CLUSTAL format seed alignment for MF_00034

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q8F836_LEPIN          ------MRSSSSSLRIIGIDPGSHRAGYAV--LEKNAS-KIKILNYGTVE-VPSGTPSPD
RUVC_SYNY3            ------MDQTEAAQRWLGIDPGLAIIGWAI--LDGQPDLSAHLVDYGIIE-TSKNLSTPE
RUVC_DEIRA            -------------MRVLGIDPGLANLGLGL--VEGDVR-RAKHLYHVCLT-TESAWLMPR
RUVC_THET8            -------------MVVAGIDPGITHLGLGVVAVEGKGALKARLLHGEVVK-TSPQEPAKE
RUVC_RHOBA            MGTQVVTARPGSASCILGIDPGLNTTGYAV--ISREGP-RLCLREAGVIK-SRRSDTLPE
RUVC_THEYD            -------------MTVIGIDPGSRHFGYGI--VDAK---QMKLIHANTIN-LSHDISLPY
A6GW52_FLAPJ          ---------MANERIILGIDPGTTIMGFGL--IKIINK-KMEFLQLNELI-LSKYDNHYQ
RUVC_CAMJE            -----------MNLKILGIDPGSRNCGYAI--IEADKG-KNILIEAGLIK--IKPSTLQY
RUVC_HELPY            -------------MRILGIDPGSRKCGYAI--ISHASN-KLSLITAGFIN--ITTTRLQE
RUVC_SALRD            -------------MIILGVDPGSRATGYGL--VDPSGG-DEHLVAADTIR-LADTDDHPT
RUVC_CHLTE            -------------MIVLGIDPGSRKTGYGV--IAETAA-GYRVLGCGLVR-PRAADTLHE
RUVC_RICPR            -------------MIVLGIDPALGKLGWAV--VAKEST-KLHYLASGTIK-THSKDEIHN
B7PXR6_IXOSC          -----------VIMIVLGIDPALGSLGWAV--VAKETA-KLKYLASGIIK-TNSKDEIHH
RUVC_DESVH            ---------MAASVTVIGIDPGSQCTGWGI--VREASG-VLTLVDCGAIR--PKGGDFAA
E9G9D5_DAPPU          ----------MKPMIVLGLDPGLRTTGWGS--VFLKDK-EVIYQPSGLIK-TPEKCPTPE
RUVC_BIFLO            -------------MIILGVDPGLTRCGVGV--IEAGEHRRLSFIHVDVVR-SSPDITQDL
RUVC_CORGL            --------MNHEGLRVMGIDPGLTRCGLSV--VQAGRGRTVYPVSVGVVR-TPPDAELAE
RUVC_STRCO            -------------MRVLGVDPGLTRRGIGV--VEGVAGRPLTMIGVGVVR-TPADADLGH
RUVC_MYCS2            -------------MRVMGVDPGLTRCGLSM--IESGKGRQVIALDVDVVR-TPADTPLQK
RUVC_MYCTU            -------------MRVMGVDPGLTRCGLSL--IESGRGRQLTALDVDVVR-TPSDAALAQ
RUVC_DICTD            -------------MVVIGFDPGTAITGYGI--LNKGED-GISIIEYGALT-TPSGWGIGR
RUVC_CAUVC            -----MMNANRLPTRILGLDPGLRRTGWGV--LAVEGS-RMTHIAHGVIT-PDEKAEFAD
RUVC_RHORT            -------------MRLLGLDPGLRITGWGV--IEVTGN-RIGHVADGVVR-SDDRLSLAA
RUVC_RHOS4            -------------MRVLGIDPGLRNMGWGV--IDVSGT-RLAHVANGICH--SDSGDLAH
RUVC_AGRFC            ---------MQKTIRIIGIDPGLRRTGWGV--IDTLGN-SLRFVASGTVT-SDGDMDLAS
