGGGTGG
MURG_CAMHC       ------------------------------------------------MTIAITGGGTGG
MURG_CAMJR       ------------------------------------------------MTIALTGGGTGG
MURG_NITSB       ------------------------------------------------MRILITGGGTGG
MURG_SULDN       ------------------------------------------------MRLCITGGGTGG
MURG_WOLSU       ------------------------------------------------MNILLTGGGTGG
MURG_SULNB       ------------------------------------------------MSIIMTGGGTGG
MURG_HELAH       ------------------------------------------------MKVALTGGGTGG
MURG_HELHP       -------------------------------------------------MFAITGGGTGG
MURG2_BACC1      -----------------------------------------------MKKIVFTGGGSAG
MURG_CLOTE       ----------------------------------------------MKKKIILTGGGTAG
MURG_GEOTN       ----------------------------------------------MRKKIVLTGGGTAG
MURG_OCEIH       --------------------------------------------MKNNKRILFTGGGTAG
MURG_STAS1       -----------------------------------------------MTKIAFTGGGTVG
MURG_BACSK       -----------------------------------------------MKKIIFTGGGSAG
MURG_LEGPC       ----------------------------------------------MSPSIVFTGGGTAG
MURG_STRP1       ----------------------------------------------MPKKILFTGGGTVG
MURG_STRP3       ----------------------------------------------MPKKILFTGGGTVG
MURG_STRP6       ----------------------------------------------MPKKILFTGGGTVG
MURG_STRMU       ---------------------------------------------MAKKKIIFTGGGTVG
MURG_STRS2       -----------------------------------------------MKKIVFTGGGTVG
MURG_TREDE       -----------------------------------------------MKCVVFTGGGTGG
MURG_TREPA       ------------------------------------MRFRARVSQSTAKCVVFTGGGTGG
MURG_BORBU       --------------------------------------------MSNKKIIFFTGGGTGG
MURG_PARUW       ----------------------------------------------MSKRFMITAGGTGG
MURG_RUBXD       ------------------------------------------------------------
MURG_ROSS1       ---------------------------------MKQSRIPRDPDGLPPLRAWLVGGGTGG
MURG_THEP1       -----------------------------------------------MIKVAAAGGGTGG
MURG_AQUAE       -------------------------------------------------MIAVSGGGTGG
MURG_FUSNN       --------------------------------------------MRKMKKVMLTTGGTGG
MURG_PELUB       ----------------------------------------------MNKKILISTGGSGG
MURG_LEPIC       -----------------------------------------------MKSIVIVAGGTGG
MURG_STRSV       -----------------------------------------------MKKIVFTGGGTVG
                                                                             

MURG_ACICJ       HMVPAESVADELMRR---------------------GQRIVLMTDARS---AGQKSAVFA
MURG_GRABC       HFFPAEALAAELKRR---------------------GRQIVLMTDARS---GGLTSTVFA
MURG_GLUOX       HFFPAEAVATVLAER---------------------GHDLVLMTDARH---GRRETGLFK
MURG_RHILO       HLFPAEALAHELNGR---------------------GWTVHLATDDRA---ERFAGHFP-
MURG_RHOPA       HLFPAEALGVVLIRR---------------------GYRVRLVTDHRA---TRYSGLFT-
MURG_BARBK       HLFPAEALAVELRQR---------------------GYDVHLATDERA---KRFVRHFD-
MURG_ZYMMO       HMIPAHALAVELMRR---------------------GHHVALVTDERG---TRFPELFK-
MURG_SPHAL       HMLPAYALADELIAR---------------------GHRVALVSDDRG---LKIPGAPA-
MURG_MAGSA       HVFPAEALASVLLDR---------------------GYRLALITDKRG---AAYGGTLG-
MURG_RHORT       HVFPAEALAGELIRR---------------------GHKLTLITDKRG---HVYGGTLG-
MURG_HYPNA       HMFPARAFADEMRAR---------------------GWNTALISDSRG---LRYAADFP-
MURG_MARMM       HMFPARAAAEALIAR---------------------GWQVRLVTDARG---LRHATDFP-
MURG_CAUVC       HMFPAQALAEALAAR---------------------GWRVVLATDDRG---ALYADKFP-
MURG_JANSC       HMFPAQALSEAMLRK---------------------GWRVTLSTDARG---ARYVGGFSH
MURG_PARDP       HMFPAQSLAETLLAQ---------------------GWRVKLSTDERG---ARYAGAFPA
MURG_WOLTR       HIFPAITLARAIKRQ---------------------GYDSILFADKK-------TGKNTD
MURG_ANAMM       HIVPAALLCQVLADR---------------------GYRCVLYTDQYF---LQYTARFPG
MURG_RICTY       HFFPAVALGEELIKR---------------------GYIVHFITDLRC---KKYI-NKDM
MURG_ORITB       HLFPAIALGEELQER---------------------GYNVYLITDTRC---EKYLLNFNY
MURG_KORVE       HVIPALAIAQELKNV--------------------HGAEVIFIGTQRG-IETRLVPAAG-
MURG_SOLUE       HVIPALAVARELRS---------------------RGHKVFFVGTQHG-MEARLVPPEG-
MURG_MYXXD       HLFPGIALAEEVVTR-------------------HHRNEVVFVGTERG-IESRVVPKEG-
MURG_SYNAS       HLFPGVAIAEELLRR-------------------DRENRVLFVGTKRG-IEKKVLKDLG-
MURG_PELCD       HLFPAVALAQRLLEQ-------------------DSEAQVQFVGTARG-IEARVLPEQG-
MURG_PELPD       HLFPGIAVAEEFLSR-------------------DPANQVLFVGTERG-IEARAVPAAG-
MURG_MAGMM       HLFPALAVAERWRER-------------------YGLHSVHFIGGQRG-LENRLVPNAG-
MURG_BDEBA       HIYPGIAIARALQKL-------------------DPSIEVHFVGTARG-LESKIVPREG-
MURG_DESPS       HLFPAIAAAQQFCRE-------------------YPGAEVLFVGTKRK-MDAETLERYG-
MURG1_BACC1      HIYPALALIREIKKL-------------------NPEARFLYIGTENG-LESTIVPKAG-
MURG1_BACAN      HIYPALALIREIKKL-------------------NPEARFLYIGTENG-LESTIVPKAG-
MURG_LISIN       HVYPALAFIRELKKV-------------------HPEAEFLYIGTEKG-LEAGIVKREG-
MURG_ENTHR       HIYPALAFVNYVKTK-------------------EPNTEFMYVGAQRG-LENKIVPETG-
MURG_LACLA       HIYPALAFLKYLEKV-------------------EPDTEVLYIGTKKG-LEAKIVPQAG-
MURG_LACSS       HIYPALALIERLKQR-------------------GLLDAVLYVGTERG-LESKIVPDQG-
MURG_LACP3       HIYPALALIEALKAE-------------------GKLDDVLYVGTKRG-LESRIVPATG-
MURG_LEUMM       HIYPALALAEVIRKH-------------------EPDTEFLYVGSERG-VESNIVPATG-
MURG_OENOB       HIYPALALVESLLKH-------------------EPDSKVLYIGSFRG-LEGSIVPKTG-
MURG_LACJO       HIYPIMALIERLKERKL-----------------VTNDEILFVGTDRG-LESKIVPAAG-
MURG_HUNT2       HINPGLAIAKYIKKR-------------------EPDTEILFIGTERG-LEARLVPREN-
MURG_CALS4       HIYPAVAIAKEILKN-------------------EQDAQILFVGTEKG-LEKELVPREG-
MURG_CLOD6       HVYPAIAIANKIRDE-------------------HPDAEIIFVGTEKG-IESEIVPKYG-
MURG_CALS8       HIYPAVAVADYLKKR-------------------YNNLNIVFIGTNEG-LESKIVPQHG-
MURG_DESHY       HIYPALAIAKGILAQ-------------------RPDAEILYIGTREG-MEARLVPEAG-
MURG_MOOTA       HVYPALAIARGLKEA-------------------RPGVELLYIGTARG-LEADVVPRAG-
MURG_SYNWW       HIYPALAIASGLKER-------------------LGEAEILYVGTKKG-LEANIVPRAG-
MURG_CARHZ       HLYPALAIAQSWKES-------------------HPNDEILFVGTPRG-IENTVVPKYG-
MURG_SYMTH       HIYPALSIARALTEQ-------------------DPEAELLYVGTRTG-REAAIVPQAG-
MURG_FLAPJ       HIYPAIAIANELKSR-------------------FPNCKILFVGAKDK-MEMQKVPQAG-
MURG_GRAFK       HIYPAIAIADEIKRR-------------------YPNAEILFVGAQDR-MEMEKVPQAG-
MURG_CYTH3       HIYPAVAIANAIKAR-------------------FPDSEILFVGAQGR-MEMQKVPAAG-
MURG_PORGI       HIFPAISIADALRRR-------------------YPECEILFVGAEGR-MEMERVPRSG-
MURG_CHLCH       HLYPAIAMAAELQRL-------------------SPNVSVAFVGTKSG-IEATEVPRLG-
MURG_SALRD       HVYPAIAIADAVRAL-------------------RPDAQIVFAGTQDR-LEARAVPEAG-
MURG_DESVV       HIFPALAVAEEIRARY-------------------PECSVLFMGGLYG-PEADLAARAG-
MURG_DESAG       HIFPALAVAEEIRRQY-------------------PAADILFVGGSYG-PEARIVPAHG-
MURG_LAWIP       HVYPALAVAEQFHDK----------------------ADLFFIGSQYG-PEAEMVKTFN-
MURG_ACIC1       HIEPALTLAEALRRRD-------------------VGVGITLLGSPRG-LETRLVPARG-
MURG_THEFY       HVEPALALADALRRIN-------------------PDTQVLCLGTKRG-LEQRLVPMRG-
MURG_FRACC       HVEPALAVADALRATD-------------------SRVRLTLLGTATG-LEARLVPARG-
MURG_SACEN       HIEPALALADAVRRLR-------------------PDARVTALGTERG-LENRLVPARG-
MURG_CORJK       HIEPAMAVAEAVRAQR-------------------PDARITALGTTRG-LETTLVPARG-
MURG_NOCSJ       HTSPLLATADALRRLE-------------------PDVEITCLGTPRG-LENKVVPEAG-
MURG_ARTS2       HISPLLAIAAALRDVR-------------------PDVRLLAVGTPSG-METRLVPAAG-
MURG_LEIXX       HVNPLLAVADRLRRDD-------------------PAAEVLVLGTAEG-LEARLVPARG-
MURG_BIFLO       HVNPLLAVAGAIRDIE-------------------PTAQVTVIGTAVG-LEKDLVPEAG-
MURG_CUTAK       HTSPLIATAMALQ--E-------------------RGATVSCIGTPRG-LEGRVIPEAG-
MURG_COREF       HIEPALAVAEALRDGY--------------------GATVTALGTARG-LETSLVPDRG-
MURG_CORDI       HIEPALAVAESLRHR---------------------GAEVVALGTTKG-LETSIVPERG-
MURG_TROWT       HVNPLLALADVLKV---------------------SGHATFALGTSEG-IESRLVPNSG-
MURG_DEIRA       HIYPAVATAKELRGR---------------------GYEVALMGQKGG-MEEGIAEREG-
MURG_THET2       HLFPALAVAEELRRR---------------------GHPVFYLGAEGG-LEARLLPKTP-
MURG_ACISJ       HIFPGLALAEALRER---------------------GWQVHWLGTPGS-MEERLVPPRG-
MURG_BORA1       HIMPGLAVAEILRQR---------------------GWQVRWLGNPDK-MEGKLVPARG-
MURG_DECAR       HIFPALAVAHKLRDA---------------------GWRVVWLGNPEG-MEARLVPQHG-
MURG_THIDA       HVYPALAVAETLRER---------------------GWSVFWLGTRAG-LEARVVPAAG-
MURG_NITEC       HVFPGLAVARAMQAE---------------------GWRVIWLGTRNG-MEATLVPQHG-
MURG_NITMU       HVFPGLAVAEYLKAA---------------------GWRIVWLGTEGG-METTLARQQG-
MURG_METFK       HVMPGLAIAKTMQSR---------------------GWNVHWLGTTHG-MENRLVPPSG-
MURG_NEIG1       HIFPALAVADSLRVR---------------------GHHVIWLGSKDS-MEERIVPQYG-
MURG_HAHCH       HVYPALASALALREQ---------------------GANVVWLGARGG-MEERIIGRTD-
MURG_MARHV       HVFPALATARALQQR---------------------GHEVHWLGASGG-MEERLIGDTD-
MURG_CHRSD       HVVPALSLARALRAR---------------------GVSVEWLGSPRG-IENRLVPAAD-
MURG_PSEU5       HVFPALACAREFQTR---------------------GYAVHWLGTPRG-IENELVPAAG-
MURG_XYLFT       HIFPGLAVAGVLRAR---------------------GVPVVWLGAAGK-METHLVPKHG-
MURG_ALCBS       HVFPALAVADQLRTR---------------------GFDILWLGAENG-MEGNLVRQYG-
MURG_ALKEH       HVFPALAVAERLREQ---------------------GVPVVWLGTREG-LEARVVPAAD-
MURG_NITOC       HIFPALAVADRLRAW---------------------GVEVVWMGTRHG-LEAELVPKAG-
MURG_HALHL       HVYPGLAVADALRER---------------------GHRVVWLGTRAG-LEGRVVPAAG-
MURG_METCA       HVFPALAVAGKLRRA---------------------GAEVFWMGTRTG-LEARVVPAAG-
MURG_DICNV       HVYPALAVARAAAEQ---------------------GSIIHWLGNQSG-FEGKKVPEAG-
MURG_HYDCU       HVFPGLALAEALADK---------------------QVKTVWLGTCNG-MEKQWVDAAK-
MURG_SACD2       HVYPGLAVAEAMHQR---------------------GFNIAWLGSRGG-MEKELVAKASE
MURG_ACIAD       HVFPALAVAKQLQQH---------------------GCQVSWLATPAG-MENRLLKDQN-
MURG_PSYCK       HVFPALAVSEELTKR---------------------GAMIHWLGTPNG-MENGLVAPTG-
MURG_IDILO       HIFPALAVAEQMRDN---------------------GWQVDWLGTQEGRLESRVIPAAN-
MURG_HAES1       HVFPAIAVAQYLQKQ---------------------DWDICWLGTRDR-MEAKLVPKHG-
MURG_VIBCH       HVFPGLAVAKQLQQQ---------------------GWQIRWLGTADR-MEAELVPKHG-
MURG_BLOPB       HVFPGLSVAHYLINH---------------------GYQVVWLGTADR-IESKLVPQYG-
MURG_BAUCH       HIFPGLAIANNMITQ---------------------GWDVRWLGTKNR-IEADLVPKHG-
MURG_BUCAP       HVFPGLTIAKHLIKK---------------------GWDINWIGTKNK-IESEIIPKCN-
MURG_BUCBP       HIFPGLEIAKSLINK---------------------GWKVFWLGTSKN-IESKIVPKYG-
MURG_WIGBR       HVFVGLSIAEQLIKI---------------------GCEILWIGSSDR-IESYLIPKSN-
MURG_PSEA6       HVFPGLAVAQALKEQ---------------------NWHIHWLGTAQR-MEADLVPKAG-
MURG_PSYIN       HVFPGLAVADALKEQ---------------------GWAVSWLGTADR-MEAQLVPKHG-
MURG_SHEFN       HVFPALAVAKYLAEK---------------------GWQIRWLGTADR-MEARLVPQHG-
MURG_COLP3       HIFPGIAVADELKAQ---------------------GWKIHWLGTADR-MEAQIVPMHG-
MURG_PSEHT       HIFPGIAVADYLKQQ---------------------GWQVSWIGTPDR-MEATVVPKHN-
MURG_COXBU       HIFPALAVARELREQ---------------------EVDVQWLGVKGG-LEEKLVPDSF-
MURG_FRATN       HIYPALAIAELLRQN---------------------KANVTWVGTPNS-MEASIVPEY--
MURG_VESOH       HIFPALAIANELKKH---------------------SSNIQWLGSNLG-MENNIIPKHN-
MURG_TRIEI       HLFPAIAIANQLKD-----------------------YHIEWLGVPDR-LETKLIPSQY-
MURG_SYNY3       HLFPALALAQQLPD-----------------------YEIIWLGVPDR-LETTLVPRQY-
MURG_SYNE7       HVFPALAVAEALPE-----------------------AKIDWLGVPDR-LETQLVGDRY-
MURG_SYNJA       HIFPALAVVEQLPT-----------------------WQIEWLGVPQR-LEAKLVPDRY-
MURG_GLOVI       HIFPALAVAGELSE-----------------------FEIAWLGVPDR-LENKLVPGRY-
MURG_THEEB       HLFPALAVAQELPE-----------------------YEIHWLGVRDR-LENQLIPPHY-
MURG_PROMA       HIFPALSVAEELPES----------------------WDISWLGVPER-LENQLVPTKY-
MURG_PROMT       HIYPALSFADSLSNS----------------------WEIVWLGVPHR-LEVELVPEKY-
MURG_SYNR3       HLFPALAVADRMPET----------------------WSVRWLGVPDR-LERQLVPSRY-
MURG_PROMP       HIFPALAVSKKVEKD----------------------WDIHWLGVTKR-LDSEFVPSKY-
MURG_CHLPN       HIVPALSVKEAFSRE---------------------GIDVLLLGKGLKNHPSL-QQGIS-
MURG_CHLAB       HIVPALATREAFCRE---------------------GVDVLLLGKGLENHPSLGEQQIL-
MURG_CHLMU       HIIPALAARETFIKE---------------------KVEVLLLGKGLTRFLEG-EPDVL-
MURG_CAMFF       HLAIAKALAIELKNR---------------------GENVIFIGSNSG-QDRMWFEHSDI
MURG_CAMHC       HLTIAKILAYELKKR---------------------GLKTIFIGSTNG-QDMLWFENSVL
MURG_CAMJR       HLAIVRCLLESAIKK---------------------NIECVYIGSQNG-QDKAWFENEVR
MURG_NITSB       HLSVAKSLKEAFKKK---------------------DATLYYIGSIQG-QDRSWFENDED
MURG_SULDN       HLMIAEALVEACAND---------------------GHEAIFIGSTSG-QDRKYFEQNSK
MURG_WOLSU       HLAIAKALMESLASK---------------------NQSLFFIGSQRG-QDRSWFEHEEG
MURG_SULNB       HLAIIKAVKEQLK-----------------------GEELIYIGSTTG-QDRQWFENDED
MURG_HELAH       HLSIAKALAIELEKQ---------------------GVEAIYLGSTYG-QDKEWFEDSPL
MURG_HELHP       HLAIAKALAQEAQKN---------------------NQQSIYIGSQIG-QDKTWFEGSSL
MURG2_BACC1      HVTPNLAIIPHLQE---------------------QNWDISYIGSHQG-IEKTIIEK---
MURG_CLOTE       HVTPNISLIPKLKE---------------------LGYEVQYIGTKDG-IEKSLIKK---
MURG_GEOTN       HVMVNVALIPKLKE---------------------QGWDIVYIGSHEG-IEREIIGRI--
MURG_OCEIH       HVIVNLALIPYYQE---------------------RGWEIDYIGSYNG-IERDLISPL--
MURG_STAS1       HVSVNLSLIPTAIE---------------------EGYDTFYIGSKNG-IEREMIESQL-
MURG_BACSK       HVTPNLAIINELND---------------------KDWSIAYIGSYEG-IERQLVEK---
MURG_LEGPC       HVTPNIALIKEFRK---------------------EGWNVEYIGSVSG-IEKEMIEPM--
MURG_STRP1       HVTLNLILIPKFIK---------------------DGWEVHYIGDKNG-IEHTEIEKSG-
MURG_STRP3       HVTLNLILIPKFIK---------------------DGWEVHYIGDKNG-IEHIEIEKSG-
MURG_STRP6       HVTLNLILIPKFIK---------------------DGWEVHYIGDKNG-IEHTEIEKSG-
MURG_STRMU       HVTLNLLLIPRFLK---------------------DGWEVHYIGDKHG-IEHEQIEQSD-
MURG_STRS2       HVTLNLLLIPRFLE---------------------EGWEVHYIGDGNG-IEHEQVVKSG-
MURG_TREDE       HIFPGLAVAEALSS--------------------SLECRIVWIGSAKG-VDRKIVESSEL
MURG_TREPA       HIFPGIAVFQALAQ--------------------QAAVRVVWIGAARG-ADRSIVESA--
MURG_BORBU       HVFPGISIIQKLKEF-------------------DNEIEFFWIGKKNS-IEEKLIKEQD-
MURG_PARUW       HIFPAQGLAQELIKK---------------------TYSSSILFVAGGLSTNKYFDRSI-
MURG_RUBXD       -------MAESLRER---------------------GAEVVFFGSESG-LERELVPKAG-
MURG_ROSS1       HVYPALAVAAALNAHGAQFVVADTDGGRNRAMSRHTRWSALYVGSVGG-MEAALVARESA
MURG_THEP1       HLYPLLAILETLAKRV--------------------DVKVLFFAVKGK-IDERVVRKDHP
MURG_AQUAE       HFFPALAFTNYVLKK----------------------EKVKFIGSKRG-IEYELKDLIK-
MURG_FUSNN       HIYPALAVADRLKIK---------------------GIEAVFVGSMER-MEKDLVPESG-
MURG_PELUB       HVIPATIIYKHLEDN----------------------FDVSMTSDFRG---VKFLNKDE-
MURG_LEPIC       HISPGVALAEVLTEL------------------------KEKIGYENLYLYSLVRNKNN-
MURG_STRSV       HVTLNLLLIPKFIKE---------------------GWQVHYVGDKHG-IEYQEIQKSG-
                                                                             

MURG_ACICJ       ------GCERHVLAGAGLAGRSLGR----RLLGVAQLARGTVAARHILAKLDAAAVVGFG
MURG_GRABC       ------DTDRFVLPGAGIAGRGIRR----AGQAVIALGHGVVKAGALLRRLEAGCIVGFG
MURG_GLUOX       ------DRPQYVLDGAGVAGKGLSG----KVHGVLALLRGMMEARRILASLDAAAVVGFG
MURG_RHILO       ------AAAVHPIQSATMGSKNPIA----VLGAFWKIWRGVRQASTIIGRIKPDAVVGFG
MURG_RHOPA       ------AEMTDVVPSETVRGRTPWA----LAKTALKLGSGALLAFNLIGRLKPAAVVGFG
MURG_BARBK       ------EKHIHIISSATLVRHHPFA----LIKTFWLLLRGMVQSWILFRKLRPVLVGGFG
MURG_ZYMMO       ------DVQIHQLPAGRLTG-GVKG----LFQAMRNIWAGRERALTLYENFTPAAVVGFG
MURG_SPHAL       ------ELETHVLPAGRASG-GPLG----WLKGALAIRKGRRMAIELIDDFDPAVVVGFG
MURG_MAGSA       ------KLETFRISAGGIAGRGKLS----ALRSALELGLGLIQARSILGRIRPAAVIGFG
MURG_RHORT       ------LLDTKRILAGGVAGRGVIG----RLRGMIELAMGSLQAYGLLRRLRPDVVVGFG
MURG_HYPNA       ------ADWKEEIEAASPNFRKPWT----VPGAALKINAGIARARRLMKQHRPALVAGFG
MURG_MARMM       ------AVAVDEIHAASPSTKNPLK----LARAALELTQGFAQARSIVGKWKPDVIAGFG
MURG_CAUVC       ------AEERLALSAATAKSNDPLG----MIKAGFVVLQGVMEARAAFKRLDPAVVVGFG
MURG_JANSC       ------AVEIREVSSATFTRGGALA----KLAVPFRIFGGVLTATARMLREKPDVVVGFG
MURG_PARDP       ------EVAREVVSSATTARGGALA----RLAVPFRIGAGVLAAIRAMRADRPAVVVGFG
MURG_WOLTR       ------VKDYTL-PLNKPGG---NK----FRFFLLLIYSCVLALYQIRK-LKPKLVIGFG
MURG_ANAMM       ------IKGYVLLPLCKRSGGAVRL----LKFCALLAYSCVLSYIKLRS-LKPDLVIGFG
MURG_RICTY       ------KIIFYLLDLKRFSNI--------LLFLPTLLIAFLKSIKLIYH-IKSCVIIGFG
MURG_ORITB       ------SFKIHIMNMVSISNTGIKK----LYAYIRILAACITGFKLVYS-NSPSLIVAFG
MURG_KORVE       -------FSLKLVKVGALNRVSFS----TRIKTMFDLPKAILESRRIIREFKPDVMIGVG
MURG_SOLUE       -------FEFKTIEIGGLNQVSWN----QKFATLSRLPITTLKCGRSVRD--ASAVFSMG
MURG_MYXXD       -------YPLELVKVQGLKGKGFL----SLLKALFALPLAFIESFRILARQKPDVVVGVG
MURG_SYNAS       -------FRLKLLNVEGIKGRGVM----RSSLALLKLPGSLMQSMKIIRDFRPDVVIGVG
MURG_PELCD       -------WPLELIDIRGFVNQGLL----GKLRMIPCLIRSVWQGLCILRKFQPDVVLGVG
MURG_PELPD       -------FPLELISAAGIRGKGGL----GKLRGAAMMFNGYRQSCRLLDRFRPDAVLGVG
MURG_MAGMM       -------FTLETLAVGQLKGKGLP----HKLRTLGGLLPAVWQARGMVQRFDPHVVLGVG
MURG_BDEBA       -------FPLHLIESGQLNVKSPI----QKMKTLLKIPVGLWQSIRLLGQLKPLYVIGVG
MURG_DESPS       -------FKGVAINSYGLKGKNMR----ELVKALLVLPISCLQALFILARFRPDLVLGVG
MURG1_BACC1      -------IPFQSIVISGFKRKISL----DNVKTVMRFLKGVQDSKRYIRRFNPDIVIGTG
MURG1_BACAN      -------IPFQSIVISGFKRKISL----DNVKTVMRFLKGVQDSKRYIRRFNPDIVIGTG
MURG_LISIN       -------IPFESIEITGFKRSLSL----ENIKTVMRFLSGAKKSKQILREFKPDVVIGTG
MURG_ENTHR       -------MPFRTLEIQGFQRKLSL----HNLKTIQLFLKSIREAKKILKEFKPDVVIGTG
MURG_LACLA       -------IKLKTVDIQGLRRSLSP----QNLKTAYKFFKSVSDAKKIMKEFKPDVVLGTG
MURG_LACSS       -------IDFKTLEIQGFKRSMNLNGIKTNLKTIELFMSSIKSAKKMIKEFKPDVVIGTG
MURG_LACP3       -------LKFATLDLQGFKRSLSL----SNFTTVRKFLGSLGEAKKLLQDFQPDIVVGTG
MURG_LEUMM       -------MPFEKLTVQGFKRSFSL----ENIKTVSLFLKAVKEAKKIIKDFDPDVVVGTG
MURG_OENOB       -------LDFKQLHVQGFSRSLSL----TNFKTVNLFIKAVKKSKHIIHDFKPDIVLGTG
MURG_LACJO       -------VPFKTLKIKGFDRKHPL----KNFETIELFIKATKEAKQIIKNFKPDVVVGTG
MURG_HUNT2       -------FEIKMIKVRGFKRKLSM----DTLVAVKELFQGLAEARKIIKDYKPDLVIGTG
MURG_CALS4       -------FELVTIEVQGFKRKLSF----DTLKTVYKAFTGFKQANKILKDFKPHVVIGTG
MURG_CLOD6       -------FELKTVTVQGFKRKIDF----DNVKRVFKLFKGLEQSRKIVKKFKPDIVIGTG
MURG_CALS8       -------YKIEYIQAKGLKRSLTV----KNVEVFLKFISGYRQALQILKRIKPKVVFVTG
MURG_DESHY       -------IEFSGVSGQGLPRKLSL----ETLKVGGKSFKALWETKQILKKFKPDLVVGTG
MURG_MOOTA       -------LTLATITVQGLVRRQVW----KNIPALVKTGRGLGEAWQQVRRFRPDVVVGTG
MURG_SYNWW       -------LRFTTIDISGIDRSSML----KASRSLVKFPRSFFQAWDIIKDFQPDIVIGTG
MURG_CARHZ       -------FPLYLLPVEGIPRKVSW----ETLKKLFLVPKSLINAFIFLKKEKPDIVVGTG
MURG_SYMTH       -------IAFAVISSGGVVNLGLL----QRVRGGLRAARGLLEALGHIRRFRPDIVIGTG
MURG_FLAPJ       -------YDIKGLSIAGLQR----KITLQNAMFPFKLLSSLVKSFGIVQQFKPDVVIGTG
MURG_GRAFK       -------YEIKGLWISGIDR----SFSLKNFIFPFKLMSSLSKSRKIIKKFKPDIVIGTG
MURG_CYTH3       -------YNIEGLWISGIQR----KLSLDNLAFPLKVIASYFKAKKIVSTFKPDIAIGVG
MURG_PORGI       -------YEIVGLPIKGLDR----KHLLSNYKVAIAVIRSMRLANKTIRNFRPDMVIGVG
MURG_CHLCH       -------YKLHLVSVRGLKRGFSPKLLIENLRILFDFARSLGITIQLLRSEAPDVVVGTG
MURG_SALRD       -------YALHPITAQGLQR----RAVASNLLLPFRVAQGLVQSWRLVGAIEPDVAVGTG
MURG_DESVV       -------LDFVGLPVRGVLGRGVR-----AIGAAFGMAAGIARAYAVMGRFDPDIVLGFG
MURG_DESAG       -------IRFEGLPVRGVMGRGLK-----APLALAAMTAGVARGMRLVGRFNPDVVIGFG
MURG_LAWIP       -------IPFYGLPVRGVLGRKWK-----AFSALYSMIKAIVKARKILQKCMPDIVVGFG
MURG_ACIC1       -------FDLALIPAVPLPR-RLTP---DLLAVPSRLRAAVGEVERILAETGADVLVGFG
MURG_THEFY       -------YELAEIPAVPLPR-KLTP---QLLSVPGRLANAISTAAKHLDRVQADILVGFG
MURG_FRACC       -------HELATVPKVPMPR-RPTP---AVFKLPARFLDAICQAGETLDLVRADVVVGFG
MURG_SACEN       -------YPLELVPPVPMPR-KPTP---ELLKLPLKVRESVKRTREVLDRVGADVVVGFG
MURG_CORJK       -------FDLQLIPPVPVPR-KLNK---DLATLPLRLRKALKETKRVLREVEADVVIGFG
MURG_NOCSJ       -------YPLELIPPVPLPR-RPGA---DLLKVPFRLRAAVRATHAVLDRVRPDVVVGYG
MURG_ARTS2       -------LELATISRVPFPR-RPSL---DLLRLPGRLAGAVKQAGRILDDAHADVLVGVG
MURG_LEIXX       -------YELATIPRLPFPR-RPNA---AAVRFPGEYRRSVRAVGELIRARGIAAVVGFG
MURG_BIFLO       -------YELDTIEKVPFPR-RPNL---YMLRFPAKWKRETAKVRSILETRHADVVAGFG
MURG_CUTAK       -------LQLDMIPPVPLPR-TVNA---DLFKVPARLAGAVRKAGEVLQRRQTDVVVGFG
MURG_COREF       -------FDLRLIEPVPVPR-TPNL---DLVKLPFRVAKSLRQARQVLRDTGAHAVVGFG
MURG_CORDI       -------FELRLINPVPVPR-KINA---DLFKLPFRLLATISQTRKILKEFDTDVVIGFG
MURG_TROWT       -------IDFFTIPKLPFPR-RTSR---HILCFPFKFFSSVKLVRSILIEHKIQVVVGFG
MURG_DEIRA       -------LTFYGVDAGKLARSGQGR---PDPRQLLKAGQGLAQARRTLAGLNPAAVVGYG
MURG_THET2       -------IPHALIPAGKLDRSALR------PQEAPKVLQGVLRAQALLRRLRPKAVLSTG
MURG_ACISJ       -------FAFEPIDFSGVRGKGLKT----LLALPLRLARACLQARAVVRRLQPDVVIGLG
MURG_BORA1       -------IEMAPLRFQGLRGRGVTA----LLKLPLLLTRALLQARKHMAEIQPDVVLGMG
MURG_DECAR       -------FEMVWIKFSALRGKGILR----KLLLPVNLLRGFWQGLKAIRQVKPNVVLGMG
MURG_THIDA       -------IDMVWVSMGGVRGKGLVK----KLLLPAMLLVAFAQSLGAILRRRPDVVLGMG
MURG_NITEC       -------FTIELINFSGLRGKKPVS----YLLLPWRLAKACWQSFCILRRQRPQIVLGMG
MURG_NITMU       -------HALETIRFSGLRGKNVRT----WLLLPARLLLAFWQSARVIRKVRPDVVLGMG
MURG_METFK       -------LPMTLLKFSGMRGKGWKH----TLLGMFRLVGATWRAWRLMRELQPQAVLGMG
MURG_NEIG1       -------IRLETLAIKGIRGNGIKR----KLMLPFTLYKTVREAQRIIRKHRVECVIGFG
MURG_HAHCH       -------IPMRLITIGGLRGKGVAA----LLMAPVNLVRALWQAFSVFRKEKPDCVLGMG
MURG_MARHV       -------IPLSLIHISGLRGKGKLA----LLLAPFRLMRALGEAYTHLRRIRPDCVVGMG
MURG_CHRSD       -------IVLHRIQVAGLRGNGMAG----WLLAPWRLAKAVWQARQVIAKFDPQLVVGLG
MURG_PSEU5       -------LPLHLIQVSGLRGKGLAS----LIKAPLQLVRSLFQARRIIRELRPVCVLGLG
MURG_XYLFT       -------IEIQTIAVSGVRGHGMLA----LLGAPVRVLPAIFAAMRVLRRYRPRVVVSFG
MURG_ALCBS       -------YEIAELSVSRLRGGGIKR----KLTAPFNLLRAVLQARQLIRARQPVLAVGFG
MURG_ALKEH       -------IPLESLRVRGLRGNGLRG----WLAAPFVLLRALWQALGVLRRHRPRAVLGMG
MURG_NITOC       -------YPIEWISIGGLRGKGLTH----WLRAPFKLLLALSQALRALRRWQPAVVLGLG
MURG_HALHL       -------LDAEWLEIGGMRGKGLAT----IAALPWRLGRAVAVAGAALRRQRPDVVLGMG
MURG_METCA       -------YPIDWLSVSGIRGKGLAS----KAKAPAMLGLACLQALRILRRRKPDAVLGMG
MURG_DICNV       -------FIFHDIAVYGLRGNGVIG----WLKAPFMIGRAVFQAKKIMQHIQPDVVIGMG
MURG_HYDCU       -------IPFYTIAISGLRGNGLLG----WLKAPFNVFKAWRQARYIIQQEAPDLVLGMG
MURG_SACD2       QMGF--DIAFSEIEISGVRGKGRMA----LLAAPFRVLKAIEQAKQILQKLRPALVIGMG
MURG_ACIAD       -------IPIYQIDIQGVRGNGAVR----KLLAPFKILKATYSAMRYMKQLKVDAVAGFG
MURG_PSYCK       -------YPFHAIEMQGLRGKGIGR----LLKMPVTLLSATMAVIKIIRGNNIDIVVGFG
MURG_IDILO       -------FPLHSISMTGVRGHGLKR----KLFMPFTLAKAVLQCRRLLKTLQPQVVATFG
MURG_HAES1       -------IPIEFIQISGLRGKGLIT----LLKAPFVILRAVLQARKIIKKYQPDVVLGMG
MURG_VIBCH       -------IEIDFIQVKGLRGQGLMR----LLKAPFQIVNAILQARRHLLTYQPDAVLGMG
MURG_BLOPB       -------IDIKFIRINGWNGEKLHI----KCIMPLFICLAIYQARKIIKYWKPDIVLGMG
MURG_BAUCH       -------ITTYFLSIYGYGLHGKKQ----KILAIVSILQAVLQSYYIMRKWRPDIVLGMG
MURG_BUCAP       -------IKIHFIKIQGLRNSSLKN----LIMTPINVLNSYLQVRKIIKNWIPDIILGMG
MURG_BUCBP       -------ITIKYINISGVRGKNLFE----LMAIPFKLIIACYQAKKIIENINPDIILGMG
MURG_WIGBR       -------IKIYKINVIGFNGNNIFL----KLISLIKTAYSILKIKKLIKYYKPDIVLSIG
MURG_PSEA6       -------FEISFIDIAGVRGNGLVR----LLAAPFKIIKAVIQARGVIKQVKPDVVIGMG
MURG_PSYIN       -------YEIDFIDIAGIRGNGLKR----LLMAPIRIIKSIWQARSVLKKRRVDLVLGMG
MURG_SHEFN       -------FDIEFIDIKGVRGNGLMR----KLAAPFKIIRSIIQAKAVIDDFQPDVILGMG
MURG_COLP3       -------YDISFINISGLRGKNLLT----TLVMPFKLLRSLFQARRVIKTVKPDVVIGMG
MURG_PSEHT       -------IDINFINVKGVRGNGIKR----LIKAPFMVLNAILQARKVLKSEKPDVVLAMG
MURG_COXBU       --------PLHLIQIKAFRGKRGLQ----QLLMPLRLVRAVFQAYRIIRQFKPDVILGMG
MURG_FRATN       -------FNIQFIKSSGVRRKGIIK----KITFPLKLAYNTLRSRSLLKKLKADLVIGFG
MURG_VESOH       -------IKLHTVSSVGLRGKNVIS----LIKAPFLLSYATLQVIKIFLKFKPDVVLGMG
MURG_TRIEI       --------PLHTISVEGFQQKLGIE----TLKVLSRLIGSILKVRHILKEGKFQGLFTTG
MURG_SYNY3       --------PLQTIPVEGFQGRPSLK----TIKIGWNLLRSVFTVRKLIKSKKINAVATTG
MURG_SYNE7       --------PLHTIRVGGFQGSWLLR----PLTAL-RLIGAIFKVRRLLKRQQIEAVFTTG
MURG_SYNJA       --------PLHRVAMSGWQGSP-WQ----KLGSLVQLARATLQVRQILASGQFDVVLTTG
MURG_GLOVI       --------PLHTVALQGLNRKPGPQ----WLEAASQTFAAYRYARNLLSQERFAGVFTTG
MURG_THEEB       --------PLHTVNFSGLQGKTPWA----KLRPLWQFWGVFWQTRQLLKQGDFQGVFTTG
MURG_PROMA       --------DMTVIPVGGLQSKGLRK----YFQLL-KLILAIFFVIYLIKRKQIKLVFTTG
MURG_PROMT       --------NLIKLKVGGLQGNSFRK----LFNLC-KLLFASVQVSVLLRQKKINVIFTTG
MURG_SYNR3       --------PLFTVRAGGLQGRGLRK----LKQLI-QLLWSAWPVTRLIRKQECAVVFTTG
MURG_PROMP       --------NLLTLNLETPK-KNIFR----VFQYL-KILFSIFNIIKILKEKKINLVFTTG
MURG_CHLPN       ---------YREIPSGLPTVLNPIK----IMSRTLSLCSGYLKARKELKIFDPDLVIGFG
MURG_CHLAB       ---------YKEIPSGLPTFVRPIT----AVRRVCSLYAGYKKAKKELLIFDPDVVIGFG
MURG_CHLMU       ---------YYDIPSGSPFSLRPNQ----MFSGARQLYQGYTAALRMIKSFAPDVAVGFG
MURG_CAMFF       ------FKFKYFFPSRGVVNKKGIH----KLFALLNIIKLAFKCRCIFTEHNISSVISVG
MURG_CAMHC       ------FDEKYFLKSSGVVNKKGIS----RILSLFKILALSFGCRKIFAKHDVKAVISVG
MURG_CAMJR       ------FKEKFFLSSKGVVNQSKFD----KISSLLHTLKLSKDCREIFKKYHIQAVFSVG
MURG_NITSB       ------FQKKLFFDVEGVVNKKGIN----KIRALTDIVRASFAAKKLIKNESIDAVVSVG
MURG_SULDN       ------FSHVYFLQTTGVVNQRGLG----KLKALWLVLRAFFASRAILKKHNIQATYSVG
MURG_WOLSU       ------FKRRFFLETQGVVNQRGIA----KIRSLSSQFQAMLEARKILKNHQIKRVVSVG
MURG_SULNB       ------FTETYFFDTRGVVNQRGFG----KLKSLWMMLQAMMKARKLLKKYDAKVVFSVG
MURG_HELAH       ------FSECYFFNTQGVVNKSFFK----KIGSLFLQAKAALKAKEILKKHQITHTISVG
MURG_HELHP       ------FTHCYFLDSTGVVNKKGLG----KIKAIFKQLKAAWEARNILKKHKIEYVISVG
MURG2_BACC1      -----EGIPYYSIASGKLRRYFDLK----NIKDPFLVMKGVMDAYVRIRKLKPDVIFSKG
MURG_CLOTE       -----EGIKYHEISSGKLRRYFDLK----NFTDPFKVLKGIMEARKIIKKEKPNIVFSKG
MURG_GEOTN       -----DGVPYYSVSTGKLRRYFDWK----NFKDPFNVLKGVWQAYRLIQKEKPDIVFSKG
MURG_OCEIH       -----DGVTYHSVSTGKLRRYMSKE----NLKDPFKVLKGTMQAYRIIGKRKPSIVFSKG
MURG_STAS1       -----PSIKYHSISSGKLRRYISWD----NIKDIFKVLKGVLDARSVLKKEKPDLLFSKG
MURG_BACSK       -----AGIRYFGISSGKLRRYMDWK----NVTDIARIANGFRQARKILKAEKPDVVFSKG
MURG_LEGPC       ------DIPFHGVSSGKLRRYFSLK----NLLDPFKIVLGIIQSSLLFYKIKPDVVFSKG
MURG_STRP1       -----LDVTFHAIATGKLRRYFSWQ----NLADVFKVALGLLQSLFIVAKLRPQALFSKG
MURG_STRP3       -----LDVTFHAIATGKLRRYFSWQ----NLADVFKVALGLLQSLFIVAKLRPQALFSKG
MURG_STRP6       -----LDVTFHAIATGKLRRYFSWQ----NLADVFKVALGLLQSLFIVAKLRPQALFSKG
MURG_STRMU       -----FDVIFHSIATGKLRRYFSLK----NVLDVFKVGWGVLQSLTIMVKVRPQVLFSKG
MURG_STRS2       -----LDVHFHSIATGKLRRYFSFQ----NMLDVFKVGFGVLQSLTIIAKIRPQALFSKG
MURG_TREDE       YSASPSVLEFIGIPAGKLRRYFSFQ----NFIDVFKVAAGFIKSFFILLKLKPVFVFSKG
MURG_TREPA       ------GLEFCGITAGKWRRYASVR----NFFDVFRVLVGTVQSYCILRALRPQALFSKG
MURG_BORBU       ------NIKFISIPCGKLRRYFSFK----NFTDFFKVILGIIKSFYVLKKYKPQLIYATG
MURG_PARUW       -------FPFQEVSASPLFSKNPFK----LLKGVFNLLRGVWQSIRIIRKFKPDVVVGFG
MURG_RUBXD       -------FGLHALPLSGLAGGPASR-----ARASLLFARAVVRCRALLRELRPGAVLGVG
MURG_ROSS1       -------LPFHALPAAAVRGRNPLT----MVRNLITLARGTGAAHRLIARDRPAAILGTG
MURG_THEP1       ------EFETVSIDVRGLLRPLHHP---KNLWRTLKIGIATIEVKKHLKRFKPDLVVLTG
MURG_AQUAE       -------TEKLFLDVEPLRERNFYQ----KLKAIWKFLKAQEEINEFLKEDYRALIF--G
MURG_FUSNN       -------HKFIGVDISVPRGLKNIR----------KYLKAIRTAYKVIKEEKPDAIIGFG
MURG_PELUB       -------YNLKIFNVRPISKNLLII-----PLDFIFMIFLIFKSISFFRKNKIDTLISTG
MURG_LEPIC       --------PDLEQAPCPVLWHNLPPLSSNFFLFPIRYTIQIIKTFFIFKKLNIDVVIGMG
MURG_STRSV       -----LDVTFHSVATGKLRRYFSWQ----NLLDGFKVVWGIFQSLGIMLKVRPQALFSKG
                                                                            *

MURG_ACICJ       GYPSVPPVLAAATLR--RRPAIVLHDQNAVLGGANRFLARFAD-HLALSFEGTVGLPGRA
MURG_GRABC       GYPCIPPVLGARLRA--RNVPVILHEQNAVLGRANRLLARKIH-CLALSFASTSHVPAGT
MURG_GLUOX       GYPSIPPLTASRLLPSAKRPQMVIHEGNAVLGQANAFLSRFSP-LIATSYAKVARLPENA
MURG_RHILO       GYPTLPPLYAATRRK----VPTLIHEQNAVMGRANRALAGRVD-AIAGGFLPQDTS--AA
MURG_RHOPA       GYPTLPPLLAATWRR----VPTLIHEQNAVMGRANRFLAPRVD-AIATGFPGHEIAWPVL
MURG_BARBK       GYPTVPPVWVAALTG----RVTFIHEQNAVMGRANRVLATRVN-AIASGLLLENKI---H
MURG_ZYMMO       GYPALPALLAAFKAK----IPTVIHEQNAVMGRTNRFLAGRVD-AIATAYHQVDRLKKRY