RUVC_BRADU            ----MTALPIRGPVRIIGIDPGLRRTGWGV--IEAEGN-RLIYVACGSVE-PPDDLPLSS
RUVC_KORVE            -------------MRVMGIDCGSEYTGFGI--VESDDRARLHCIVAGAVH-LSARDPLEN
RUVC_XANCP            ------------MTRILGIDPGSQRTGIGI--IDVDESGRSRHVFHAPLV-LLGEGDFAQ
RUVC_FRATT            -------------MVILGIDPGSRITGFGV--IKVQDN-KIYYVASGCIR-I-TEITTPK
A0A088ACT6_APIME      ---MQKQPTEQTHIRILGVDPGSRVTGFGV--IDVIGS-QHIYVASGCIK-TTSGAPLAE
RUVC_NEIG1            ---------MSATVRILGIDPGSRVTGFGI--IDVRGR-DHFYVASGCIK-TPADEPLAD
RUVC_NEIMB            ---------MAASVRILGIDPGSRVTGFGV--IDVRGR-DHFYVASGCIK-TPADAPLAD
RUVC_BORPE            -------------MRVLGIDPGLRRTGFGV--IDAEGM-RLRYVASGTIV-VPPALALPE
RUVC_BURPS            -------------MRILGIDPGLRVTGFGV--IDVSGH-QLAYVASGVIK-TPTA-DLPT
RUVC_COXBU            --------MDNPRRIIIGIDPGSRITGYGI--IWSQGS-KQGCIAFGQIK-T-DNDSLNF
RUVC_PSEAE            ------------MTLILGIDPGSRITGFGV--VRETAR-GCEYVASGCIR-T-GNGPLHE
A7T3Z8_NEMVE          ------------MTLILGIDPGSRITGYGV--VRDTGR-NCEYVASGCIR-T-GNGSMPE
RUVC_GEOSL            -------------MRVLGIDPGSRITGYGI--IEKIGN-RLVHVDNGAIH-TDSHREFAL
RUVC_SHEON            ------------MAIILGVDPGSRITGYGV--IQCQGR-QQLYLGSGCIR-T-SGDDLPL
RUVC_VIBCH            ------------MSVILGIDPGSRVTGYGV--IRQQGR-HLIYLGSGCIR-T-SDLELPL
RUVC_ALIF1            ------------MSIILGIDPGSRITGYGV--IRQNGR-HLQYLGSGCIR-M-SEKELPG
RUVC_HAEIN            ------------MSIILGIDPGSRVTGYGV--IRQTGK-HLEYLGSGAIR-T-QVEDLPT
RUVC_YERPE            ------------MAIVLGIDPGSRVTGYGV--IRQQGR-QLTYLGSGCIR-T-VVDDMPT
RUVC_ECOLI            ------------MAIILGIDPGSRVTGYGV--IRQVGR-QLSYLGSGCIR-T-KVDDLPS
RUVC_SHIDS            ------------MAIILGIDPGSRVTGYGV--IRQVGR-QLSYLGSGCIR-T-KVDDLPS
RUVC_SALTY            ------------MSIILGIDPGSRITGYGV--IRQVGR-QLTYLGSGCIR-T-KVDDLPS
RUVC_FUSNN            -------------MRVIGIDPGTAIVGYGI--IDYDKN-KYSIVDYGVVL-TSKDLSTEE
Q2FQ00_METHJ          --------MNTGNETVLGIDPGFARCGYGV--VGKEKN-TPVAYEWGCIETTPKTGDTPV
RUVC_THEMA            ----------MGSLRILGVDPGYGIVGIGI--IEVSGN-RISHVFHGTIE-TPKNLPAEK
D1BA53_THEAS          ---------MPRDLLCLGIDPGIGTLGYGL--VRQRGG-DLSAEGYGAIH-TPPGLSLPE