MURG_SPHAL       GYPSLPSLLAAGATK----RPRVIHEQNAVLGRVNRLMAPRVD-AVAVAYHHIQRYPAGH
MURG_MAGSA       GYASVPGMGAAALAG----IPTAIHEQNAVLGRANRLLAGHVR-RIATSFAEVSHVEPKL
MURG_RHORT       GYASVPTMLAAIRLK----LPTVVHEQNAVPGRANRLLAARVS-RYAVSFARAERPR---
MURG_HYPNA       GYPAFPALAAARRLG----VPIIIHEQNAVLGRVNRQFAKHAQ-LVASGFERLDRLPRGS
MURG_MARMM       GYPAFPALAVARSMG----IAFAIHEQNAVLGRVNRVFAAKAG-FVASGFERLDRLPAKA
MURG_CAUVC       GYPALPALLGALSQG----RPTVIHEQNAVLGRVNRFLAPRVN-EVACAFPILEKATPAV
MURG_JANSC       GYPTIPAMAAARLTG----RPRMLHEQNGVLGRVNRVFAKHVA-HVACG-TWPTDVPLGA
MURG_PARDP       GYPTIPAMSAALVLR----IPRMIHEQNGIMGRVNMAFARRVD-RVACG-TWPTRLPPGV
MURG_WOLTR       GYASFPTLLAAKVLS----IPIILHEQNAVLGRVNKFFFNSAE-LIATSFPETKYAK--G
MURG_ANAMM       AYASFPVLLSAWLMS----VDAVLHEQNSVMGRVNRVFAGYAR-VIACGLPLRTVGNKLA
MURG_RICTY       GYPVIAPMFAAIFLR----IPIIIHEQNSYLGKVNKFFARFAK-KIAISYEDIKNVPEFA
MURG_ORITB       GYTIAPIIINGILFR----IPFILHEQNSVLGLANRLFLRYAK-AITVTFANTLNLNNRY
MURG_KORVE       GYASGPAMLAARLCR----VPTVIFEPNIYPGFANRLVAPFAA-AAAVHFQETCKHFRQ-
MURG_SOLUE       GYVAGPPVMAALVRR----VPVVVMEPNAFPGFTNRVIARLVS-RALVSFPETAAFFPKG
MURG_MYXXD       GYASGPVVMAAWLMG----IPTAIQEQNALPGFTNKVLGRIVR-VVFIAFEEARAFFPEK
MURG_SYNAS       GYASGPAVMAAHLMG----IKTAIAEQNSIPGLTNRILGRFVD-RVFLSFSDGGKWFSAK
MURG_PELCD       GYASAPMLVAARLKR----IPTVIHEQNAWPGLTNRLLGPWAR-CVCLSFSEAERAFHRA
MURG_PELPD       GYASLPMLLAARTRQ----VPSFIHEQNAVPGMTNRLLSRFAD-RIFITLEESSRFFAGR
MURG_MAGMM       GYASAPAMVAARSLG----IPMALHEQNARAGLTNRLLSHLAQ-QVLVSFNGVCAQFPGR
MURG_BDEBA       GYASGPFVLAASIIG----FNTAVWEPNAMPGMANRILSRFVD-KCFVVFNEAKKHLKGD
MURG_DESPS       GYVTGPVVAMAKLCR----RPTLIHEQNSVPGLANRKLAKLVD-RVCVSLPASASCFPAD
MURG1_BACC1      GYVCGPVVYAAAKLG----IPTIVHEQNSVPGVTNKFLSRYVD-KVAVCFEAAAEHFP-Q
MURG1_BACAN      GYVCGPVVYAAAKLG----IPTIVHEQNSVPGVTNKFLSRYVD-KVAVCFEAAAEHFP-Q
MURG_LISIN       GYVCGPVVYAAAKLK----IPTLIHEQNSIAGLTNKFLSRYTD-KVAICFEEVSDSFA-S
MURG_ENTHR       GYVSGAVVYAASKLA----IPTIIHEQNSVPGITNKFLSRYVD-RIALSFEDAAPFFP-A
MURG_LACLA       GYVAGPVVYAAAQLK----IPTIIHEGNSFPGITNRFLAKKVD-RIAVGFHAAEQYFP-A
MURG_LACSS       GYVSGSLLYAASRLK----VPTIIHEQNSAAGVTNKFLARFVD-KVAISFESVSDQFP-M
MURG_LACP3       GYVSGAILFAATRLH----IPTVIHESNSVAGVTNKFLSHFVD-RVAIVFPEVAKAFP-A
MURG_LEUMM       GYVSGAVVYAAQRLH----IPTVIHEQNSVAGVTNKFLSRGAT-KIGVAFDAALSQFP-K
MURG_OENOB       GYVSGAVLYAAQRLR----IPTVINEQNSIAGVTNKFLSRGAD-RIAISFPHAANQFP-K
MURG_LACJO       GYVSGAIVYEAAKMH----VPTIIHESNSVVGLANKFLAHYVD-KICYTFDDAAKQFSEK
MURG_HUNT2       GYVCGPVLFNASRMK----IPTLVHEQNAFPGVTNKILSKFVD-RVAISFKEAEKYFKDK
MURG_CALS4       GYVCGPVLMAAVIKR----IPTLIHEQNAFPGLTNRLLSPFVD-IVAVSFEDSVKYFKKA
MURG_CLOD6       GYVSGPVLFNASMGK----IPAIIHEQNSFPGVTNKILSKTVT-KVLTSFEDSHKRFPEA
MURG_CALS8       GYVSLPVALAARRLK----IKTILHEQNAYPGLANKIISRFCE-KILISFEESKRFFKNS
MURG_DESHY       GYVAGPVVLTAALFG----IPTLLHEQNALPGITNKILTRFVR-KVMVTFPESIAHFGVQ
MURG_MOOTA       GYVSGPVCLAAALQG----VPVILHEQNAFPGVTNRLLAILAR-CVCLTFPEAASRFPRR
MURG_SYNWW       GYVSFPIVMAGTFFP----SKTVIHEQNAIPGLANRNLARRVD-YALLNFAEAAPYMKAK
MURG_CARHZ       GYASFPVVFAATVLK----IPTVIHEQNAYPGIANKILAARVD-AVCLTFGEAKKRMKAK
MURG_SYMTH       GFVAGPVLAAARLAR----VPLVIQEQNAFPGVTNRLAARWAT-AVFVPYEEARAHFPPG
MURG_FLAPJ       GFASGAVLKVASILG----IATVIQEQNSYPGITNKLLSKKAN-KICVAYENLEQFFPKD
MURG_GRAFK       GFGSGPLLRIAISKG----IPTLIQEQNSLPGVTNRILSKNAS-IICAAYEKVKDVFPAE
MURG_CYTH3       GYASWPLLQAANASG----VATLIQEQNSYAGVANKALSKKVK-AICVAYERMERFFPGD
MURG_PORGI       GYASGPTLRRAHSLG----IPTLIQEQNSYAGVTNKLLSRGAH-KICVAYPEMDKFFSPE
MURG_CHLCH       GFVSAPLLFAAQLLG----KKTLIQEQNAFPGVTTRLLSLFAS-EVHVAFNEARRFLLNK
MURG_SALRD       GYVAAPVLMAAWLRG----RPLLIQEQNAYAGLTNRVLARLAL-RIHLAFPEAKDWVPAE
MURG_DESVV       GYAAFAGVLAARLRG----RPAAIHEQNSVPGVTNRVLSRVVP-RVFLSLPDTLGAFPPQ
MURG_DESAG       GYAAFAAMVAAKLRE----KPCAVHEQNSVPGMANRLLAKIAD-RVFISFPDPQEYFLQR
MURG_LAWIP       SYASFAPLVAAKLKR----IPTAIHEQNVRPGLANRMLARLAD-RVFLSVPDTLHIFTKK
MURG_ACIC1       GYVALPGYLAARRTG----LPYVVHEANARPGLANRWGARFTR-YVAVADAAIRLPH---
MURG_THEFY       GYVATPGYLAARSRR----IPIVVHEANPLPGLANRLGARLTP-HVFTGHPHTEIRN---
MURG_FRACC       GYVSAPAYLAARRRG----IPIVVHEANPLPGLANRLGARLTP-FVATSYPSTPLRG---
MURG_SACEN       GYVSLPAYLAARG-K----TPIVVHEANARAGLANKVGAKFAE-RVLSATPDSGLAG---
MURG_CORJK       GYVSAPAYLAARSLK----IPFFVHEANARAGVANKLGVKLGG-TGLAAVEDSGLE----
MURG_NOCSJ       GYVSMPAYVATRKRG----IPLVVHEQNTVPGLANRAGARFAQ-RVAVSFPDTPLRN---
MURG_ARTS2       GYVCTPLYLAARRRK----IPIVIHEANTRAGLANKVGARFSH-HVGVAFAGTKLRG---
MURG_LEIXX       GYAAAPAYSAARKAA----VPLILHEANARPGLASRLGARYTP-WVGVAFEGTRLPH---
MURG_BIFLO       GYASAPVYATAHKMG----IPIAIHEQNARAGMANKLGARWAD-FIGTVYEGTGLKPRAG
MURG_CUTAK       GYVSLPAYLAARRAK----IPVVIHEQNAVPGLANKIAARFAV-FVGTAFPDTPLPK---
MURG_COREF       GYVSAPAYLAARSLG----IPFFVHEANARAGMANKLGVRLGG-VGLNATENSGMPG---
MURG_CORDI       GYVAAPAYIAAKLQK----IPFIVHEANARSGMANKLGVRLGG-MGLNAVANSGMPG---
MURG_TROWT       GYVAAPAYAAAISLN----IPYVVHESNARPGLANLLAAHFAK-CVGISVIGALPCG---
MURG_DEIRA       GFASLPGVLAAQSLG----IPTILHEQNARLGLTQRLAVRRAR-AVGTAYDKVIGLD--P
MURG_THET2       GYAGFPGGMAASLLG----IPLLLHEQNARLGLANRALAPLAK-GLALSVPLALPAPL-A
MURG_ACISJ       GYVTFPGGIAARLAR----KPLLLHEQNSVPGMANKLLSRLAT-RVYTAFPNVLPDAQ--
MURG_BORA1       GYVAFPGGVVAALRR----TPLVVHEQNAVAGTANRWLARMAK-NVLTGFPAVLPGAD--
MURG_DECAR       GYITFPGGMMAALTG----VPLVLHEQNSVAGLANRVLASVAD-RIVTGFPDVIKNGT--
MURG_THIDA       GYTAFPGGMMASLLN----RPLVVHEQNSVGGLTNRLLACLAD-RVLTAFPAVFTHAHDK
MURG_NITEC       GYPALPGGIMAVLSG----KPLLIHEQNRIAGLTNKILAKIAS-RILLAFPGTITDQAG-
MURG_NITMU       GYPAFPGGMMASLLA----RPLLIHEQNSIPGLANRILSRLAD-RVLLGFPDAIKSEK--
MURG_METFK       GYVTVPGGWAARLAG----VPLAIVNADAALLMSNRALVKHAK-RVLFGFDGGAATLGGM
MURG_NEIG1       GFVTFPGGLAAKLLG----VPIVIHEQNAVAGLSNRHLSRWAK-RVLYAFPKAFSHEGG-
MURG_HAHCH       GFASGPGGIVACLTG----TPLVIHEQNAIAGMTNRWLARGAR-YVLEAFPQTFAQAQ--
MURG_MARHV       GFVTGPGGIAAWLMR----KPLVIHEQNAIAGMTNRWLTRFSE-TVLEAFPGSFGDQT--
MURG_CHRSD       GFASGPGGLAAWLMR----RRLIVHEQNAVAGMTNRYLSRLAD-GVYAAFPGAFGAH---
MURG_PSEU5       GYVTGPGGLAAKLAG----VPLVIHEQNAVAGTANRSLVPLAS-RVCEAFPDTFSSSA--
MURG_XYLFT       GFAAGPGGIAARLMG----LPLIVHEQNRAPGMTNRVLARVAR-RVLSGFPGSFV-AE--
MURG_ALCBS       GFASGPGGLAARLCK----VPVVVHEQNAVPGLTNRLLSRLST-VTLEGFQGAFG-HP--
MURG_ALKEH       GYAAGPGAVAAWLTR----RPLIIHEQNAVAGLTNRLLSRLAR-RVLTGFPGILP-ER--
MURG_NITOC       GFVSGPGGLGAWLLR----RPLLIHEQNAIVGTANRLLAPLAG-RVMEAFPGTFPPAR--
MURG_HALHL       GYVAGPVGLAARLAG----RPLIIHEQNARAGMTNRFLARLGH-RVLTGFPDALG--A--
MURG_METCA       GFVAGPGGLMARVLG----IPLIIHEQNRIPGTTNRWLSRIAN-RVLEAFPGAFQASA--
MURG_DICNV       GFASGPGGIAAKILN----IPLLIHEQNAVMGLTNALLSRVAN-TILLASQQAAAKIAL-
MURG_HYDCU       GFVCGPGGLAALSLN----KPLVLHEQNATPGLTNKLLAPFAK-KVICAFPQSTIK----
MURG_SACD2       GFVAGPGGMAARKLK----IPLVIHEQNAAAGTTNKILRRFAN-LTLVAFPGSLKN----
MURG_ACIAD       GYVAGPGGLAARILG----IPILIHEQNAVAGFTNTQLARVAS-KVCEAFPNTFPAS---
MURG_PSYCK       GYVSAPGGIAARLTK----TPLIIHEQNAIAGMSNRYLAKMAT-KVLQAFENTFGNSQL-
MURG_IDILO       GYVCAPMGLAAKLLG----IPLVVHEQNAIPGMTTRLLAPRAN-KVMLGLPVALPQW---
MURG_HAES1       GYVSGPGGVAAKLCN----IPVVVHEQNAVLGLTNSLLAKIAT-RVLQAFPNTFPNAE--
MURG_VIBCH       GYVSGPGGIAAWLLG----IPVVLHEQNAVAGLTNQWLAKIAR-RVFQAFPGAFADAS--
MURG_BLOPB       GYVSGPGGLAAWTCG----VPLIIHEQNRIIGLTNRYLSIFSK-KVLQGFPGTFPNAK--
MURG_BAUCH       GYISGPCGLAAWMCK----IPLVIHEQNRVTGLTNYYLSKFAK-KVLQAFPSVFPNAN--
MURG_BUCAP       GYVSGPGGLAAWSCK----IPFILHEQNKIAGITNKLLSKIST-KNMQAFSGTLLNAE--
MURG_BUCBP       GYVSVPGGIISYLYK----KPLIIHEQNKIAGLANKLLSKFTT-INMQAFANTILTSKS-
MURG_WIGBR       GYVSFPGAIATWISK----VPLIIHEQNSVPGLSNYILYKLTNCKILQAFPNTFPRAK--
MURG_PSEA6       GFASGPGGVAAWLMG----KPLVLHEQNAAPGMTNRLLARIAN-KVLTGFAGTFDAQKTA
MURG_PSYIN       GFASGPGGIAAWSMG----IPVILHEQNAVAGLTNRILSLFSK-RVLMGFSGAFK-----
MURG_SHEFN       GFASGPGGVAGKLSG----IPVVLHEQNAIPGLTNKLLSKIAK-KVLCAFPNTFA-----
MURG_COLP3       GYASAPGGLAAWLSK----IPLIVHEQNAAAGLSNRLLARIAN-KVCCAFPNAFVSGI--
MURG_PSEHT       GYVTGPTGIAAKSLG----IPLVIHEQNAIAGMSNKWLAKFAN-RVLAAFPSAFATG---
MURG_COXBU       GYVAGPGGLAAWITR----TPLIIHEQNSIPGLTNRVLAKMAK-FILQGFPDTFPQNR--
MURG_FRATN       GYVSGPICLAAALIN----IPVIIHEQNAKIGLTNRILAKFAT-TICLAFEIENLHKQFS
MURG_VESOH       GFTSGIGGLVAWVFK----TTLVIHEQNSIPGTTNKILNKIAT-KTFQAFDDTFIRNATT
MURG_TRIEI       GYIAAPAIIAARYLG----LPVILHESNVLPGKVTRWFSRLCN-VVAVGFEEGTKYLSFE
MURG_SYNY3       GYIAAPAIVAAKLCN----IPVIFHESNFIPGKVTTWLGRWCD-TVAIGFRGTAKYLPNC
MURG_SYNE7       GYIAGPAIAAAWSLG----IPVVLHESNALPGKTTRLLSRFCR-RVALGFAEAGEYLPGR
MURG_SYNJA       GYIAAPTILAARSLG----VPVLLHESNCLPGKVTRWLGRFCR-LVALGMAETAEHLPGA
MURG_GLOVI       GYIAAPAVLAARSLN----LPAIGHESNVLPGKVIRYLARWMR-SLGLGFAESATYVSGA
MURG_THEEB       GYIAAPAILAARSLG----RVAILHESNALPGKVTRWLAPWCT-LVALGTPASLAYLQSK
MURG_PROMA       GYIAAPAIIASKLCG----INVILHESNSYPGKVTRLLGKFCD-EVALGLPIAAEKLKRC
MURG_PROMT       GYISAPSILGAKMAG----IPVLLHESNAIPGKVTRLLGRFCD-HVALGIPSASEYLQRC
MURG_SYNR3       GYIAAPAILAARLCR----RPVVLHESNAIPGQVTRLFGRFCS-RVALGLPQAADYLSGC
MURG_PROMP       GYISAPTILAAKWLK----IPVILHESNLIPGTVTKYFGFLCE-FVLLGFKDTNYYLKNC
MURG_CHLPN       SYHSLPVLLAGLSHK----IPLFLHEQNLVPGKVNQLFSRYAR-GIGVNFSPVTKHFRCP
MURG_CHLAB       SYHSLPVLMAALKKK----IPIFLHEQNVVPGKVNKLFSRFAK-GVGVSFPPVIKRFACP
MURG_CHLMU       SYHSLPAILASIRKR----IPLFLHEQNVVPGKVNKLFSHFAK-GVGMSFSAAGEHFRCR
MURG_CAMFF       GYSSAPASFGAVIFR----KKLFIHEQNAIKGKLNSILKPFCK-KFFSSY----------
MURG_CAMHC       GYSSAPAAFWAVANK----IPLFIHEQNAEIGKINALLKRFAK-RFYSSY----------
MURG_CAMJR       GYSAAPASFAALFSH----LPLFIHEQNSKSGSLNMLLKPFAT-KFFSAF----------
MURG_NITSB       GYSAAAASFAALQLN----LPLFIHEQNAVKGKLNRLLSPFAK-RVFCSF----------
MURG_SULDN       GFSAAAASFASLSRL----IPLFIHEQNAVYGKLNSILKPFAT-RFISAYD---------
MURG_WOLSU       GYSAAPASLAALSLG----IPLYIHEQNAKVGLLNRLLKPFSR-AFLSSYD---------
MURG_SULNB       GFSSAATAFAAKSAS----VPLVIHEQNAALGSLNKLLRPYAA-AFISSYL---------
MURG_HELAH       GFSAGPASFASLLNK----IPLYIHEQNAIKGSLNRYLSPKAK-AVFSSYAFKDK-----
MURG_HELHP       GFSAGGASIGAILSN----TPLFIHEQNAIKGKLNEILTPFAK-AIFGSFEGKSK-----
MURG2_BACC1      GFVSVPVVIGGWLNR----VPVLLHESDMTPGLANKIALRFAS-KIFVTFEEAA--KHLP
MURG_CLOTE       GFVAVPVVIGAYLNK----VPVISHESDMTPGLANKLSTPYCN-KVCVTFPETL--KYIK
MURG_GEOTN       GFVSVPVILGAWLNG----VPSVIHESDLTPGLANKIAMPFAT-KICLTFPETK--QHVN
MURG_OCEIH       GFVSVPVVAAAKLRG----VPSIIHESDYTPGLANKLSIPFTK-RVLATFPETM--KYLP
MURG_STAS1       GFVSVPVVIAAKSLK----IPTIIHESDLTPGLANKISLKFAK-KIYTTFEDTL--NYLP
MURG_BACSK       GFVTVPVVAAAYTLR----IPVHLHESDLTPGLANRLAKRFAN-TFYTSFAETA--AHFP
MURG_LEGPC       GFVAFPVVVGAWLNR----IPVVAHESDMSPGLANRLSFPFVN-KICLTFDAGK--KYFK
MURG_STRP1       GFVSVPPVVAAKLLG----KPVFIHESDRSMGLANKIAYKFAT-TMYTTFEQED--QLSK
MURG_STRP3       GFVSVPPVVAAKLLG----KPVFIHESDRSMGLANKIAYKFAT-TMYTTFEQED--QLSK
MURG_STRP6       GFVSVPPVVAAKLLG----KPVFIHESDRSMGLANKIAYKFAT-TVYTTFEQED--QLSK
MURG_STRMU       GFVSVPPVVAANLLR----IPVFVHESDLSMGLANRIAYKFAT-TMYTTFEQSD--NLTK
MURG_STRS2       GFVSVPPVIAANLLR----VPVFIHESDLTMGLANKIAYKFAT-TMYSTFEQPA--SLTK
MURG_TREDE       GFVSVPPCAAAKFLK----IPVITHECDFSPGLATRINSKFAN-RILVSYQETAELLPAS
MURG_TREPA       GFVSVPPCIAAWLLR----IPVVTHESDISPGLATRINARFAD-RILVSYPHTSCYFPRA
MURG_BORBU       GFVSTPAIIASSLLK----IKSITHEMDLDPGLATKINSKFAN-NIHISFKESEKYFKNY
MURG_PARUW       SYYTVPPLLAAKILR----IPIVLHEANSIPGKANKWLASMAW-RVGIHFPFTATLLKGN
MURG_RUBXD       GYASAPAVAAARLLG----IPTFIHEQNSVPGKVNRAAGRFAR-EVLVAFPDAARRFGRA
MURG_ROSS1       GYVCVPVFLAARLAC----VPTVIYQPDVVPGLAVRLLARLAN-LVACSVADSGRYLGLT
MURG_THEP1       GYISGVVGLAAKDLG----IPIFVHEQNVVPGLAVKVLSQYAK-KVFVSFERTRDYLREW
MURG_AQUAE       GYASLPLGINTVLRR----KELFIHEQNSIPSKTNKILSKKAK-KVLITFNYTKRFFP--
MURG_FUSNN       NYISVPVIIAGILLR----KKIYLQEQNVNIGSANKMFYKIAK-MTFLAFDKTYDDIPIK
MURG_PELUB       GYMSLPLCLGARILN----IKLLLFEPNMVLGRSNKFFLSYCQKIFCYSNNIKKFPIKFK
MURG_LEPIC       GYSTVSSILYGIFFR----KKIYLCEQNTIPGNVNRLFFRFAS-KVAFSLPPKNSKIPCD
MURG_STRSV       GFVSVPPVIAARLSG----VPVYVHESDLSIGLANKIAYKCAT-KMYATFEQPSSLNKIE
                  :                       : :                                

MURG_ACICJ       ------------------RATVTGNPVRAAISVLA-------------------------
MURG_GRABC       ------------------RTLVTGNPVRPAIAALA-------------------------
MURG_GLUOX       ------------------RTTLTGMPVREGIEALF-------------------------
MURG_RHILO       GE----------------KTVTTGNPVRPAVLEAA-------------------------
MURG_RHOPA       AS----------------KITNTGNPIRPAVADAA-------------------------
MURG_BARBK       IH----------------KTFVTGNPVREAILKAA-------------------------
MURG_ZYMMO       RR----------------KTEVTGNPVRDEVLFLR-------------------------
MURG_SPHAL       EL----------------KMHITGNPVRDEIVAIR-------------------------
MURG_MAGSA       AP----------------KLVHTGMPVRAAILASR-------------------------
MURG_RHORT       GA----------------RPVVVGMPVRPSVLALR-------------------------
MURG_HYPNA       ------------------AHMVIGNPVRAPIIAAG-------------------------
MURG_MARMM       KK----------------RHILTGNPLRAPILAAR-------------------------
MURG_CAUVC       KA----------------CAHVVGNPVRPPVRALF-------------------------
MURG_JANSC       ------------------DAIHTGNPVRAAIVERG-------------------------
MURG_PARDP       ------------------QGIHTGNPVRQAVLDRA-------------------------
MURG_WOLTR       NK----------------CVFIGNFVDIK-AKSHS-------------------------
MURG_ANAMM       HK----------------VAHVGVPTDVKKAVKRP-------------------------
MURG_RICTY       KS----------------KIVLTGGIVRKNIRELDSFIYLASQHCPTKLTKTVLTNTLNH
MURG_ORITB       KH----------------KVIVTGTPVRKALR----------------------------
MURG_KORVE       -------------------CTVTGVPVRQAFFNLP-------------------------
MURG_SOLUE       R------------------TEVTGLPVREEFFRIP-------------------------
MURG_MYXXD       K------------------VQLIGNPIRRKLMDNY-------------------------
MURG_SYNAS       K------------------AAVSGNPIRAAFFNGK-------------------------
MURG_PELCD       A------------------TIVTGNPLRKGMEG---------------------------
MURG_PELPD       R------------------TLLTGNPLRRQILDRLGTRDQGPGIRD---------QEKHM
MURG_MAGMM       A------------------CQLTGNPVRQALAAVPPLQI---------------------
MURG_BDEBA       S------------------IIQTGMPVRAEIEAAVHD-----------------------
MURG_DESPS       K------------------VVFTGNPVRENLVALAAK-----------------------
MURG1_BACC1      S-----------------KVVMTGNPRASEVMDQNGM-----------------------
MURG1_BACAN      S-----------------KVVMTGNPRASEVMDQNGM-----------------------
MURG_LISIN       E-----------------KIVFTGNPRASEVVGVDGE-----------------------
MURG_ENTHR       E-----------------KSSLIGNPRAQEVADMDKS-----------------------
MURG_LACLA       S-----------------KTTFTGNPRAQEVADA--------------------------
MURG_LACSS       H-----------------KVVLTGNPRAQQVAGMVPN-----------------------
MURG_LACP3       N-----------------KVVVTGNPRAQQVAGLKPN-----------------------
MURG_LEUMM       D-----------------KVFVVGNPRAQQVASIKSN-----------------------
MURG_OENOB       D-----------------KVVLTGNPRGQQVFEKKGD-----------------------
MURG_LACJO       K-----------------KLVKTGNPRSQQVLGLNKENI---------------------
MURG_HUNT2       S-----------------KVVFTGNPIRSEMLEVSRE-----------------------
MURG_CALS4       K-----------------KVVVTGNPIREELLRVKKE-----------------------
MURG_CLOD6       AED---------------KLVFTGNPVRKEILLSRKN-----------------------
MURG_CALS8       N-----------------KVVLTGNPVRLEIFSHNER-----------------------
MURG_DESHY       K-----------------KLVLTGLPVRAEIGN--ISRE---------------------
MURG_MOOTA       A-----------------KLVTTGLPVRPEIIQ--ADRD---------------------
MURG_SYNWW       S-----------------MKV-TGLPVRSEIFN--VQRA---------------------
MURG_CARHZ       N-----------------LYE-TGLPVRREFFTNAANRN---------------------
MURG_SYMTH       V-----------------RLIRAGNPVRPEIASASRE-----------------------
MURG_FLAPJ       K------------------MILTGNPVRQDLISVDGKRN---------------------
MURG_GRAFK       K------------------TIITGNPVRQDLLKVDQLRE---------------------
MURG_CYTH3       K------------------IVYTGNPVRKDIVDYKKYSE---------------------
MURG_PORGI       K------------------IVFTGNPIRPEIEFGHPSRS---------------------
MURG_CHLCH       R------------------HVFLTGNPARLFQPMDA--A---------------------
MURG_SALRD       H------------------AVVSGNPTRQSLRDADP--D---------------------
MURG_DESVV       ------------------KTCLAGNPVRASIVACGAERS---------------------
MURG_DESAG       ------------------KTVLTGNPVRAAIAAAGAHRA---------------------
MURG_LAWIP       S-----------------KVRYTGNPIRQSIVDLHYKFE---------------------
MURG_ACIC1       -------------------AVPLGIPLRREIATLDRA--------------------ARR
MURG_THEFY       -------------------GRYIGIPLRTRISNLDRL--------------------AVG
MURG_FRACC       -------------------ATLTGIPLRGEILTLDRSP-------------------AAM
MURG_SACEN       -------------------ARTIGIPLRESITTLDRA--------------------ALR
MURG_CORJK       -------------------AEIVGIPVRESVLQLDRK--------------------ALR
MURG_NOCSJ       -------------------AEYVGLPIRPMISGLDRA--------------------ARR
MURG_ARTS2       -------------------ARHVGMPMRREVSGLDRA--------------------ASR
MURG_LEIXX       -------------------ARFVGMPLRPEIEELDRV--------------------AAR
MURG_BIFLO       A-----------------DVERVGLPLRPAIASLTKRIGDD--------------RAAVR
MURG_CUTAK       -------------------ARFVGMPLRSQITDLADASGQA--------------RAERC
MURG_COREF       --------------------QVVGIPIRRELAGGEDATAA--------------------
MURG_CORDI       --------------------TVVGIPIRSSLSG--DNTAL--------------------
MURG_TROWT       --------------------KLVGTPIRRDLTAAASF---------------------DP
MURG_DEIRA       R-----------------KATLVGMPVREERMP--------------------------R
MURG_THET2       R-----------------KARVVGYPVREVRYP--------------------------K
MURG_ACISJ       ---------------------WVGNPMRRAFTRQPRPER---------------------
MURG_BORA1       ---------------------NVGNPVRADLCDLSSPAQ---------------------
MURG_DECAR       ---------------------WVGNPVRPEIAAIAAPAE---------------------
MURG_THIDA       PIPCR-----------RVSAEWVGNPVRGDITA--APAG---------------------
MURG_NITEC       ------------------KIQVTGNPVRTEIAQLPSPEV---------------------
MURG_NITMU       ------------------KAVFCGNPVRDEITRLAPPAQ---------------------
MURG_METFK       AF----------------KARVTGNPVRAEIVEIASPEQ---------------------
MURG_NEIG1       ---------------------LVGNPVRADISNLPVPAE---------------------
MURG_HAHCH       ------------------SVVTVGNPVRDELAALPSPQE---------------------
MURG_MARHV       ------------------VTRCTGNPVRGEVASMDEPEQ---------------------
MURG_CHRSD       ------------------RAEVVGNPVRDDIAALGETPRG--------------------
MURG_PSEU5       ------------------KRRTTGNPVREEL--FLETPR---------------------
MURG_XYLFT       ------------------EV--VGNPVRKDIAALPAPGV---------------------
MURG_ALCBS       ------------------QACWVGNPVRPQITALEEPAR---------------------
MURG_ALKEH       ------------------GGEHVGNPVRDAITRVPGPAD---------------------
MURG_NITOC       ------------------KAEWTGNPVRESIEQLSESRA---------------------
MURG_HALHL       ------------------RSEWVGNPIRTRIHRLESPQE---------------------
MURG_METCA       ------------------GAVCTGNPLRQGIETFRDHHT---------------------
MURG_DICNV       ----------------KYPYRVTGNPVREDITLLPAPEE---------------------
MURG_HYDCU       ----------------GKQVTVIGNPVRSGLESLPVVKA---------------------
MURG_SACD2       -------------------GVFVGNPVRKDIETVAPPQQ---------------------
MURG_ACIAD       -----------------AKRVTTGNPVRKEITAILSPKWRYD------------------
MURG_PSYCK       ----------------DAKLETVGNPVRNAITGVAEPIARYD------------------
MURG_IDILO       -----------------QQYPVVGNPLRKGLLAQAAEQTEKS------------------
MURG_HAES1       ---------------------VVGNPVREAFFSVPMPQER--------------------
MURG_VIBCH       ---------------------VVGNPVRQDVVQLAAPEQR--------------------
MURG_BLOPB       ---------------------MVGNPIRRAILAVPNPSRR--------------------
MURG_BAUCH       ---------------------VVGNPIRKEILAVIEPSLR--------------------
MURG_BUCAP       ---------------------IVGNPIRKNIIDIPPPIKR--------------------
MURG_BUCBP       --------------------ITVGNPLRTSITNLKKSWDR--------------------
MURG_WIGBR       ---------------------VVGNPIRNAILKIKTPEKR--------------------
MURG_PSEA6       DRQGQDV-------SDSAKYQWVGNPVRAGFATIMPKQIS--------------------
MURG_PSYIN       ----------------SGKAILVGNPVRKQLVDLPVKKIS--------------------
MURG_SHEFN       --------------SNVANVEVVGNPIRQELIELGAQIKT--------------------
MURG_COLP3       ------------------DVEVVGNPLRASIGQQALVSENI-------------------
MURG_PSEHT       ------------------QAELVGNPVRESVANIAV------------------------
MURG_COXBU       ------------------KVITTGNPVRTELVKMPLPQVR--------------------
MURG_FRATN       SKQLA-------------KTKLVGNPVRKDIVALNDKARI--------------------
MURG_VESOH       SG-----------------NPIVFNPIEKQ------------------------------
MURG_TRIEI       ------------------KTVYLGTPVREEFLFPQS------------------------
MURG_SYNY3       ------------------ATVWISTPVREQFRQPQS------------------------
MURG_SYNE7       ------------------PLQVVGTPLRSQFYQPSQ------------------------
MURG_SYNJA       ------------------VTRVVGTPVRAEFYQPQPL-----------------------
MURG_GLOVI       ------------------TTRWVGTPVRPEFLISPNP-----------------------
MURG_THEEB       RL----------------NLRVTGTPVRPDILHPGN------------------------
MURG_PROMA       ------------------RTIVTGMPVRKSFSLKNPL-----------------------
MURG_PROMT       ------------------RTSFTGTPVRTEFLLEKSL-----------------------
MURG_SYNR3       ------------------RPEVTGTPVREDFLKPAAC-----------------------
MURG_PROMP       ------------------KTIFTGTPLRDQFYEINPL-----------------------
MURG_CHLPN       -------------------AEEVFLPKRSFSLGSPM------------------------
MURG_CHLAB       -------------------AQEIALPKRAFSSFNPI------------------------
MURG_CHLMU       -------------------AEEVFLPIREPSE----------------------------
MURG_CAMFF       ------------------GTDTYDYPIDIKFFNTARV-----------------------
MURG_CAMHC       ------------------FEPKFDYPIDEIFLKTARI-----------------------
MURG_CAMJR       ------------------EKEISPYPVADKFFDNARI-----------------------
MURG_NITSB       ------------------VPPYDPYPVQNIFYETRRI-----------------------
MURG_SULDN       -----------------EASPIKGYPVKDIFFKNARL-----------------------
MURG_WOLSU       -----------------SNSLIRDYPVRDAFFEVARV-----------------------
MURG_SULNB       -----------------EESPIKAYPIKEVFFDNVRV-----------------------
MURG_HELAH       -----------------GNHIVTSYPVQNVFFDHART-----------------------
MURG_HELHP       ------------------NFIHTSYPVRDEFFTHSRV-----------------------
MURG2_BACC1      K----------------EKVIYTGSPVREEVLKGNREKGLA-------------------
MURG_CLOTE       K----------------DKGVLTGTPIREELFLGNEEKGKK-------------------
MURG_GEOTN       T----------------DKAVYVGAVVREELKHGSAEQGRK-------------------
MURG_OCEIH       E----------------NKASYVGAVIRDELFTGKRDIGLK-------------------
MURG_STAS1       K----------------DKADFVGATVREDLKTGDKHRGYQ-------------------
MURG_BACSK       K----------------EATTTVGSPIRRELLEGSRIQGLT-------------------
MURG_LEGPC       RQ---------------DKIEVTGTQISSQLLTGNPMKGLE-------------------
MURG_STRP1       VK---------------HLGAVTKVFKDANQMPESTQLEAV-------------------
MURG_STRP3       VK---------------HLGAVTKVFKDANQMPESTQLEAV-------------------
MURG_STRP6       VK---------------HLGAVTKVFKDANQIPESTQLEAV-------------------
MURG_STRMU       TK---------------HVGAITKVNQTISSSDDNTEIKTI-------------------
MURG_STRS2       VK---------------HVGAVTKVGQTNDKVT-PIQLPEI-------------------
MURG_TREDE       LR---------------SKVICTGNPVRLSFYSGRPEKGRS-------------------
MURG_TREPA       RR---------------AAVHCTGNPVRQDFFSAQAERAYQ-------------------
MURG_BORBU       K-----------------NIIYTGSPIRREFLNPDP-KIIK-------------------
MURG_PARUW       -------------------TIEVGMPLREGYQLDQIDKIEA-------------------
MURG_RUBXD       V-----------------RAAHVGMPTRRQFFSASREE----------------------
MURG_ROSS1       PVDFERAVPQLETQNRTVRLIVTGYPVRQELFHADRRACRA-------------------
MURG_THEP1       QD----------------KIVVTGCPVRETEKEAPLK-----------------------
MURG_AQUAE       ------------------EGVRVGLPIRKELKKKLPKKE---------------------
MURG_FUSNN       SQ---------------SRFKVTGNPLRKEIDGLKYATERE-------------------
MURG_PELUB       N-----------------KIKVIPALLRKNFYNKRD------------------------
MURG_LEPIC       Y-------------------QVLGNPLRKKTIPKMSLKFFE-------------------
MURG_STRSV       H-----------------VGAVTKVGSQESVLPQELEEI---------------------
                                                                             

MURG_ACICJ       --ASPYEPPAE--TIRLLVLGGSLGARIFATLVPEALA-RLPEGLRR-------------
MURG_GRABC       --GTSYTPPGTEGVINLLILGGSLGARVLSDVVPAALA-LLPPALRQ-------------
MURG_GLUOX       --GHVYAPPED--RINLLVWGGSLGARVFSEIVPQALA-ALSEDFRK-------------
MURG_RHILO       --KTPYAASTGQEPFRLLVFGGSQGAQFFSDAMPGAIA-LLSDAQRK-------------
MURG_RHOPA       --TVAYDPPAAGGSLRVLVFGGSQGARVMADIVPPALE-KLDPALLR-------------
MURG_BARBK       --EIPYCASTSKQPFYFLVFGGSQGASAFSRIVPEAVK-LLDHDIRE-------------
MURG_ZYMMO       --DLPYPPLSDNSIFRILVVGGSQGASILSEVVPEGLG-LLPLHLRR-------------
MURG_SPHAL       --EEGFPPLLEDGIFRLLVVGGSLGATVLSEVVPAAIA-MLPRALLD-------------
MURG_MAGSA       --DASYAGITAEGPIELLVLGGSQGARILSEVIPAALA-RLPEALRT-------------
MURG_RHORT       --GEGYDAPRPGLDFRLLITGGSQGARVFATLVPQALA-LLSPAHRA-------------
MURG_HYPNA       --QVPFPP--TDGTLNIFITGGSQGSRIIGEIVPLAIANHVAPPLRV-------------
MURG_MARMM       --DAGYPAIDADGRLNILVLGGSLGARILSETVPQALA-MVPEKLRS-------------
MURG_CAUVC       --DVPYLA--PEVQLRVLVTGGSQGARLLSELIPEAVA-KLPEEMRG-------------
MURG_JANSC       --GAPYTP-PGDWPMSLLVFGGSQGARILSDVVPAAIA-LLPEAIRD-------------
MURG_PARDP       --GAPYVP-PGEGGLNLLVIGGSQGARVLSDMVPEAIA-GLPDEMRT-------------
MURG_WOLTR       ---------STKKILTVLIIAGSQGANFFDDVVSSVICNLP-IEIRK-------------
MURG_ANAMM       ---------LAGDSINLVILGGSQGLCTFGKTFALAIAELP-TNIRG-------------
MURG_RICTY       FVKARNNKFSNCNIFTLFIFGGSQGAKLFSELIPASIEILMKKQPNL-------------
MURG_ORITB       FTPKRN---FNSKNFQLLVIGGSQGTKIFSTLVPNAIKLLVNCDHDF-------------
MURG_KORVE       -------QRRADGRRNLLVFGGSQGARAINNAIVEALPQLYAA-----------------
MURG_SOLUE       -------PKARGDVLQILITGGSQGSRTLNHAARQSWPLFRNS-----------------
MURG_MYXXD       -----LRSHVAHERFSVLVFGGSLGARGINQRMTEALDSLGDL-----------------
MURG_SYNAS       -----PVLEKTGDQFSLLVFGGSQGAHAINSAFQDALPFLQLL-----------------
MURG_PELCD       ------CPPMDGDAPELLVFGGSRGARAINDAMLEALPRLEPW-----------------
MURG_PELPD       TDSTGPASRVPGPRFNLLVFGGSQGAHAINMAMVAALPLLKRA-----------------
MURG_MAGMM       -----PTLFTPQRPLRILVFGGSQGASIFTQRVPEALLPLAQH-----------------
MURG_BDEBA       --------SSENQKFHLLAFGGSQGSRIINNCLSDAVLGGGDW-----------------
MURG_DESPS       -------AREVKEGVTLLVLGGSQGARSLNRLIVEAFVGVGSES----------------
MURG1_BACC1      -KGKRSVGLSLPK-KSVLIFGGSRGARPINDAFVEAIEQFG-------------------
MURG1_BACAN      -KGKRSVGLSLPK-KSVLIFGGSRGARPINDAFVEAIEQFG-------------------
MURG_LISIN       -GALEAYGLVSGK-PTVLVFGGSRGARGINEAVEAILPEWN-------------------
MURG_ENTHR       -KILATYGLDPEK-KTVLIFGGSQGALKINQAVTEFLMSFDQ------------------
MURG_LACLA       ----AAQVEKFEE-PTVVIFGGSRGALKLNNAFIEALPELAQ------------------
MURG_LACSS       -ERLSEFGLKTDS-PTVMIFGGSRGAPSINKAFIDAVPLLN-------------------
MURG_LACP3       -DRLRDFGLDPHI-RTLLAFGGSRGAPRINDAVVAALPIWA-------------------
MURG_LEUMM       -FSWQQIGLSDEK-PSLLIFGGSQGAPPINLAVIDAMQEFN-------------------
MURG_OENOB       -FSLTEFDLDPKL-PTVLIFGGSGGALKLNSAVVNFANRFSE------------------
MURG_LACJO       -DIAKKWDLNPNM-PTVLIFGGSRGALAINQIVEKSLSELE-------------------
MURG_HUNT2       -TARKKLGIPKDM-PLVVIFGGSRGAENINSTVAELIKRHKS------------------
MURG_CALS4       -EGREKLGFSMSK-PLVVSVGGSRGAEKINSTMVELLKIK--------------------
MURG_CLOD6       -IARKNLSISDEK-RMVLCYGGSGGSRKINDAMRLVIKNM-V------------------
MURG_CALS8       -AAKSSLGL-EDK-IIVLAVGGSRGAENLNKAVIRLSKEFEG------------------
MURG_DESHY       -KGAEDLGLRSDC-LTLLVTGGSRGARSINQAMPTVLKHLAG------------------
MURG_MOOTA       -SCRQHFGLRPEQ-LFLVTVGGSQGARSINGAMLPILKELAG------------------
MURG_SYNWW       -ESIKKLGLEPNL-FTLVVFGGSRGAMTINQAMLEAVERWQD------------------
MURG_CARHZ       -ELRKKMGVGKDE-LLLVAFGGSQGALTINKVVGYLLPEIML------------------
MURG_SYMTH       -AGRQALGLSERD-RVLVIMGGSGGARDFNRVAAEAVLQLD-------------------