RUVC_CHLAA            -------------MRALGIDPGTATMGWGI--VEFNNG-HLRLIDVGALT-TPAGMPHPE
RUVC_MOOTA            -------------MLILGIDPGTAIVGYGL--VEARAG-QTRALVYDCIR-TPAGEDPCR
RUVC_PROMA            -------------MVILGIDPGLARVGYGL--IEVNNQRQVKMLDCGIIK-TNKNQYEGE
RUVC_GLOVI            ----------MCGMRILGLDPGVAILGYGV--LDFFDSAPPVVCDYGIVQ-TSAKTAFEA
RUVC_THEEB            -------------MRILGLDPGLATLGYGC--IEVYRD-TCQVRDFGVIT-TSADLPTGD
                                       *.* .    * .   :                           

Q8F836_LEPIN          NLLMLRKGLREILEEFNPSIASVEEMFFAKN-KKTASRVFESRGVLLVTLAEMNIRILEP
RUVC_SYNY3            RLVEIEQDIHVLLEEFSPQAIAMEMPFFSRQ-IKAAGGVMQALGVINLVIYREKSIQPVF
RUVC_DEIRA            RLQYLHEELTRLLTEYRPDAVAIEDQILRRQ-ADVAFKVGQAFGVVQLACAQAGVPIHAY
RUVC_THET8            RVGRIHARVLEVLHRFRPEAVAVEEQFFYRQ-NELAYKVGWALGAVLVAAFEAGVPVYAY
RUVC_RHOBA            RLREIHVGLSEVFAVHAVDLMALEQLFSHYDRPRTAILMGHARGVICLAAASAGVPVEHY
RUVC_THEYD            RLKSIYEILLSMVEKYSPDEMAVEKIFVGKK-ITSSFVLGYARAIAFLVAAQKEIPVYEY
A6GW52_FLAPJ          KLKVIFERTIELIDTHNPDEIAIEAPFFGKN-VQSMLKLGRAQGVAMAAGLSRDIPITEY
RUVC_CAMJE            QITELCEGLDLIFKNHSFDEVAIEDIFFAYN-PKTVLKLAQFRGALSLKILQIHGDFAEY
RUVC_HELPY            QILDLIEALDCLLDRYEVNEVAIEDIFFGYN-PKSVIKLAQFRGALSLKILERIGNFSEY
RUVC_SALRD            RLKQIYDALVDVIDAHGPDEFAVEMPVYGQN-PQSMLKLGRAQAAAMMAALNRDLPVAQY
RUVC_CHLTE            RISQLCAGLDEVIEQLKPEAVALETAFVGRN-VRSALILGQVRGAVLATVMRHSLPVREY
RUVC_RICPR            RLAFINSILEKVILEYQPNIAAIEETFVNTN-NVTSLKLGYARGAIMSLIGRYNLDMQEF
B7PXR6_IXOSC          RLAFINSTLEKVILEYQPNMAAIEETFVNTN-SVTSLKLGYARGAIMSLIGRYNLGLREF
RUVC_DESVH            RLGDLYRQLADVVRAHTPDEAAVEDVHAAQN-VATALKLGQARGVVVAACAAHGVPVIDY
E9G9D5_DAPPU          RLAYLFQALTTIIREYCPEEVSVEEVFVNKN-PKSSLKLALARGVVLCAPAVIGLPVFSY
RUVC_BIFLO            RLLAIYNGLSEKMDRFAPDAVSIERVFAQSN-RNTVLGTAQAAGLAMLAAAQRNIPVALH
RUVC_CORGL            RLLRLSKAVGEWMDEYTPDVIAIERVFERGN-VSTVMNTAHAVGVLILAAAERGLPVHMY
RUVC_STRCO            RLVAVEQGIEQWLDEHRPEFVAVERVFSQHN-VRTVMGTAQASAVAILCASRRGIPVALH
RUVC_MYCS2            RLLTISDAAEHWMDTHRPDVIAIERVFANQN-ANTAMGTAQAGGVIALAAAKRDIEVHFH
RUVC_MYCTU            RLLAISDAVEHWLDTHHPEVVAIERVFSQLN-VTTVMGTAQAGGVIALAAAKRGVDVHFH