MURG_FLAPJ       -EAIDYFKLDANK-KTILILGGSLGARRINQLIAKEIDWLLS------------------
MURG_GRAFK       -EALEYFQLSKDK-KTVLVLGGSLGARRINRLIENDLKKFKD------------------
MURG_CYTH3       -GAHTFFGLKPGV-PTLFVMGGSLGARTINLSIERNLEQLKN------------------
MURG_PORGI       -ESLRFFGFEQSESPVVLVVGGSLGALTINKSIADKLGKWAE------------------
MURG_CHLCH       -QARARFGLQHNR-PTLLVFGGSRGARSLNNAIASQLDTLLA------------------
MURG_SALRD       -AARAAFNVPEDG-RVLLVMGGSLGSAAINGAIQRILDPLLA------------------
MURG_DESVV       -------DPRPDHVRRLLVMGGSLGARAINDAVVSSLPALAEA-----------------
MURG_DESAG       -------GHVP--ACRLLVMGGSQGAHALNLAVVNMLPQLRDA-----------------
MURG_LAWIP       -------DTKNSSTRHLLVLGGSLGAIAINSIVVDGLSRLFSN-----------------
MURG_ACIC1       AEARAYFGLDAEA-PTLAVAGGSQGARSINRAVVAALPMLAA------------------
MURG_THEFY       DKARSKFGLRPDL-PTLLIFGGSQGAQAINQAAFDSAEDFYQ------------------
MURG_FRACC       RAARARYGLDPHR-PTLLVFGGSQGARSLNQVMTAAAHPLAA------------------
MURG_SACEN       AQARAHFGLHPHA-PTILVFGGSQGARTLNTAFSGAADALGR------------------
MURG_CORJK       AEAREFFGVDPEA-PLLLVTGGSQGARSINNAVVDAAKTLQD------------------
MURG_NOCSJ       AEARAFFGLDPDR-PTLLVTGGSQGARRLNQAVSAAAGALAA------------------
MURG_ARTS2       HAARELLGLDQHK-PALIVTGGSSGAQSINRTIAASLDALAK------------------
MURG_LEIXX       PAALAEFGLAADR-PTLLVTGGSLGARRINQTIAARAVRLTE------------------
MURG_BIFLO       RESAAQLGVDPNR-PLVLVTGGSLGAQSLNRAIASSAADLL-------------------
MURG_CUTAK       ARARADLGLDINR-PTLLVSGGSQGAVAINEAVVAARTRLLA------------------
MURG_COREF       ERGRTQWGLEADR-PTVLVTGGSQGSVSINSAVAGALDDLLG------------------
MURG_CORDI       DRAQQLWGLDPEK-KTILITGGSQGARSINAAVAEGIDAVLAD-----------------
MURG_TROWT       VLAKEKLGLDPVR-KLLLVFGGSQGSAKINMHMRAALPRVLKLC----------------
MURG_DEIRA       AEALAALGLRDGP-ITIMVMGGSQGSLYLNQQVPGILWRLFGKVGKLRGKGDSVPPIDLD
MURG_THET2       DEAKRRLGFDPQR-PLLLVLGGSQGSLELNERLPPVL-----------------------
MURG_ACISJ       ------RLAGREGPLRLLVVGGSLGAKALNDIVPQALAWIHEQDR---------------
MURG_BORA1       ------RYADRQGPLRLLVVGGSLGAQALNTVVPQALGNIPPAQR---------------
MURG_DECAR       ------RFAERTGALRLLVIGGSLGAQVLNEMVPQAMALLGESDQ---------------
MURG_THIDA       ------ERAARSGPLRLLVVGGSLGASALNELVPRALALLPEAQR---------------
MURG_NITEC       ------RYAKRAGKLNILVVGGSLGAQALNTVLPQALSMIPGNQR---------------
MURG_NITMU       ------RYAGRSGSIKLLVVGGSLGAQALNTIVPRALKRIPEGMR---------------
MURG_METFK       ------RFADRQGPLRVLVVGGSLGAQVLNATLPKALALLPAEQR---------------
MURG_NEIG1       ------RFQGREGRLKILVVGGSLGADVLNKTVPQALALLPEEVR---------------
MURG_HAHCH       ------RGIG-ARKPTLLILGGSRGALALNEAAPKAIAALPETLR---------------
MURG_MARHV       ------RLAGRSGKLRVLVVGGSLGAQVFNQQLPQALALMPEADR---------------
MURG_CHRSD       ------SDALRQRPLRLLVLGGSLGAQALNTQVPQALARLPAAQR---------------
MURG_PSEU5       -------DSLAHRRPRLLVLGGSLGAEPLNKLLPAALAQVPAELR---------------
MURG_XYLFT       ------RFAGRSGPVRLLVLGGSQGARVMNNALPVVLRVLSDSDVA--------------
MURG_ALCBS       ------RYAQHQGGLRVLVLGGSQGALVLNQDLPELLLAVLGRD----------------
MURG_ALKEH       ------RGAGAHEPLRLLVVGGSLGALALNSTVPAALARLPEVQR---------------
MURG_NITOC       ------RLQARQGCFHLLVLGGSQGARILNETVPQALALLPTKVR---------------
MURG_HALHL       ------RYARREGAPRVLVLGGSQGARALNRYVPQALSAIGGGQ----------------
MURG_METCA       ------PRVGRH----VLVLGGSLGAQALNRIVPRALARLGGEP----------------
MURG_DICNV       ------RFHYRSGRIRLLVLGGSQGAKAINLLLPQALSLLPEEQR---------------
MURG_HYDCU       -----------HSPRHLLVLGGSRGALALNEMVPEALSLLPEEQR---------------
MURG_SACD2       ------RFAQKEGPIKVLVLGGSRGALAINEMVPAAFGKVNKALP---------------
MURG_ACIAD       ------SREQAGQPLNILIVGGSLGAQALNERLPDALKNLN---LP--------------
MURG_PSYCK       ------IND--CSALKLLVVGGSLGAQVLNETVPKALALIE---SP--------------
MURG_IDILO       ------NTD---GALNILVVGGSLGAQVLNEAVPEAVKALEG--VE--------------
MURG_HAES1       -------FNTTCETLKVLVVGGSQGAHILNTILPEVLAQLP---NR--------------
MURG_VIBCH       -------FATRNGAIRILVMGGSQGARILNQTLPAVMAALG---EG--------------
MURG_BLOPB       -------WKGRVGPIRVLVIGGSQGAHILNKTIPNMAEKLS---DK--------------
MURG_BAUCH       -------LCNRTGPIRILVIGGSQGSKIINQILPVVAAQLA---GK--------------
MURG_BUCAP       -------FKNRKGPLRILIIGGSQGASIFNKILPKISFFLQ---EK--------------
MURG_BUCBP       -------FENRSGPLRILVVGGSQGTQIFNFCFPKVALVLK---NK--------------
MURG_WIGBR       -------FLGRFGPLRILVIGGSQGASILNLVIPDVAKYLP---NK--------------
MURG_PSEA6       ---------GISRATNVLILGGSLGAKALNENVPLALAKQ---NE---------------
MURG_PSYIN       ---------SEDVALKVLVVGGSLGAKVLNDLLPAVFSSFD--NEN--------------
MURG_SHEFN       ---------PQADALRVLVVGGSLGAKVLNDVMPAVVAHLS-KYHS--------------
MURG_COLP3       -------DQSHEGSKNILVVGGSLGAQVLNKVMPDSFKDLSESDEK--------------
MURG_PSEHT       --------REVSSPINILVVGGSLGAQVLNTTLPAAFAELGNTNA---------------
MURG_COXBU       -------LAARRGPLRILVLGGSQGARSINQKMLAALSSYPRSEE---------------
MURG_FRATN       --------YTDSSTLKILVLGGSQGAKAINEIIPKLIRKSNEQGIN--------------
MURG_VESOH       ----------NNNKLNLLIIGGSLGSKPINEIVTQLN-------ID--------------
MURG_TRIEI       -----LDLPIPENVPVIVIVGGSQGAVAINQLVRKCIPAWVEN-----------------
MURG_SYNY3       -----LDLPIPPNRSLIVVAGGSQGAVTVNQQVRSCVPAWVNA-----------------
MURG_SYNE7       -----HGLPIPENVPVLLVMGGSQGAVAINRLVRAAAPAWLAA-----------------
MURG_SYNJA       ----PADLPIPEGDPLIVVMGGSQGARGLNRLVAACAPAWLEA-----------------
MURG_GLOVI       ----LLDVPVPPEAPLIVVMGGSQGARAINQMVGECAPGWLER-----------------
MURG_THEEB       -----LELPIPKAVPLIVVMGGSQGAVAINRLVRATVHRWLEA-----------------
MURG_PROMA       ----PIWVPKGLE-PLIVVMGGSQGAVGLNRMVRESLPWLLKQ-----------------
MURG_PROMT       ----PSWVPLGEG-VLIVVMGGSQGAIKMNEMVRKILPCLIEK-----------------
MURG_SYNR3       ----PDWVPAGDG-PLLLVIGGSQGAVGLNRMVRAAAPALLAM-----------------
MURG_PROMP       ----PKWVPRGKG-PLLIVMGGSQGAKMINEIFYESIDFLIKQ-----------------
MURG_CHLPN       ------MKRCTNHTPTICVVGGSQGAQILNTCVPQALVKLVNKYP---------------
MURG_CHLAB       ------VERLTSHSPTICVVGGSLGAKTLNDHVPPALVEVAKDYP---------------
MURG_CHLMU       ------QIVFPEASPVICVVGGSQGAKILNDCVPKALAYVREKHA---------------
MURG_CAMFF       ----------RNELKTILFLGGSQGASFINSLALNLALNLKNH-----------------
MURG_CAMHC       ----------RREVKTVMFLGGSQGANFINELAVKLAPHLAEF-----------------
MURG_CAMJR       ----------RKELKNIIFLGGSQGAQFINELALNLAPKLQEQ-----------------
MURG_NITSB       ----------RKELTTIIFLGGSQGAKQINDLAMSWAKELQKH-----------------
MURG_SULDN       ----------RDEIKCVIFLGGSQGAKAINDLALSVALELEAR-----------------
MURG_WOLSU       ----------RSRVKKILFLGGSQGAKAINDWALELAPLIHQR-----------------
MURG_SULNB       ----------RKNVETIIFLGGSQGAKAINKLALEIAPKLKER-----------------
MURG_HELAH       ----------RTEIKHILFIGGSQGAKAINEFALFNAPKLTKQ-----------------
MURG_HELHP       ----------REKLHHLLFLGGSQGAKGINDFALQIVPELLKR-----------------
MURG2_BACC1      ------FLGFSRKKPVITIMGGSLGAKKINETVREALPELLKKYQ---------------
MURG_CLOTE       ------ICGFKDNKPIVLLVGGSLGSKILNNLIRENIEELLKKFN---------------
MURG_GEOTN       ------LCQFDGQKPVLLAMGGSLGSKKINDALRASLPVLLSEFD---------------
MURG_OCEIH       ------ISGLKGNKPVLLVMGGSGGSEKINQTIRQSLTKLLDEFE---------------
MURG_STAS1       ------LTEFNNDKKVLLVMGGSLGSKKLNDIIRQNLETLQETYQ---------------
MURG_BACSK       ------ITDFSRERPTLLVMGGSLGAKRINEAIRESLDTLTNTYQ---------------
MURG_LEGPC       ------VCRFISSKTCLLVMGGSLGAGSINSCIRSALKQLTSEFQ---------------
MURG_STRP1       ------KEYFSRDLKTLLFIGGSAGAHVFNQFIS-DHPELKQRYN---------------
MURG_STRP3       ------KEYFSRDLKTLLFIGGSAGAHVFNQFIS-DHPELKQRYN---------------
MURG_STRP6       ------NEYFSRDLKTLLFIGGSAGAHVFNQFIS-DHPELKQRYN---------------
MURG_STRMU       ------KEYFDPRLKTLLFIGGSAGAKVFNQFIS-DTPELTKHYN---------------
MURG_STRS2       ------LSHFDKSLPTLLFVGGSGGAKVFNDLISQNSAALTERFN---------------
MURG_TREDE       ------FLNIKSNLPVLFVLGGSLGARQLNDLISDSIEYLVKHFV---------------
MURG_TREPA       ------FLRIDQKKPLLTVLGGSSGARDLNARVLSCSTFLTERFY---------------
MURG_BORBU       ------QLTQNTNKPIISILGGSLGANALNNLALCIKK--DAEIY---------------
MURG_PARUW       ----LSYFGLSKNNSTLLVFGGSQGALAINRLMRNLANTWKNT-----------------
MURG_RUBXD       -----ALRRLGLEPPVVLVFGGSGGALRINLAAAEAFRGQTP------------------
MURG_ROSS1       ------VFGLSDDLPTLLVAGGSRGARSINRAIAALLPSLLPLMEIIHVCGREGD-----
MURG_THEP1       --------------DFVLVLGGSLGSEAINELMEKVYPELQET-----------------
MURG_AQUAE       ---VKKRFGLEPDKITVLIFGGSQGALFLNELARDLKSVLPKE-----------------
MURG_FUSNN       ------KLGIKPSEKVLLITGGSLGAQEINNIVMKYWEKFCADKN---------------
MURG_PELUB       -------YNKSLDTINLLIIGGSQGAKIFDDLVKNAIIELAKNYK---------------
MURG_LEPIC       -----KYDTKKKKQFNVLVMGGSQGARQINNIVIALMSHEEINKQ---------------
MURG_STRSV       ------RQYFDKELPTLLFVGGSAGAKVFNDFVSQNQAALTE------------------
                                 .   .** *   .                               

MURG_ACICJ       -------------RIALTMQCPGEAIGAARGALDAAG---------------ITHELAPF
MURG_GRABC       -------------RMRVTQQCRAEDIDRVRMAYAACG---------------IEAILAPF
MURG_GLUOX       -------------RLKVTQQIKADDLERVRAIYENAG---------------IEVEAAPF
MURG_RHILO       -------------RLVITQQARADDVARVKTAYAALG---------------VAVEVSPF
MURG_RHOPA       -------------RLVLTQQVRDEDMGRVRAVYDRLQ---------------LNCELAPF
MURG_BARBK       -------------RLHIVQQVRGEEIDLAK-IYQDMG---------------VQAEVAPF
MURG_ZYMMO       -------------RLQVTQQCRPEDLEKTRAQYAKLG---------------IPADISTY
MURG_SPHAL       -------------RLQVVQQCREDDLEAVRARYAELG---------------VAAECAPY
MURG_MAGSA       -------------RIRIAQQCRPEDLEGVRRAYDGTG---------------IDATLDSF
MURG_RHORT       -------------RLRVTQQCRPEDIEAVRATYEAQG---------------IDALLSAF
MURG_HYPNA       -------------RLKVVQQVREEQFESVSNLYRSAG---------------IECELAAF
MURG_MARMM       -------------RLDVVQQTREESLPMARETYQAAG---------------IAAQCEPF
MURG_CAUVC       -------------RLKVFQQARAESMEQARKVYRNAM---------------VECEVAPF
MURG_JANSC       -------------LLRIAQQAREEDVDRVQAAYDDLS---------------MRVEVDTF
MURG_PARDP       -------------RLSVSHQARAEDAERVIAAYASAG---------------ISAVVRPF
MURG_WOLTR       -------------KIRVVQQCMKKNMNKVEGLYKGGQ---------------VICELSEF
MURG_ANAMM       -------------RVFVTQQCGKGQLEVITELYARHG---------------IKHKLSGF
MURG_RICTY       -------------ELKIIQQASLAHQVKIKDIYSKLN---------------ITYEFAEF
MURG_ORITB       -------------KITIVHQAVAKDINYVKAMYTELN---------------IEHEVSDF
MURG_KORVE       -----------IPGLHIVHQTGEKEYETVARAYLDPLV---------------AAEVSPF
MURG_SOLUE       -----------GYPVRITHQTGTGSFQEIRDAFAQSGL---------------EGEVVPF
MURG_MYXXD       -----------KDSLHFVHQTGKNDLESVRKGYADKGF---------------QAEVVEF
MURG_SYNAS       -----------KGCLRIVHQTGERDCESMAAAYSAQGF---------------SARVVPF
MURG_PELCD       -----------KDRLRIVHQTGGDDLQRIREGYARAGWP--------------QESVVPF
MURG_PELPD       -----------SVRLGITHQTGESDRERVAAAYRSAGV---------------EARVLPF
MURG_MAGMM       -----------GAPIQVTQQVQEADADALQRRYQEGGI---------------EAITTPF
MURG_BDEBA       -----------VKDLSVVHQLGSADFQAVSEKYKNAPC---------------EVQPFEF
MURG_DESPS       -----------LAGINLIHQTGTKDLAWVKQAYGDA---------------GRDVWVEPF
MURG1_BACC1      -----------NKSYEILYVTGEVHYDKVMDAVKQK------------GNPN-NVIIKPF
MURG1_BACAN      -----------NKSYEILYVTGEVHYDKVMEAVKQK------------GNPN-NVIIKPF
MURG_LISIN       -----------KRDFQLLYVTGDVHFEKIKDSLGEM------------NLGN-HISVQPF
MURG_ENTHR       -------------EYQVLYASGERYYKDIQTKVPAC----------------ANVSIQPY
MURG_LACLA       -----------R-SFKTVYASGEIYYDDYKETFNQY------------KEN-SNLDIRPY
MURG_LACSS       -----------ERDYQVLFVSGQVHYENVQAALANT------------TLNS-NLAFVPY
MURG_LACP3       -----------KADFQVLFATGRTHYDQIKAKLPD--------------LPA-TIKVVPY
MURG_LEUMM       -----------KRNYQVVIVTGPKRYENVLDRLTTQ------------PAD--NVRILPY
MURG_OENOB       -----------QKKFQAIFVTGRKYFDSVSNQLADL------------KINSSNFVVLPY
MURG_LACJO       -----------TKPYQVIWATGQLYYGDVKKKLAGK------------EVNS-NIKIVPY
MURG_HUNT2       -----------DLGFYLIYATGEAQYDGIMKKIGE--------------VKSPNINILPY
MURG_CALS4       -----------DRKFQVLIITGSSNYDKVLEKVKKEN-----------VVLDDSVKIVPY
MURG_CLOD6       -----------NEDIAFIFATGKSYYDEFMGSISD-------------INLKPYQKVVPY
MURG_CALS8       -----------CKDVYFILSSGDTKYLEAVNFANS-------------LGVKSNIKILPY
MURG_DESHY       -----------RKDIQVIWATGKATYQETLENLKAQGIQ---------WQR-ENWRVLEY
MURG_MOOTA       -----------CQDVSLLQVTGRRDYEAYLQQVRTQGID---------LAKYGNITIEPY
MURG_SYNWW       -----------SK-MQIIWITGESSYNEIKQQLEER-LS---------LSKRRFLQLYPY
MURG_CARHZ       -----------RPNLRLVWATGPRNYENLKQKYKNL---------------PERVQMVPY
MURG_SYMTH       -----------VPGLRVVHITGERYFGQVKAQYGDR---------------APHVTLLPY
MURG_FLAPJ       -----------Q-NVQIIWQCGKLYFEDYKPFSGK-----------------ENVQILSF
MURG_GRAFK       -----------E-GVQLVWQIGKLYFDEYRKYDS------------------ATVRAKEF
MURG_CYTH3       -----------A-GIQVLWQTGKFYYEGLKQYNS------------------ETIKVTDF
MURG_PORGI       -----------S-GVHLIWQTGKNYIETARKAVENHP--------------GLKCYVNDF
MURG_CHLCH       -------------SVNLIWQTGSLDGEKLKAEVKPS----------------PYLWMAPY
MURG_SALRD       -----------EGDVHVVWQTGTRYYDDLTEDLDEH----------------PRLRVVEY
MURG_DESVV       -------------GVEVWHQTGAADWERIRKAYAETGHG--------------EGRVEAF
MURG_DESAG       -------------GVEILHQTGAADLETVRSAYDKAGV---------------QATVVDF
MURG_LAWIP       -------------RIVIRHQTGVHDWERVKEGYALYGRT--------------NSQVTPF
MURG_ACIC1       ------------AGVQVLHIAGPQQIAEVESAQP------------KRAPDAPAYVLLPY
MURG_THEFY       ------------AGIQVLHVVGPK---NADGPE-------------DRTRGGVPYVVVPY
MURG_FRACC       ------------AGIQVLHATGPKNFDEVAAAL--------------PLDLPTPYELRPY
MURG_SACEN       ------------AGVGVLHAHGPKN--TLAVQQ---------------VPGAPVYNAVPY
MURG_CORJK       ------------AGIGVLHAYGKKNDIELPAEV---------------QEGKPRYVAVPY
MURG_NOCSJ       ------------TGVQVLHAQGKHGGADPQPGA---------------EETGVPYVVVEY
MURG_ARTS2       ------------AGIQTLHITGKGKSVLDGEGK---------------PLAADGYRQVEY
MURG_LEIXX       ------------AGWQVLHIQG-GRGELSDPG-------------------LPHYRLLGY
MURG_BIFLO       ------------AHAQIIHLTGRGKISEVRELVTASAGADVLTGIGPESAGQGDYHTAEY
MURG_CUTAK       ------------DGVQILHVLGPKNIRGATRITD--------------ELTGASWLPMGY
MURG_COREF       ------------AGIQVLHAVGKRNSLPTARPG---------------------YVPVPF
MURG_CORDI       ------------PDVQVLHAYGRKNSAPEAQER---------------------YVPVAY