RUVC_DICTD            RLNYLFDQVSSLLDLYNPDVVVMENIFFNKN-IKTAINIGQAQGVIILAAEQHQKEISIL
RUVC_CAUVC            RLLHLFEGITAVIEQHRPDEAAVEEVFLNTN-AQSTLKLGHARAAALIAPARAGLLVAEY
RUVC_RHORT            RLAQLHGGIVAVLKAYEPVEAAVEETFVNRN-PASTLKLGQARGAVMLAPALAGLVVAEY
RUVC_RHOS4            RLLSLHGQLTDVLARFQPDTAAVEHTFVNKD-GVATLKLGQARGIALLVPAQAGLAVGEY
RUVC_AGRFC            RLCQLHDGLAEIVHSHQPDEAAVEQTFVNKD-AVATLKLGQARGIAMLVPARAGLPVFEY
RUVC_BRADU            RLLAIHEGLASVLSDHKPMEAAVEQTFVNKD-GVATLKLGQARGVAMLAPAMFGISVAEY
RUVC_KORVE            KLAKIFRELCSVIREHDPEVVAIEDVFYAVN-AKSALKLGHVRGVAMLAVAECGLRVATY
RUVC_XANCP            RLKRLLHGLGELIETYQPQEVAIEKVFMGKS-ADSALKLGHARGAAICAVVLRDLPVHEY
RUVC_FRATT            RLKQIADGITQIINIYAPTEAAIEQIFMFQN-PMGAIKLGQARGVAMCTLAINNLEVSEY
A0A088ACT6_APIME      RIRIIVQNLHEVITTYQPTQTAVEQVFVNVN-PAATLVLGQARGAVLAALTLGELPVFEY
RUVC_NEIG1            RIAVIVRHIGEVVAVYKPQQAAVEQVFVNVN-PASTLMLGQARGAALAALVSHKLPVSEY
RUVC_NEIMB            RIAVIVRHIGEVVTVYKPQQAAVEQVFVNVN-PASTLMLGQARGAALAALVSHKLPVSEY
RUVC_BORPE            RLKVILDNLREVARETRPDVAALEIVFLNTN-PASTLLLGQARGAALCALADSALDVHEY
RUVC_BURPS            RLGTIYDGVSTLIREHTPDQAAIEKVFVNVN-PQSTLLLGQARGAAICGLVSGGLPVAEY
RUVC_COXBU            RLHQIERELRDLILIHRPHEAAIEQVFTFHN-HQSALKLGQARGAALVATAACALSVAEY
RUVC_PSEAE            RLHVVFRSVREVIRTHGPTALSIEQVFMARN-ADSALKLGQARGAAIVAAMEEGLSVAEY
A7T3Z8_NEMVE          RLQVVFRGVREVIETYGPVTMGIEQVFMARN-PDSALKLGQARGVAIVAGMEAGLDIAQY
RUVC_GEOSL            RLHKIYEGLSRVIEEYRPDAMAVEQVFLAHN-AQSALKLGQARGAAIVAGVSAGLPVSEY
RUVC_SHEON            KLKQIFDGISEIIRQYQPDEFAIERVFLAKN-ADSALKLGQARGAAIVAATVANLPVAEY
RUVC_VIBCH            RLKQIYAGVSEIITQFQPDAFAIEQVFMAKN-ADSALKLGQARGSAIVAAVNAELPVYEY
RUVC_ALIF1            RLKQIYAGVSEIITQFQPDVFAIEQVFMSKN-ADSALKLGQARGSAIVAAVNADLPVYEY
RUVC_HAEIN            RLKRIYAGVTEIITQFQPNMFAIEQVFMAKN-ADSALKLGQARGTAIVAAVNNDLPVFEY
RUVC_YERPE            RLKLIYAGVTEIITQFQPDFFAIEQVFMAKN-PDSALKLGQARGAAIVAAVNLNLPVSEY
RUVC_ECOLI            RLKLIYAGVTEIITQFQPDYFAIEQVFMAKN-ADSALKLGQARGVAIVAAVNQELPVFEY
RUVC_SHIDS            RLKLIYAGVTEIITQFQPDYFAIEQVFMAKN-ADSALKLGQARGVAIVAAVNQELPVFEY
RUVC_SALTY            RLKLIYAGVTEIITQFQPDYFAIEQVFMAKN-ADSALKLGQARGVAIVAAVNQELPVFEY