MURG_TROWT       --------DEKNYLWQVLHITGYGDSIDVNMPH---------------------YSSVRY
MURG_DEIRA       LRGPHLIENARSREVQVLHATGPRWLAEVQPKVENL-----------------PWYHVTG
MURG_THET2       ----------KGLPVQVLHQVGERWVERFRPLEGE-------------------GYRVEG
MURG_ACISJ       --------------PIVTHQSGESQIEALRRSYAAAGVE---------------ATLTPF
MURG_BORA1       --------------PIVMHQAGAQHLQTLQADYAKAGVQ---------------AECVAF
MURG_DECAR       --------------PQIVHQAGEKHIEALKANYAAVGVQ---------------AHCVSF
MURG_THIDA       --------------PRVVHQSGRRHVDALRAGYAAAAVD---------------AEVRDY
MURG_NITEC       --------------PFVTHQSGKVHLAALQQAYAEHGVT---------------GNLVAF
MURG_NITMU       --------------PQVTHQAGARHLEALKQNYSEAGVE---------------GELVTF
MURG_METFK       --------------PIVTHQSGAQHIDALREAYAAVGVQ---------------AHVVPF
MURG_NEIG1       --------------PQMYHQSGRNKLGNLQADYDALGVK---------------AECVEF
MURG_HAHCH       --------------PRVVHQAGEGKDQTCRELYASLGVE---------------AEVYDF
MURG_MARHV       --------------PDVRHQCGEKNLEAAQAAYEEAGVN---------------ASVEPF
MURG_CHRSD       --------------PDVRHQAGRDKETATQSVYAEAGVE---------------AEVSAF
MURG_PSEU5       --------------PEVFHQAGKQHAEITEQRYAEAGVE---------------AEVAPF
MURG_XYLFT       --------------VEVRHQCGEALRAETEGAYAYAGVA---------------ARVEPF
MURG_ALCBS       --------------IQVRHQCGAGRTAEAAPIYQALGLQ---------------AQVSEF
MURG_ALKEH       --------------PVVRHQAGERTLQQAREAYDQAGIA---------------VDLQPF
MURG_NITOC       --------------PQVWHQCGSRQWEGAVVAYRAAGVE---------------ARLVPF
MURG_HALHL       --------------PQVLHQAGELTLEEARTEYGRAGLDG--------------AEVVPF
MURG_METCA       --------------VAIRHQTGQAMFQETQDLYQQLALT---------------AKVDPF
MURG_DICNV       --------------PQVLHQTGARWLEKTQTEYAALNVH---------------AEIVPF
MURG_HYDCU       --------------PQVIHQTGQKTLQQAMSSYEAANVA---------------ADVVPF
MURG_SACD2       --------------FQIVHQTGKDKLEATKESYALAGVK---------------ANVVPY
MURG_ACIAD       --------------LNVFHQCGQKQFEETRVRYTNAP-ANM-S-----------VQVMPF
MURG_PSYCK       --------------FEVRHQCGRNNEAATQAAYDEQD-LSMHK-----------FTVQPF
MURG_IDILO       --------------LNVLHQCGAEREATTEKAYLGAS-VLK-T-----------LKVTEF
MURG_HAES1       --------------LEIVHQVGSGSVENVTALYHDKVNLTQES-----------VQITEF
MURG_VIBCH       --------------YEIRHQAGKNSQQDVAEAY---AAAGVES-----------AQVTEF
MURG_BLOPB       --------------LIIWHQVGEQDFKKVIWAY-QKI--KQSY-----------HRIVKF
MURG_BAUCH       --------------YVFWHQVGKGALKEVQQVY-TSMLKNQLN-----------YKLVEF
MURG_BUCAP       --------------AIIWHQSGNNDLQKTRKKY-KKY-STYK------------HIVSSF
MURG_BUCBP       --------------IKLWHQIGKKNINIIHKLY-DIH-NNLAI-----------YKITPF
MURG_WIGBR       --------------FHIWHQSGYSEYELVKSKY-EKL-FHHTE-----------YKVFDF
MURG_PSEA6       --------------IKVRHQCGKGHLDSVTQLYQNQLGDSGD------------WQVDEF
MURG_PSYIN       --------------FNIMHQSGEGHYQAVQKGYEQRLVKA---------------NVQEF
MURG_SHEFN       --------------LTVWHQVGKNNQATVKASYQ-QLGQSDS------------VNVAEF
MURG_COLP3       --------------YCIWHQTGDNNQALVTASYKQEYIDTGK------------VRVTEF
MURG_PSEHT       --------------ISVWHQTGKGHLGSVEAAYKSHKFSTEN------------TKVAEF
MURG_COXBU       --------------IAVWHQTGQRDFEFIQKEYEKIKIE---------------AKVDNF
MURG_FRATN       --------------IKVWHQTGKLSLEETKDAYKDIS--QNHI-----------KDIAAF
MURG_VESOH       --------------INIWHQTGKLHADTVKSQYK------NSA-----------VKVTAF
MURG_TRIEI       -------------GAWIIHQTGENDPN----AFSLKHPQ---------------YFTLPF
MURG_SYNY3       -------------GAFIVHLTGKNDPE----AATFSHDH---------------YLSLEF
MURG_SYNE7       -------------GLWIVHLTGQQDPD----RGQLQHPQ---------------YIELSF
MURG_SYNJA       -------------GAWIVHLTGGSE------VGIPSHPR---------------YRAFPF
MURG_GLOVI       -------------GWWIVHLTGAGEYDA-VREGTPDHPA---------------YRIYAF
MURG_THEEB       -------------GAWVVHLTGNHDLD----APTIQHPH---------------YLVFPF
MURG_PROMA       -------------GYRVVHITGKYD-----KPSNINHKN---------------FVEKSF
MURG_PROMT       -------------GCRVVHLTGKNDCFYRNRDQEKNHPN---------------LVVRDF
MURG_SYNR3       -------------GCRIVHLSGHVD----PDQGQLEHPA---------------YSERPF
MURG_PROMP       -------------NFRIVHIIGENNS---NNLVKFKSNN---------------YVQKKF
MURG_CHLPN       -------------NMYVHHIVGPKSDVMKVQHVYNRGE--------------VLCCVKPF
MURG_CHLAB       -------------HMYVHHVAGPKGDVVSIQHVYSRGG--------------VSFCVKSF
MURG_CHLMU       -------------NLYVHHIVGPKGDLEGVSRVYQDAG--------------IQHKVTFF
MURG_CAMFF       -------------NINIIHQCGAKELETTRSKYNEMGV---------------EAVVFDF
MURG_CAMHC       -------------GYKIIHQCGEANEAKMREIYKKESI---------------NVELIGF
MURG_CAMJR       -------------NIKIIHQCGKNDFEKCKKHYQSLNI---------------QADIFDF
MURG_NITSB       -------------NIKIIHQTGTRDFERVRSFYAKERI---------------EADVFAF
MURG_SULDN       -------------GVKIIHQAGERDYERVKSAYEELGV---------------KAELCGF
MURG_WOLSU       -------------GIAIMHQCGEVDYERMKRGYEERSI---------------PVELFAF
MURG_SULNB       -------------GIRIIHQAGEKNIDEVRKDYEDIGI---------------EAEVFGF
MURG_HELAH       -------------GIEITHICGPNSYERVRFFYQELGLL-------------DKIVLFAF
MURG_HELHP       -------------GITIAHQCGERDFERIKKAYEHIGIL-------------DKVDVFAF
MURG2_BACC1      ----------------IVHLCGKGNLDESLQN------------------KEGYRQFEYV
MURG_CLOTE       ----------------IIHICGKGNIEKTLEN------------------KEGYAQFEYV
MURG_GEOTN       ----------------IVHICGKGNVDTSLVG------------------QKGYKQFEYV
MURG_OCEIH       ----------------IIHICGKGKVDDSIQ-------------------LDGYVQFEYI
MURG_STAS1       ----------------VIHLTGKGLLDNSYVG------------------TKDYIQFEFV
MURG_BACSK       ----------------IIHICGKGHLDPALEG------------------RRNYKQYEYV
MURG_LEGPC       ----------------VIHLCGKGKLDSSLVG------------------VEGYCQFEYA
MURG_STRP1       ----------------IINITGDPHLNELSS---------------------HLYRVDYV
MURG_STRP3       ----------------IINITGDPHLNELSS---------------------HLYRVDYV
MURG_STRP6       ----------------IINITGDPHLNELSS---------------------HLYRVDYV
MURG_STRMU       ----------------VINISGDKTLNNLSQ---------------------NLYRVDYV
MURG_STRS2       ----------------IINLTGDSSLNKLDK---------------------NLYRVDYV
MURG_TREDE       ----------------VVHQIGEANMDQGQKIKEGLLKSSPEF-------AENYKPYPFI
MURG_TREPA       ----------------LVHQFGAGNEDQMHTITNSLSVNA----------RHAYMSFPFI
MURG_BORBU       ----------------FIHQSGKNLNDLSE--------------------KNYLRRQFFN
MURG_PARUW       -------------PIQIIHITGSIQEADELKIFYANYQV--------------KASVKAF
MURG_RUBXD       --------------YSVVQISGRRDFPRLSSDNPR-------------------HRILEY
MURG_ROSS1       -------ATFLRAAIRVLPENLQKRYHLFEYLHSAPDIS--------------GQEGLPS
MURG_THEP1       ---------------QFVHSTGSDDWTERLSVFPN-------------------VTALTY
MURG_AQUAE       --------------FQVILLTGKIHYEKFKNLEGEK------------------FRVMPF
MURG_FUSNN       --------------LRIFWATGNNFEQLKKVRKTKKE----------------NDRIEPY
MURG_PELUB       --------------LKIYQQTNSINFESFKKIYEDKN---------------IQCELFNF
MURG_LEPIC       --------------FRFRVLTGSALYEEVSKKSKKD------------------AELISY
MURG_STRSV       -------------RYNVINLTGDASLDVLSERL---------------------FRRAYV
                                                                             

MURG_ACICJ       FSDVAPRMAAAHLLVARSGGSTVAEVATIGRPAIFIPL---AINTDQRHNADVLARRGGA
MURG_GRABC       FTDVATLIADAHLVIARAGASTVAELATIGRPAIMVPLP-GAIDDHQTANARILVDAQGG
MURG_GLUOX       FTNVPACLKNAHLVIGRAGGSSVAELAMAGLPSILVPLP-IAASDEQGANGQALVDAGAA
MURG_RHILO       FTDMAARMAAAHLVISRSGASTVSEIAVIGRPALLVPYP-FALDHDQAANAAALAAAGGG
MURG_RHOPA       FTDLPQRLASSQLVVSRSGAGTVAELAAIGRPGILVPLP-GALDQDQFANAGVLTAAGGA
MURG_BARBK       FDNMVEHIARSHFIMSRAGASTVCEIAIIGRPALLIPYP-HALDHDQAANAALLAARGGA
MURG_ZYMMO       MADLPQRLGWSHLVISRAGASTIAELGVAGRPAILIPYP-AAMDNHQYANARELVSAGGA
MURG_SPHAL       IKDFPERLRWAHMVIARAGASTVAELACAGRPAIFVPYP-HAMDDHQTYNVVDLVEAGGA
MURG_MAGSA       FADVPERLARAHLVIARAGASTVAELTTLGRPAILVPYP-FAVDDHQTANAHAAEDCGGA
MURG_RHORT       FSDLPERLRDAHLVICRSGASTVGELAALGRPAILVPFP-HAIDDHQTANARGLDEVGGG
MURG_HYPNA       FGDMPERLAAAHLVIARSGAGTVSELATVGRPSILIPLA-IAMDDHQAANAEALTAIGAA
MURG_MARMM       FEDVGSLYAASHLVIGRAGASTVSEVAGVGRPAIFCPLA-IAADDHQSANVDGLVQAVAC
MURG_CAUVC       FRDMAGYLRQSHLVIGRSGASTCTELAVAGRPSILIPLK-IAADDHQRFNARLLEEAGGA
MURG_JANSC       LHDMPRRLSEAQLVICRSGASSVADINVVGRPAIYVPLA-IAVRDEQTANARGPVDAGAA
MURG_PARDP       FDDVPQRLADCQLVISRAGASSIADITVIGRPAILIPYA-AATGDHQTANARALAESGAG
MURG_WOLTR       FDDMGSRLTDAHLVISRAGATSIAEITLARRPAIYIPYP-CSKDDHQFYNAEYIKDSGAA
MURG_ANAMM       FTDMQNIIGEADLIISRAGATTIAEVMAAGRPAIYVPYE-RSSCSHQLYNAQLIESLGAG
MURG_RICTY       FDNIALQYKVANLVISRAGASTIEELTYIGLPTIFIPLP-SAADNHQYYNAKLLADNKAG
MURG_ORITB       FYNIADKYKNSHLAICRAGASTISEIISLCQPAILVPYP-VSAQNHQLFNAKAIADNKAG
MURG_KORVE       IDDMPRAFAEADLVICRSGASTVAEITAAAKPAIFIPLP-TAADDHQRKNAEALVDAGAA
MURG_SOLUE       IADMPAAFAAADLIVCRSGAGTVSELAAAGKPSILVPFP-FAADDHQTRNAQSLERAGAA
MURG_MYXXD       IDDMSSAYARADLVVCRAGATTLAELTVCKKASILIPFP-HATDDHQAVNARALVDAGAA
MURG_SYNAS       IRDMAAAYEAADLLICRAGATSIAEITAIGKAAILIPFP-YAIGDHQTENAKVLLKAGAA
MURG_PELCD       IDDMAAAYARAHLVVCRAGATTLAELAACGRAAILIPYP-HAAADHQTVNARAMAKKGAG
MURG_PELPD       IADMASEYARADLVVCRAGATTIAEVTALAKACLFIPFP-YAVDDHQRRNAEALLRQSAC
MURG_MAGMM       IEDMATAYAQADLVICRSGATSVAELAATGRPSIMVPYP-YAADDHQAANAQALVSIQGG
MURG_BDEBA       IYDMAKYYQWADIIVCRGGASSIAEAAAFGIIPIIVPLP--AADNHQQKNAESLVEKNAG
MURG_DESPS       FKDMDAVYSQADILVSRAGATTLAELATLGKPVILVPYP-FAADNHQQKNAEYYVQGGGA
MURG1_BACC1      IHNMPEVLTGVDLVVSRAGATTLAELTALGKPSVLIPSP-YVTNNHQEKNARSVVDKGAA
MURG1_BACAN      IHNMPEVLTGVDLVVSRAGATTLAELTALGKPSVLIPSP-YVTNNHQEKNARSVVDKGAA
MURG_LISIN       IYDMPKILNAVTLVVSRAGATTLAELTALGVPSILIPSP-YVTANHQEYNARALEKNNAA
MURG_ENTHR       INKMAEVMASSDLLVGRAGATSIAELTALGLPAILIPSP-YVTNDHQTKNAMSLVKNNAA
MURG_LACLA       INNMTELLAKSQLFLGRSGSTTIAEVTALGLPAVYVPSP-NVTADQQTKNAQEYVDQGAA
MURG_LACSS       ISNMPEVLPDLKAIVGRAGATSLAEITALGIPSILIPSP-YVTNDHQTKNAQSLVKEDAA
MURG_LACP3       IDDMPSILPDIGLLISRAGATTLAEITALGIPAVLIPSP-NVTHHHQFLNAQSLTKQGAA
MURG_LEUMM       IENMPEVLAKTSAIVSRAGATSIAEITALGIPSILVPSP-YVTGDHQTKNAQSLVDAGAA
MURG_OENOB       LDNMDDVLPKIDLLISRSGATTLAEITALGIPSILIPSP-NVTANHQEKNARQLEERGAA
MURG_LACJO       IDNMPGLLPQMTCVVARSGATSLAEFTALGVPVILIPSP-NVTHNHQMKNALDMEKAGAA
MURG_HUNT2       IFDMANAMAAADLVVCRAGAITVSELTALGVPSILIPSP-YVTANHQEHNARALERQGAS
MURG_CALS4       SHEMQYVYAAADIMICRAGAITLSEITAVGVPSILIPSP-YVANNHQEYNARLLERQGAF
MURG_CLOD6       LEDMANALAASDLVIGSAGAISLAEITALGKPSIIIPKA-YTAENHQEYNAKSIEKQGAG
MURG_CALS8       ISDMPRYLAAADIVISRAGAIAISEITALGKPSIIVPSP-YVANNHQEYNAKALEKVGAC
MURG_DESHY       LKDMPEALACADLFVGRAGATTLAEIMVAGKPGILIPYP-LAAENHQEFNARALEKDGAA
MURG_MOOTA       VYNLEQALAAADLVIGRAGASFLAEVLARGLPSVLVPYP-HAAANHQEYNARAVARQGAA
MURG_SYNWW       MFNIEEALAAADLAVCRAGAGTLSELAILGLPAILVPYP-YAAENHQEKNARALLAKKAV
MURG_CARHZ       IDNMPEVLPAADLAITRAGAATLAEIAASKVPAVLIPYP-YAAENHQEHNARAFVSHGAA
MURG_SYMTH       AHNMPEVYAAADAGLFRAGALTLAEIQVRRLPSVLIPSP-NVTHNHQEWNARTLERRGAA
MURG_FLAPJ       IDRMDLVYAAADIVISRSGASSVSELAIVGKPVIFIPSP-NVAEDHQTKNAQAIVNKQGA
MURG_GRAFK       INRMDLAYAAADVIISRAGAGSVSELCVVGKPVLFIPSP-NVAENHQAKNAMAVTEHDAA
MURG_CYTH3       IADMNRAYAMADVIVSRAGALSISELSIVGKPCILVPSP-NVAEDHQTKNALALSEKQAA
MURG_PORGI       ITRMDYAYCAADLVVSRAGACSISELCLLGKPTILVPSP-NVAEDHQTKNALALSTRAAA
MURG_CHLCH       IEDMEAAYSAADVVVCRAGASSLAELTNLGKVALLVPYP-YATADHQRHNAQSLVEHGAA
MURG_SALRD       IDQMGHAYAAADLAVCRAGALTCSELTVTGTPAVLVPSP-NVTADHQTKNARSLERAGAA
MURG_DESVV       IDDVASAYAWADLVLCRAGATSVAELAVAGKPAVLVPYP-FATHDHQTHNARWLVSRGAA
MURG_DESAG       VEDMAAAYAWTDLALCRAGATTVFELAAAGVPAVFVPFP-FATHDHQTANAAFLADRGAA
MURG_LAWIP       IDDMAEAYQWSDLVLCRAGATTIAELAAVGKPSILIPFP-YATHDHQTYNAQFLVRVGAA
MURG_ACIC1       ADRMDLVYAAADLMLCRAGALTCAELAAVGLPAVYVPLP-HGNGEQR-LNAKPIVEAGGG
MURG_THEFY       VDEMELAYAAADIAMCRSGALTCAELTAVGLPAVFVPLA-IGNGEQR-LNAEPIVQAGGG
MURG_FRACC       LDHIPSAYAAADMTLCRSGAMTCAELAAAGLPAVYVPLP-HGNGEQR-RNALPTVEAGGG
MURG_SACEN       LERMDLAYAAADLVVCRSGAMTVAEVSAVGLPAVFVPLP-HGNGEQA-LNAQPVVSAGGA
MURG_CORJK       IERMDLALAAADAILCRSGAMTVAEVSAVGLPGIYVPLP-HGNGEQE-LNVRPITHAGGG
MURG_NOCSJ       IDRMDLAYAAADLVICRAGANSVTEAAAVGLPAVFVPLP-IGNGEQE-RNARPVIDAGGG
MURG_ARTS2       VDGMENVYAAADLLLGRAGAATVCETAAVGIPAVFVPLP-IGNGEQA-LNAAGPVQAGGA
MURG_LEIXX       CDRMDLALALADFAVARAGAATLCEFAALGVPAVYVPFP-IGNGEQR-HNAAGVVAAGGG
MURG_BIFLO       LERIDLAFACADLVICRAGAGSVSELAALGLPAIYVPLP-IGNGEQR-FNAEPVVNAGGG
MURG_CUTAK       VDDMASAYAAADLMVARSGAGTVVETATVGLPTIYVPLP-HGNGEQA-RNATSAVDAGAG
MURG_COREF       IEDMQAAYAVADLIVCRSGAMTVAEVTASGIPAIYVPLP-HGNGEQA-LNASAVIAAGAA
MURG_CORDI       IDDMAAAYAIADLVIGRSGAMTVAENTAAGIPAIYVPLP-HGNGEQG-LNAQPLVEEGAA
MURG_TROWT       MDSMGYALSAADLVVSRAGSSTVAELCTFGIPAIYIPYP-FGNGEQR-RNVSHMESAARI
MURG_DEIRA       YVDAVAAWSVADLGITRAGTGTLAEAAFHGVPLVMVPL--PESAENH-QYHNAVAVEQAG
MURG_THET2       FVDTPLAMSAADLLLSRAGAGTLAEAAFHGLPAILFPLS-PKLDGGA-QLANARAYAQAG
MURG_ACISJ       IEDTAAAFAEADLVLCRAGASTVTEIAAVGAAAVFVPFP-HAVDDHQTTNAQYLVKVGGG
MURG_BORA1       IEDMASALANADVLICRAGAMTVAEVAAAGVAALFVPLP-HAIDDHQTANARYLSDAQAA
MURG_DECAR       VEDMAGAYEWADLVICRAGALTIAELAAAGVASILVPFP-HAVDDHQTGNAKFLVHAGGA
MURG_THIDA       IDDMAAAYRDCDFAICRAGAMTVAELACAGVPALLVPFP-FAVDDHQTGNAAFLAEAGAA
MURG_NITEC       IEDMAVYYQNCDLVVCRAGALTIAELAAAGVASILVPYP-YAVDDHQTANARFLSEHHAA
MURG_NITMU       IDNMASRYGESDLVICRAGALTVSELAAAGVASILVPFP-YAVDDHQSTNAKFLSGKGAA
MURG_METFK       IDDMASAYADADVLVCRAGAITVSELAVAGVASILVPLV-VSTTSHQRDNARWMAEHGAA
MURG_NEIG1       ITDMVSAYRDADLVICRAGALTIAELTAAGLGALLVPYP-HAVDDHQTANARFMVQAEAG
MURG_HAHCH       LQDMASVYANADLALCRAGALTLAELCTVGLGALLAPYP-HAVDDHQTANARHLEQAGAA
MURG_MARHV       IRDMAEAYGWADLVICRAGALTVSELCAAGIGAILVPFP-HAVDDHQTRNGQHMVKAGAA
MURG_CHRSD       IDDMAAAYDWADLIVCRAGALTIAELAAAAKPSILVPFP-HAVDDHQTLNARQLVDAGAA
MURG_PSEU5       IKDMARAYAWADLVICRAGALTVCELAAAGLPSFLVPLP-HAIDDHQTRNAEYLANEGAA
MURG_XYLFT       ISDMAAAYSWADLVVCRAGASTLAELCAAGVGSVLIPFP-AAVDDHQRRNAEYLVAAGAA
MURG_ALCBS       IDDMAEAYGWADLVICRAGALTVAEVAAAGVAALFVPLP-SAVDDHQTLNARWLSERGAA
MURG_ALKEH       IEDMAAAWTWADLAICRAGALTVAELEAVGVPAILVPLP-GAVDDHQTANARQFVAAGAG
MURG_NITOC       IDDMAAAYAWADLVVCRAGALTVAELMAAGIGALLVPFP-LAIDDHQRANADYLVVAGAA
MURG_HALHL       IEDMAGAYAWADLVVARSGALTVAELAAAGVPAVLVPLP-WAVDDHQTANAEWLCAAGAA
MURG_METCA       IEDMEEAYGWADLAICRAGAMTVSELAAAGLPAILVPFP-YAIDDHQTANADYLAEAGAA
MURG_DICNV       IDDMAKAYANADWVIARSGALTVSEIATAGLAALFIPFP-YAVDDHQTMNAQCLAEVGAA
MURG_HYDCU       IDDMVSAYQQADLVVCRSGALTVSELMAAARPAILVPFP-YAVDDHQTANAQALVDLNGG
MURG_SACD2       IELMSEALEWADFAICRSGALTVSELAAVGLGAVFIPFP-YAIDDHQTKNADFLVQCGAA
MURG_ACIAD       IEDMAQAYRDADLIICRAGALTVTEVATAGVAAVFVPLP-IAVDDHQTANARFLADVGAA
MURG_PSYCK       IDDMAAAYNWADIIVCRAGALTVTEIQNVGIAAIFVPLP-SAVDDHQTANARTLTLHKAA
MURG_IDILO       IEDMGDAFKNADLVICRAGALTISELAVMGVASILVPLP-HAVDDHQSANAKVLESRGAA
MURG_HAES1       IDDIAQAYAWADIVICRSGALTVCELAAVGTPAIFVPFQ-H-KDKQQYLNAKYLADVGAA
MURG_VIBCH       IDDVADAYAWADLLICRSGALTVSEVSAAGVGAIFIPFM-H-KDRQQALNADHLVACGAA
MURG_BLOPB       IDDIAQAYAWADILISRAGALTVSEVSIVGLPAIFVPFI-HHKDRQQYWNAVPLVQAGAA
MURG_BAUCH       IDDIAIAYAWADVVICRSGALTISEIAAVGLPAIFVPFM-H-KDRHQYWNALPLEQLGAA
MURG_BUCAP       IKNIAEAYEWADIIISRSGALTVSEITVVGLGAIFIPYP-H-KDKQQYLNAEDLENNGAA
MURG_BUCBP       IKNISKAYFWADLIICRAGALTVSEIQYIGLPAIFVPFP-H-KDQHQYWNAYPLKMIGGA
MURG_WIGBR       IKDISIAYEWADLIICRSGALTVSEISSIGIAALFVPYN-H-KDNHQYWNAKILEKIGAA
MURG_PSEA6       VEDMPQAYQWADLVICRAGALTVAEVAASGVAAIFVPLP-HAVDDHQTKNAQTLVEHEAG
MURG_PSYIN       ITDMASAYDWADLVICRAGALTVAELAVVGLPAIFVPLP-HAVDDHQTKNAQYLVSQEAA
MURG_SHEFN       IDDMEAAYRWADVVVCRSGALTVSELAAVGLPSILVPYP-HAVDDHQTVNASVLVDAGAG
MURG_COLP3       ITDIAAAYQWADIVICRAGALTVSELAMAATPAIFVPLP-HAVDDHQTKNALYLVKRDAA
MURG_PSEHT       IDDIDTAYGWADIVICRSGALTVSEIATAGKMAVFVPFP-HAVDDHQTANAQYLVVANGA
MURG_COXBU       ISDMAGAYGWADLVVCRAGALTVCEIASVGVASIFIPYP-HAVDNHQFHNARFLEQAGAA
MURG_FRATN       IDDMATAYNWADLVICRAGALTVSECAIAGLPAIFIPLP-SAVDDHQFFNAQNIVNNNAG
MURG_VESOH       ITEMASAYAWADIVLCRAGAMTVSELMLSATSSILIPLP-NSIDNHQFHNAKILSDNNAG
MURG_TRIEI       YHNMASLFQRANLVISRAGAGSLTELAVTHTPSILIPYP-YAADNHQAYNAKIFSNQNAA
MURG_SYNY3       FDNMAALLQKADLAISRAGAGTLTELAVTQTPSILIPYP-FAAENHQMYNAQVFVDAGAA
MURG_SYNE7       VDNVAPLLNRADFSISRAGAGSLAELAAAGLPSLLIPYP-FAAEDHQTFNARIFAKAGAA
MURG_SYNJA       RADVAALLQRATFAISRAGALSLAELWATATPAILIPYP-FAAEDHQYHNALAFVGRGGG
MURG_GLOVI       WEKMAPLLSRADLAISRAGAATLSELLVTGTPSLLIPYP-FAAEDHQSVNAAALVRAGAA
MURG_THEEB       FEPMGPLLHRADIAISRAGASTLAELTLTATPALLIPYP-YAAEDHQTVNAEVLVRAGAA
MURG_PROMA       TEEIPGLLQHADLAISRAGAGALSEFAICSLPVILVPYP-YSSDHHQDANAAYAAQFGAA
MURG_PROMT       SDEIPALLRNADLAISRSGAGAICELMVTKTPSILIPFP-SSTDQHQELNAAYMARFGGA
MURG_SYNR3       SEEIPALLQHADLAISRAGAGSLSELAVCGTPAVLVPFP-QAADDHQSANAAAAAAVGAA
MURG_PROMP       TNQIASLMQNCELVISRSGAGTINELIQTGKPSILIPYP-NSKNNHQEKNAMILSSIGGA
MURG_CHLPN       EEQLLDVLLAADLVISRAGATILEEILWAKVPGILIPYP-GAYGHQEVNAKFFVDVLEGG
MURG_CHLAB       EQDMLSVLLSSDLVISRAGATIMDELLWAQSPSILIPYP-GAYRHQEENAKFFVYTIGGG
MURG_CHLMU       EKNILGVLQASDLVIGRAGATILNELLWVQVPAILIPYP-GAHGHQEANAKFFTQTLGGG
MURG_CAMFF       SNEIEVYMQKSDLCISRAGASTLWELCANALPTIFIPYP-YAASNHQFYNAKFLLDSNLA
MURG_CAMHC       SKMLHKFVESADLCISRSGASTLWELAANAVPAVFIPFP-YAAGDHQYYNAKFL--EQFC
MURG_CAMJR       SLNLEEKMKNADLAISRAGASTLFELCANTLPAIFIPYP-YAAKNHQYFNAKFLQDQALC
MURG_NITSB       DQNLAQKIVQADFAVSRSGASTLWELATNLLPALYIPYP-YAAGDHQKHNALFLYRHDAS
MURG_SULDN       TKEMPSLMARADLAVSRSGASTLWELCANALPSFFIPFP-HAASDHQYHNAKFIVDNELG
MURG_WOLSU       DRAIHQKMQQADLAISRAGASSLWELGANGLPALFIPYP-FAAGDHQYYNAKFILDQGLG
MURG_SULNB       TTKLADYMKEADLAIARAGASTLWELSATALPTLFIPYP-YAVSDHQYYNAQFLVEKDLA
MURG_HELAH       HNNIIEVMQKADLCVSRAGASSVWELCANGLPTIFIPYP-FASNNHQYHNVLEFEKENLC
MURG_HELHP       DKEIVLRLQKADLCIARSGASSLWEMSANGLIGIFVPYP-YAAKDHQYYNALHFTKQGLG
MURG2_BACC1      HGELPDILAITDFVISRAGSNAIFEFLTLQKPMVLIPLSKFASRGDQILNAESFERQGYA
MURG_CLOTE       KEELPHFMKASNIVISRAGANSIFELLALAKPNLLVPLSKKASRGDQILNAKSFEKNGYS
MURG_GEOTN       NEELPDLLALSDIVVSRAGANAIFELLALRKPMLLIPLSKAASRGDQILNARSFEKAGYA
MURG_OCEIH       NHELKDIFAATDLVISRAGSNAIFEFLALRLPMLLIPLSKEASRGDQIINANSFKKKNYA
MURG_STAS1       KDDLTDLLAITDTVISRAGSNAIYEFLALRIPMLLIPLGLDQSRGDQIDNAKHFESKGFG
MURG_BACSK       HDELPHFLQAADLVVTRGGSNAIFEFLALHIPMLIIPLSRAQSRGDQILNAQTFVKNGYA
MURG_LEGPC       NEELADLFAASSVVISRAGANSLYEILALGKPHILIPISSQVSRGDQIQNARYFQGLGIS
MURG_STRP1       TDLYQPLMAMADLVVTRGGSNTLFELLAMAKLHLIVPLGKEASRGDQLENATYFEKRGYA
MURG_STRP3       TDLYQPLIAMADLVVTRGGSNTLFELLAMAKLHLIVPLGKEASRGDQLENATYFEKRGYA
MURG_STRP6       TDLYQPLMAMADLVVTRGGSNTLFELLAMAKLHLIVPLGKEASRGDQLENATYFEKRGYA
MURG_STRMU       TEMYQPLMDLADVVITRGGSNTIFELLAMAKLHIIVPLGKEASRGDQLENAAYFEEKGYA
MURG_STRS2       TELYQPLMDLADVVITRGGSNTLFELIAMQQLHLIVPLGRQASRGDQIENALYAEKKGYS
MURG_TREDE       KKEMADVLSLSSIVVSRAGANTVWESAAAGKPMILVPLEKGSSRGDQIENAEFFKKKGSA
MURG_TREPA       QAHLPDILAASALVLSRAGANAVWECAVLGKPMILFPLERGSSRGDQIENAEYFSAHGAA
MURG_BORBU       AEEMASIVKFSNLIISRAGAGAIKEFANAGACAILIPFKKGS-RGDQIKNAKLLTNQNAC
MURG_PARUW       EKNMHLAWRAAEVFISRSGASTIAEAMEFEVPGILIPYP-HATDHHQDKNADFFVDIVKG
MURG_RUBXD       AEDIWHHVTAADVVVIRGGAGSLFDVAAVGRAAIVVPYP-HHRDNQQLLNARYFTERGAA
MURG_ROSS1       TPTMIAALVAADLAVCRSGASILGELPAVGLPAVLAPYP----YVHQDENADYLVQRGAA
MURG_THEP1       IDPMGAYWKKAIASISRAGASTIAEMMYYGVPGILIPWE-SSAESHQLENALEAERLGYG
MURG_AQUAE       SLDMGLIYSASDVAISRAGAGTINELSHFGVPSVFVPYP-YAVDDHQFYNAKEIEKLGGG
MURG_FUSNN       FNDMLNVMAAADLVVCRAGALTISEIIELEKPAIIIPYG--SIKVGQYENAKVLTNYDAA
MURG_PELUB       NDDVVNFMQKTDLCITRAGASTLAELNFTETPYLAIPLP-TAKDNHQFENAHFYNKLGFN
MURG_LEPIC       SDNMKEHYEWANFVIARSGSGVLSECAAFALPMILIPYP-YAKDDHQMANAKYFELNGAA
MURG_STRSV       TDLYQPLMDLADVVVTRGGSNTIFELLAMAKLHIIVPLGREASRGDQIENADYFVKKGYA
                               :  .*     :        .  *                       

MURG_ACICJ       FRLDQATTTPDRLAGV---LESLLDDPLR------LAAMAEAAASARIEEAAARLADLVL
MURG_GRABC       WMIRQPDFTPDTLAAR---IAGLLAEPGT------LADAARNAARLGMQDAVARLADTVE
MURG_GLUOX       WMIRQPDFTAAALTAL---LTDLFSHPEK------LENAAKAAHLCARPHAAAKVADLIE
MURG_RHILO       EVHPQSTLSPERIAAL---IGGLMDNPER------LAAMAAGAKSVGRPDAARLLADLTE
MURG_RHOPA       LRIVQPDFTPDRLAAE---ITALAADPAK------LTQMAAAARQIGRLDAAERLADVVG
MURG_BARBK       QIMLEKDLNAQILSSL---LTKFCCEPHS------LEQRALAAKKVGKPQATRVLADMAE
MURG_ZYMMO       RLIDQRRFNPFELAKQ---IQKMALEPSA------LKNAAARARQVGYPDAVEKLADLVE
MURG_SPHAL       ISFRQSDFIPAEVAKH---IQRMAVEPGV------LEEAAERAASCGLPDATRDLADLVE
MURG_MAGSA       WLMQQDSFTADSLAAR---LDSLFTHPEA------LVRTAVCARNVGRPDAAEALADLVV
MURG_RHORT       WLMPQAALTPQALAER---LGELMDDPDV------LVRAAQCARGAGVPDAAVRLADLVS
MURG_HYPNA       DMILETNATPKLLGEL---ISARLSDGAD------LTARAAAAKSAARPDAAQKLAEMAE
MURG_MARMM       DVVHEGEFTAQKIAAL---IETRLSNPDD------LASRAQSARALGRPDAADALARAVD
MURG_CAUVC       AVCLEDELTVDVMAAA---LKALLSKPER------LEKMAAGARSAAKPNAAEELADLVE
MURG_JANSC       VLMPESQLTPETLAQT---IEQILTQPDA------ATQMSIAALSVAVPDATERLVALVE
MURG_PARDP       VVLPESVLDAESLRRD---MRDILSDSAR------ATAMAAAALTLARPDAAQRLADLVT
MURG_WOLTR       VVVEQNSEVKKNLTKL---LVNLLGDSQK------LRDMANNTKKIRIKNGVTEFIRIVI
MURG_ANAMM       LCIEERTLDVSSARDA---LTNLLGDRNK------LQEMSCNAAKHAMPDADAQFCAIVD
MURG_RICTY       WCLEQNNISAEKLADQ---ILDLISNRQL------LEDAAQNLLNRKQEGHLLLSNLIED
MURG_ORITB       WCIEQSTITPHILFEK---IFTLMQSPTL------LASTELKLREMKINAENLLANVVDK
MURG_KORVE       KLIPQSELNAERLVSE---VCELLGNSTS------LEGMSAAARKLSHPNAAAEIATMAV
MURG_SOLUE       RLVRDAEMTGEKFFEV---VTSVTGE---------LSRMGTAARQFAKPGAAKRAADILE
MURG_MYXXD       LMFRESELTGEKLAQT---VRELKSHPER------LKSMEKKAGLLGRPEAAKELADVCV
MURG_SYNAS       VMIPEKDLTGKKLADE---IQNFYSHPSL------LKDMEAKAASLGNIYAASDIVDSCM
MURG_PELCD       LVLAQQNLTPETLASL---ITDLLENRPR------LISMSAAAKSLGITGAADRILRVCR
MURG_PELPD       FMLLERELSAERLAAL---ILQLAGDPRL------VRRTGELAFSMARLDAARIIVDEIL
MURG_MAGMM       WMRRQEQFHSAWLEAF---ITSLCMQPAQ------LQRAGEIARSYARPNADMQIVTLLA
MURG_BDEBA       RMILQKDLTPERLISE---VQSLRADKAL------REQMVRNIKNFYIPQSATVIAKEIL
MURG_DESPS       LLFKESELTAPQLVEA---VISIATNREQ------RERMEFNQRRLAPTDAAGKIVAVCR
MURG1_BACC1      KMLLEKDLTAETLIRD---IDEILLDAQT------LQNMKLAAGQLGIPDAANKLYEVMN
MURG1_BACAN      KMLLEKDLTAETLIRD---IDEILLDAQT------LQNMKLAAGQLGIPDAANKLYEVMN
MURG_LISIN       VVITESELKETDLMAT---VDAILTDEAK------LNSMKLSAKQMGRPDAALKLVETVL
MURG_ENTHR       KMIKDDELDGRSLKQA---IEEIMTNDQL------QKQMSLASKQQGIPDASERMYELVK
MURG_LACLA       IIIKDEDLTGQTLVEA---ISNILENNEK------YQEMQAASLKAGVPDASQRLYNLVK
MURG_LACSS       MLIPEPELTGASLVKA---LDTLFETPEK------QHAMAKAAKKSGIRDASDRIIEVIE
MURG_LACP3       ITITEDELDN-HFPRR---VVTLMEDDEK------RAAMAKASKKLGVPDASDQLIAVMT
MURG_LEUMM       LMITEPALSGKALLLA---ADSLLLNESV------SKTMTEQAKNVGIRDAGDRLYALIL
MURG_OENOB       EVILESDLSSAMLYHD---LSELLSHKSK------LESMAQAAKKLGHPDAADKLYKLLV
MURG_LACJO       LVIAENDLNPNNFVSS---IDHILLDTNY------AKKMSEASKKLGVPDASDQVISVME
MURG_HUNT2       VVILEKNLRPDILYEE---ITTLLKDRNK------LSQMAKNAKSIGITNATERIYEIIK
MURG_CALS4       HVILEKDLDAKKLYEK---IEYLLSEPSL------LNEMREKAKSMSRTDASYKIYQLVK
MURG_CLOD6       IAILEKNLTPESLNTA---VFKLLGDREL------LVDMANASKTIGKPEAIDLIYDEIM
MURG_CALS8       FVVLESELESDKLKSF---LEKLIYDKAL------YERMSESSKKMGKPEATQNIGKIFE
MURG_DESHY       CVILDQDLTGENLWAL---VQGLLEKPEK------LRKMAQAARGLGQPDALNKIVNVCL
MURG_MOOTA       VVVLDRELKGGRLYQV---VFELLRSREK------LKAMAAAAASLGRPGALEAIIQVIL
MURG_SYNWW       EMVIDEFLDGDTLYKK---VNELRENPVY------LKEMARNMAKEGRPNALNEILDVIL
MURG_CARHZ       VLLRDAECSEDRVKAT---ILPLLDSPEK------LVKMAENAGKVLRRDSLKEITGIME
MURG_SYMTH       IVLREGGLTPADLAAA---LTRLLTDEAL------ADRMRAALGEVADPDAARTIARRIV
MURG_FLAPJ       ILLKES-QLDSEFKFV---FESLLNDKAK------QEDLSKNIKQLALPNATKDIVDEII
MURG_GRAFK       LMITED-ELTERFEPC---FFSLLQDERR------MNRFAANIKKLALPNATSDIVDEVE
MURG_CYTH3       WMVKDM-NAPEELVQK---ALELMKNQDA------QHTLSKNILTFARPDATERIVNKVF
MURG_PORGI       VLIPDT-EAIELLTDT---ALSLVRDPAE------LSSLSEQIRTLAKPQAADRIVDEIA
MURG_CHLCH       LMVADS-EAFTKLVPT---ALELLQNSGK------RAAMSVAAAKQAHPDAAGVLAKRVL
MURG_SALRD       VWLDEA-DLDAHLETV---LLDLLGNSDR------RARMAEAARDRARPDAAETIARDVL
MURG_DESVV       VLLEQKDISMTDVPAL---LVGLLSDRAR------LNRMAVSARAQGRPDAAAAVVDGLV
MURG_DESAG       QSIAQRDLESMPPAVLAGQIIDLLKDHGR------LQGMSAAMRRMARPEAAAAIVSGAK
MURG_LAWIP       VLIPEKNVVEVDVIEK---IIALFNDRVT------LVNMALAAHKHGRIDAATCVANEII
MURG_ACIC1       VLLRDAELRGDAIRRIVL---PLVTDRAR------LAEMAGRAAALGRRDADERLADLVE
MURG_THEFY       LMVANSELSRDWIREHLI---PLLTDTDR------IVAMSEAAARLGRRDADMALAREVI
MURG_FRACC       LLVDDAELSASWLLENAL---PVLISAER------LAKMSAACAGSGHPQAAAAIVAMIR
MURG_SACEN       RLVPDEQMTPQRVVEELL---PLALDAQR------LQEMSRATLSTGHREADRVLAQIVL
MURG_CORJK       VIIKDAELTGHRVSQEVI---PLLRDETR------WQAASLATLAAGHRDAAEKIAEKII
MURG_NOCSJ       ILVKDADLTTDWVVGTVP---PLVADAER------LAAMGAAAAALIPRDADERLARIVL
MURG_ARTS2       LVVDDESFTPEWVSREII---PLLSDPAR------LAKMAASSEALGIRNADRRMADLVL
MURG_LEIXX       VLVDDAGFLPAWVDAQLL---PLLADRAR------VAEMAERAASVGVRDGSDRVVALIR
MURG_BIFLO       LLVADKDLTPQWVHEHVP---DLLADHER------LAEFGRKAWEYGIRNAAEIMARHVL
MURG_CUTAK       VVVANADLDVERLLAET----ARIHDADV------LAQMSAAGRGLMPAHAAEEMAVRVI
MURG_COREF       KLVDDADLTPQRLVSEVR---DIVGNPAT------LHRMSAAARTSTVGDAAGVIAGLVA
MURG_CORDI       VLVADSEFNGEAFSSLAA---KILGDQET------YNTMVIAAKESGTANAAETIADIIY
MURG_TROWT       IQEND--LSQIRLEDELL---ELMTDDER------REAMSIAAKRFAICNAAQNTASLIE
MURG_DEIRA       AGRVVEQKVLPETLEKVV---LECAAPGK------RAAMRDAAQKRARPGAAARFADLIE
MURG_THET2       GAVLGAWDRLSSQILEAL---EDLEAR------------RRAMARLSPEGAAARLADLLE
MURG_ACISJ       WLVQQAD-LTAHGLAE--MLQNMKRQ--D------LLAKAQKARTMRKINATRDIVAACE
MURG_BORA1       WLQPQHV-LTAQWLAD--WLTQRDRT--E------LQAVAARARAHARPDAAAHIADVCV
MURG_DECAR       FLLPQTE-LTPDAIA---LIRNYSRS--Q------LLEMAEKARSLAKPDATEAVAQICS
MURG_THIDA       WLVQQKD-LSAEALAE--LIAGIDRN--R------LAAMSEQAVRLAKPDATGRVADICE
MURG_NITEC       VLWPQSE-LTANSLAQ--WLMTCTRT--Q------LQTMAINARMLAMPEAAQSVVTVCQ
MURG_NITMU       ILLPQSQ-LTPEGLAE--LLVGMSRG--Q------LMEMACRARELAQPDATRCVAETCM
MURG_METFK       IHLPQQE-MTPQRLAL--LLQELTRT--R------LLAMAHAARELGRPMAAETIANELE
MURG_NEIG1       LLLPQTQ-LTAEKLAE--ILGSLNRE--K------CLKWAENARTLALPHSADDVAEAAI
MURG_HAHCH       KIFQQDN-LTVERLAE--TLTSLLGQPQK------LLDMANAARTLAKPEATREVVKYCW
MURG_MARHV       ILVPQPR-LTPEVLAE--TLKDLATDRKR------ILTMAKAARSLARPDATERVVNYCL
MURG_CHRSD       RLMPQTQ-LTAESLAE--TLA-TLLEPET------LATMATSARAQARLDAVERLVAGCM
MURG_PSEU5       VLLPQAK-TDAAALAA--QLTEVMMQPEK------LKAMGTTARRLARPDATRSVVDICL
MURG_XYLFT       LLLQQQDRAFYVYLES--VLRDLLSNPMR------RLAMAEAARGLAKSDAAECIAEIIL
MURG_ALCBS       LLLPQRD-LGAVSLAG--TLKPVAERGLL------A-QIAERAREQAMADSAERAATLCE
MURG_ALKEH       VLLPQSE-LSAQRLAL--ELKTLLADPPR------LQRMAQCARGLGRPDAAATVARICL
MURG_NITOC       LLLPEKE-LSPSRLAQ--EIERLGADYST------FISMAQAARQLHRVGAAQRVAERCL
MURG_HALHL       RRLLQPD-LEQGALGP--VLAELLGDRRR------LAEMGEAARGVARPDATDRVATICE
MURG_METCA       VLMPQSS-LDEVSLAV--EIRALLDQRDR------LEAMSAAARNLARYDAAESVAKVCL
MURG_DICNV       AILEEKT-LTADILAT--AIQSRQD-RSA------LLTQAERARLCSDEKALGEILRAIK
MURG_HYDCU       EVLQQAD-MTSELLAE--RLQFWMA-DKR------CETASRSIRESAPHSAKEKIVDELL
MURG_SACD2       VVKQQKE-LSPEILAV--LLNELLAGRER------LQQMAVKAKQQSKPHAAEKFADFCE
MURG_ACIAD       KICQQST-MTPENLDA--LLKPLM-NRQL------LSEMAVKARQHAQPNATQHVVDLIQ
MURG_PSYCK       ILLPQNE-LTPKRLSE--ELAAL--DRPA------CLEMAKKGHALANRQACQHVANIIW
MURG_IDILO       VLLPQTE-VVEGALKQ--QLKRLLHDRQQ------LWTMARFARQCAMPEATQRLVNECM
MURG_HAES1       YIVEQHE-LDAEKIAQ--LLKNVDKEK--------LLEMAEKAKNMSTPLSTQRVAEVIM
MURG_VIBCH       KMIEQPE-LSVEKLTQ--MVRELDRAQ--------LLSMAQKARQAAKLDADKVVAQAII
MURG_BLOPB       KIIEQKN-FTSDVVSA--MLESWDRKT--------LCSMAQRARSIAAPNATQQVSQVII
MURG_BAUCH       KILEQPN-FTAEKVSQ--ILMSWDRSK--------LFTMAQRARTIAMVDSTERVTSELI
MURG_BUCAP       KIIEQSM-FTAELIIK--ILNSLNREK--------LFIMAKKAYSLGIRNSTSKISKIIH
MURG_BUCBP       KIIMQER-FNVNVIIT--LLKNLNRQK--------LIVMAKKLRSSYKLNSIKTITKIIE
MURG_WIGBR       EIINQKD-FTKKKLIK--LLSSWDRKK--------SLIMSQKSKNLSITNSAKKIIKEIN
MURG_PSEA6       YLLAQNE-LVQGGLTS--LLEACLAQPNM------LVEMGNKARKLARLDAVQRVTHCCQ
MURG_PSYIN       VLIAQKE-LTAKKISD--YLRLFLQNRKL------LTAMSQKSRKAAIIDATESVASICN
MURG_SHEFN       FLLPQTI-LNADNLAE--KLQLFAENRQE------LAQMGHKARGVAVLDATQRVADICA
MURG_COLP3       KLLPQAE-LNNESITS--LIIELFDQPQT------LADMAKASLSAATSDASQKVAKLCQ
MURG_PSEHT       LLMPQGQ-FNQQSIVA--LLSPYLAKPSL------IKEMAANAKQQAILDATASVAMHCE
MURG_COXBU       IIISEES-LTETDLMR--WFEQFAQDRDR------LLTMAENARKLAKPEAVQRVIAQCK
MURG_FRATN       FCLRQQQ-MTLENLLA--IIKPLNQDRSK------LEQMSKMAKKTLIKNSSEQILDCVK
MURG_VESOH       ILIEQKD-LTIELLEG--ILLNIN--KNQ------IKQMSSNALKIAKPNAVKQIVDYLL
MURG_TRIEI       LVFTEGELTPEKLQTEVLELLQS---------SEKLEKMSLGAESLAVKDSHKKLAGLVH
MURG_SYNY3       LMFAQKSLTAEQLEQAGLDLLQS---------PENLATMAKAAGTLADLDSAEQLAAIVR
MURG_SYNE7       ILAPQSELTVEQLQQQILDLLRARLGAAI---ANPLPKMAAAAGKLHVADSAEQVANLLR
MURG_SYNJA       VVMRESEANLDLLRQTALAWLAQ---------PQVVAQMAANLKATAPPAASKAVARLLQ
MURG_GLOVI       LQFSQAALSAPLLDRTVQALLDN---------PETLARMAASARRLAVPDAARRTADLVR
MURG_THEEB       EMIPQSALTGDRLGQIILEWLGQ---------PQKLQAMAENARQLAMPNSSQQVADLIR
MURG_PROMA       LIVHEDRLGTHVLTRALENLLATNRMSSKYKSDDLLNKMRIGMTKLAIKDANQRLISILQ
MURG_PROMT       IIVNQHDPEKNILKNIVSNLLDSNS----------LREMKLNMNNHDYSYPEKKIFEIIH
MURG_SYNR3       VIVAQHGPNEPGLRRMLWNLLGPRLRGCD-PAADPLRLLRQGMERLAVRDADRLLSQLLQ
MURG_PROMP       ILMNQNQISKLFFEETLKRILKFKLKKGK-PKYEILDLMKENIKNLDTLKSTNEIKKLIN
MURG_CHLPN       TMILEKELTEKLLVEK----VTFALDSHN------REKQRNSLAAYSQQRSTKTFHAFIC
MURG_CHLAB       SMILEKQLSKAVLTKN----ILLALDPET------IKNRREALRAYYQNKSSKSFYQFIC
MURG_CHLMU       TMILQKHLTEESLRKQ----VLLALDPAT------SENRRKAMLDAQKNKSFKSLYQFIC
MURG_CAMFF       KIYEQNGLDKNILFTDIMNLD--------------INSISMGLRNIVSPNGAKIIIDKIL
MURG_CAMHC       KIVRQSDADEERIFSIIQNFD--------------VKAASIGLKKLIKPDGAKKIVDDII
MURG_CAMJR       QIFMQNSINLDEFFKSILKLN--------------LENISTRLQNITQKNGADMLIQKAL
MURG_NITSB       MVFEGQSP------QDILSLN--------------IFSMSENLLPFSRPDGATKIVLSIV
MURG_SULDN       WCQREEED-LRATLLSILPQN--------------LADKSKALMEYSSRDVAKKMITDVV
MURG_WOLSU       WMVRQENL-STEVLLEILEED--------------LSQKSECLMAYVKRGAADRM-ADFI
MURG_SULNB       WIMREGEI-DTQKVLALLGED--------------LETKSRGLMEIVEKDGSKQI-ADLL
MURG_HELAH       YVVPQNELLPKKLFEVIRKLNQKDEQGHK-----NLTIISNKLQQKIAKDGAKTIIERIL
MURG_HELHP       LLLRESQLDMLRVFTFIESLQKQED---------SLSEKSHLLMSKIQPNGAKEILEHIT
MURG2_BACC1      SVLYEEDVTVKSLIKHVEELNQNNEM------------YKTALKKYNGKEAIQTIIQHIS
MURG_CLOTE       LVLEEEELSKKIFLDKLNYLYENREK------------YIKNMKNSSFKNGIDNIIDLIE
MURG_GEOTN       EVLMEEEVTNESLPAAIHRLYENKDR------------YKKNMEKSGSSDPLQTLLALIQ
MURG_OCEIH       RVLQEEELTEQSLESHLLELSKAAPI------------IRDEMKKYKSEQSLQSVTEIID
MURG_STAS1       KTILEDTLTENELKTQLREIETNRDD------------IIKQMQTYKESFTRQDLFQKII
MURG_BACSK       RMLEEENLTKETLQQEVQELYNGRQT------------YIEAMNASQATNAVAYITEKLE
MURG_LEGPC       VVIQDELLKADVLLQAVQDVMRKKDE------------IDNKIKALKIESATDKIVAIIK
MURG_STRP1       KQLQEPDLTLHNFDQAMADLFEHQAD------------YEATMLATKEIQSPDFFYDLLR
MURG_STRP3       KQLQEPDLTLHNFDQAMADLFEHQAD------------YEATMLATKEIQSPDFFYDLLR
MURG_STRP6       KQLQEPDLTLHNFDQAMADLFEHQAD------------YEATMLATKEIQSPDFFYDLLR
MURG_STRMU       QQLSEENLNFAELDKVIKDLLENQTV------------YQDKMTSSSEIKTPNDFYNLLL
MURG_STRS2       KQIDESQLTFASLLVEVDELLKHKEF------------YVQNMANSNEIQSVDSFYNLLR
MURG_TREDE       EILLGEDVRPDIFIRLLRDLGFEENISGN----ERLKNMAQASAALAGEKPALVIADFLK
MURG_TREPA       CILRAQDEKGHQLVSLLTELFHPSCA--------RIEEMARASYTLGIGNAAYDIAQQLQ
MURG_BORBU       IYIDEDEILNINILKIIKKTLKDREK---------INSLKENIKKFNNKHSSTLIAKLLI
MURG_PARUW       GIKIVEEKAKPEIVLK---SIQLLIDPIA------LDKRKSAIHSYKCRPDRTTLCELVL
MURG_RUBXD       ELLPDHEVDAKTLRGR---VEELLGDGER------RLRMASSMRSLATPRAAEEVAERML
MURG_ROSS1       VKVSDAALADTTEKGSLFRAIYRLLNCPE-----ERRAMAERARALAQPDAAQKLAFLLE
MURG_THEP1       IVIRENEASPRKIIESI------------------DKVVKKGKIEKMKENPASKISEEIL
MURG_AQUAE       LVLRQEEAKPDKVLSALKEIVKNLER------------YSENIKKFFAEGAEERMYEELL
MURG_FUSNN       YVFTRDELDESMKRVF-----EIIRNDEK------LKKMRIRLKPLKKPNAAEEIIASLD
MURG_PELUB       WLLNQKEIDEKTLLNKLINIIDNKEE---------YLVKKKNMKDFNYENTWNNINLKII
MURG_LEPIC       IVVDQKDEDESHLFRVLDQMANDVNL---------LNDMSISSLECSHVDASKDTAKYFF
MURG_STRSV       KQLAEEQLDMSHLQAA---LDDLLAN---------QASYHQAMKNSQEIKSVDEFYALLK
                                                                             

MURG_ACICJ       SAIAERVR--------------------------------------
MURG_GRABC       QSLDTARAPQGDFKGEIKS---------------------------
MURG_GLUOX       SALRS-----------------------------------------
MURG_RHILO       AIASQ-------KTVSDFKKGTQA----------------------
MURG_RHOPA       RVAKV-----------------------------------------
MURG_BARBK       ALIVG-------RSLLDMKREFFDENTT------------------
MURG_ZYMMO       RVGGNLPQQNSIEEDSTFEKNQEGAVA-------------------
MURG_SPHAL       SFAAP-PMMDVIRVGASLPRAASGIAAARREAK-------------
MURG_MAGSA       G----------------LIPNESGA---------------------
MURG_RHORT       ATADH--------RVPEMPPKEISA---------------------
MURG_HYPNA       RIAEL-----------------------------------------
MURG_MARMM       GLVTGALV--------------------------------------
MURG_CAUVC       KTAR------------------------------------------
MURG_JANSC       TLAAPTPQET------------------------------------
MURG_PARDP       ELTR------------------------------------------
MURG_WOLTR       HKLG------------------------------------------
MURG_ANAMM       GLLKG-----------------------------------------
MURG_RICTY       TVFL------------------------------------------
MURG_ORITB       FIVT------------------------------------------
MURG_KORVE       GVAGKTKRAARV----------------------------------
MURG_SOLUE       EVARP-----------------------------------------
MURG_MYXXD       DLMVQTWGPNGRERTPIEAEKKAPRSNS------------------
MURG_SYNAS       AMIRL-----------------------------------------
MURG_PELCD       NVCGQD----------------------------------------
MURG_PELPD       TPTN------------------------------------------
MURG_MAGMM       SMVKMKR---------------------------------------
MURG_BDEBA       Q---------------------------------------------
MURG_DESPS       QLINRDEL--------------------------------------
MURG1_BACC1      KLVKK-----------------------------------------
MURG1_BACAN      KLVKK-----------------------------------------
MURG_LISIN       SIMK------------------------------------------
MURG_ENTHR       SLIQK-----------------------------------------
MURG_LACLA       EISK------------------------------------------
MURG_LACSS       TII-------------------------------------------
MURG_LACP3       TLLSKRR---------------------------------------
MURG_LEUMM       DAIGE-----------------------------------------
MURG_OENOB       QVINERKQETTK----------------------------------
MURG_LACJO       SLIKNK----------------------------------------
MURG_HUNT2       DIMKNKAAG-------------------------------------
MURG_CALS4       TIT-------------------------------------------
MURG_CLOD6       KVYNSTQKSTSKKTKKEKVIKEVKEIKKETTPSIEGQAKVIGIKKR
MURG_CALS8       EYLSL-----------------------------------------
MURG_DESHY       DTAWK-----------------------------------------
MURG_MOOTA       KTVESG----------------------------------------
MURG_SYNWW       TLPDN-----------------------------------------
MURG_CARHZ       ALLKPKSNKKT-----------------------------------
MURG_SYMTH       GIARQSREAREARRGR------------------------------
MURG_FLAPJ       KLVESQKS--------------------------------------
MURG_GRAFK       KLINNKV---------------------------------------
MURG_CYTH3       EIINTDRK--------------------------------------
MURG_PORGI       RIVEHEKRAN------------------------------------
MURG_CHLCH       GLSR------------------------------------------
MURG_SALRD       ALADRYRTN-------------------------------------
MURG_DESVV       ELLKTTPRAR------------------------------------
MURG_DESAG       DLIRKKPLRSLVPEREGE----------------------------
MURG_LAWIP       DLLSANAMK-------------------------------------
MURG_ACIC1       QAAAARRVVT------------------------------------
MURG_THEFY       AIARGERPTPEMPIDYSEESGDTR----------------------
MURG_FRACC       DAAATRRRSRPRHAAP------------------------------
MURG_SACEN       EVAGR-----------------------------------------
MURG_CORJK       AAADA-----------------------------------------
MURG_NOCSJ       ELGLGSSAR-------------------------------------
MURG_ARTS2       EAVSK-----------------------------------------
MURG_LEIXX       TGLSAA----------------------------------------
MURG_BIFLO       QLAEPSK---------------------------------------
MURG_CUTAK       SAATSIDPTIG-----------------------------------
MURG_COREF       TAAGY-----------------------------------------
MURG_CORDI       SIVKNHDRNK------------------------------------
MURG_TROWT       LALSS-----------------------------------------
MURG_DEIRA       VQLRRAPSPTAHAPTAHD----------------------------
MURG_THET2       AFL-------------------------------------------
MURG_ACISJ       RLAR------------------------------------------
MURG_BORA1       AAARRQS---------------------------------------
MURG_DECAR       EIAK------------------------------------------
MURG_THIDA       ALAK------------------------------------------
MURG_NITEC       QLIETGP---------------------------------------
MURG_NITMU       QMVAV-----------------------------------------
MURG_METFK       SIALPVQGGKHS----------------------------------
MURG_NEIG1       ACAA------------------------------------------
MURG_HAHCH       EACAND----------------------------------------
MURG_MARHV       EAANG-----------------------------------------
MURG_CHRSD       EANRDSQ---------------------------------------
MURG_PSEU5       EVAHG-----------------------------------------
MURG_XYLFT       KESI------------------------------------------
MURG_ALCBS       EVANGR----------------------------------------
MURG_ALKEH       EEAR------------------------------------------
MURG_NITOC       EVASG-----------------------------------------
MURG_HALHL       EVAHG-----------------------------------------
MURG_METCA       EEAGA-----------------------------------------
MURG_DICNV       ELCR------------------------------------------
MURG_HYDCU       TLCDSSVH--------------------------------------
MURG_SACD2       ELIHD-----------------------------------------
MURG_ACIAD       TL--------------------------------------------
MURG_PSYCK       QAL-------------------------------------------
MURG_IDILO       EYRQSDD---------------------------------------
MURG_HAES1       DTVKT-----------------------------------------
MURG_VIBCH       AITE------------------------------------------
MURG_BLOPB       EYLKK-----------------------------------------
MURG_BAUCH       ELANNTKH--------------------------------------
MURG_BUCAP       DVSNKI----------------------------------------
MURG_BUCBP       NITH------------------------------------------
MURG_WIGBR       NLIGLVK---------------------------------------
MURG_PSEA6       LLVEKAQ---------------------------------------
MURG_PSYIN       QLV-------------------------------------------
MURG_SHEFN       SFARKG----------------------------------------
MURG_COLP3       QLSISNGAKLRNNEEKI-----------------------------
MURG_PSEHT       QVTNKRA---------------------------------------
MURG_COXBU       KFYAAR----------------------------------------
MURG_FRATN       KILNNK----------------------------------------
MURG_VESOH       VSD-------------------------------------------
MURG_TRIEI       EILSH-----------------------------------------
MURG_SYNY3       ASVEKSR---------------------------------------
MURG_SYNE7       SLL-------------------------------------------
MURG_SYNJA       EICRDSAR--------------------------------------
MURG_GLOVI       ECVRH-----------------------------------------
MURG_THEEB       RLIPAP----------------------------------------
MURG_PROMA       RYV-------------------------------------------
MURG_PROMT       SIS-------------------------------------------
MURG_SYNR3       DLAAEA----------------------------------------
MURG_PROMP       YFLKEF----------------------------------------
MURG_CHLPN       ECL-------------------------------------------
MURG_CHLAB       ECL-------------------------------------------
MURG_CHLMU       ESL-------------------------------------------
MURG_CAMFF       KQ--------------------------------------------
MURG_CAMHC       ENLKNEDKK-------------------------------------
MURG_CAMJR       FDNLTFIR--------------------------------------
MURG_NITSB       KMIEK-----------------------------------------
MURG_SULDN       MSLNA-----------------------------------------
MURG_WOLSU       LS--------------------------------------------
MURG_SULNB       KNYAKS----------------------------------------
MURG_HELAH       SA--------------------------------------------
MURG_HELHP       SLMSH-----------------------------------------
MURG2_BACC1      EA--------------------------------------------
MURG_CLOTE       KYYTMKN---------------------------------------
MURG_GEOTN       NTAR------------------------------------------
MURG_OCEIH       NVMK------------------------------------------
MURG_STAS1       NDALSE----------------------------------------
MURG_BACSK       QEVQ------------------------------------------
MURG_LEGPC       EQAHVQTPRIV-----------------------------------
MURG_STRP1       ADISSAIKEK------------------------------------
MURG_STRP3       ADISSAIKEK------------------------------------
MURG_STRP6       ADISSAIKEK------------------------------------
MURG_STRMU       TDITSKSKGK------------------------------------
MURG_STRS2       EDMGR-----------------------------------------
MURG_TREDE       SFFTSKNEDL------------------------------------
MURG_TREPA       TFIKEGM---------------------------------------
MURG_BORBU       KDIKETKSK-------------------------------------
MURG_PARUW       DTSELKSLHKAPQKRK------------------------------
MURG_RUBXD       AAGREGTG--------------------------------------
MURG_ROSS1       TLVIRRQTA-------------------------------------
MURG_THEP1       GEIM------------------------------------------
MURG_AQUAE       G---------------------------------------------
MURG_FUSNN       IWRN------------------------------------------
MURG_PELUB       SVINEN----------------------------------------
MURG_LEPIC       SLD-------------------------------------------
MURG_STRSV       ADIDKGKK--------------------------------------