RUVC_FUSNN            RLEIVYDEIDKILKKYKPEFMAIEDLFYFKN-NKTVISVAQARGVILLAGKQNNIAMTSY
Q2FQ00_METHJ          RLLSIYDSIENLIRTYAPACLACEKLFFSRN-TTTAMQVSEAKGVIILAAAKHQIPVFEY
RUVC_THEMA            RLKRIYEEFLKVLERFSPDECAMEKLFFVKN-VTTAIGVGEARGVLFLALAEKNIPVFEY
D1BA53_THEAS          RLSCLFGSLEGELGGVRPDLVAVERLYFGRN-TTTAEMVWQARGVVLLFASRLGVPVLEP
RUVC_CHLAA            RLLQLYNGLRAIIERLRPDTAAVEELFFGKN-VNTALTVGQARGVALLALAQAGIPVHEY
RUVC_MOOTA            RLATIYAGIRELIERLQPETMAVEELFFNKN-SKTALAVGQARGVILLAAAHTGLPVAEY
RUVC_PROMA            RMVEIAKDLRVLIRKWKPGLAAVEKFFFYKS--STTISVVQARGVLIMTLARFKVPIVEF
RUVC_GLOVI            RLAAIYEDINSLFSAHKPDLVAIEKLFFYKM-GNT-ISVAQARGVVLLCAAQHGVPYVEF
RUVC_THEEB            RLQSLYNDLHTLIPILQPDLVALERLFFYRM-SHT-IGVAQARGVILLVLSQRHCPLLEL
                      .:  :                  *                   .                

Q8F836_LEPIN          TVSQIKKGTTGSGTADKKQIHQALKLLLNVELLKGHDDSWDAIAAAYVGLSMSSSPLLSK
RUVC_SYNY3            LHQSSWKCHLGNGKANKAEVAAMVQNFFGLEDLP-IDDSVDAIAIALAGLNGVRNDIG--
RUVC_DEIRA            GPMQVKKSLVGTGRADKEQVIYMVKASLGIRELF-NNHAADALALALTHLAHAPMQERSE
RUVC_THET8            GPMQVKQALAGHGHAAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKP
RUVC_RHOBA            EPTRVKKVMTGNGRAPKSQIQLAVKMQLNLQSVPEPADVADAMAISLCGHYLANNPIDQA
RUVC_THEYD            SSTEIKKALTGYGRAHKVQVKSMVYNFLHIDKKI-SYDCADALAVAICHINSKTNFM---
A6GW52_FLAPJ          EPKKIKMAITGNGNASKEQVAKMLQQLLGLKELPKNLDSTDGLAAAVCHFFNSGKVIGTT
RUVC_CAMJE            TPLQVKKAVTGKAKATKEQVAFMVKRLLGLSKDIKPLDITDAIAVALTHAANLRVRV---
RUVC_HELPY            TPLQVKKALTGNGKAAKEQVAFMVKRLLNITSEIKPLDISDAIAVAITHAQRLKLH----
RUVC_SALRD            TPKEVKKSVTGNGNASKKQVGFMIESILSAREQTFAHDTADALAIALCHGNRDAHDDGDS
RUVC_CHLTE            APREIKLSVTGTGSACKEQVAAMLSRMLELGGELKPLDVTDALGIAYCDLARGASSLGGQ
RUVC_RICPR            KPNTVKKTVTGYGHAGKEQILYMIKHLISGTDLITNSDEADAVALAYTCLVAKKY-----
B7PXR6_IXOSC          KPNTVKKTVTGYGHAEKDQILHMIKLLLPGTSLITNSDEADSVAIAYTYLVTKNY-----
RUVC_DESVH            RPSVIKKALVGTGRAEKEQVGYMVGQVLGVRPDW-KLDTGDALAAAICHLNQRRLTRLAG
E9G9D5_DAPPU          APNYMKKALSGYGHADKNQIGWAVQQILKLKTPP-QKDAADALGLAICHSYAKSTPQCSF
RUVC_BIFLO            TPTEAKLAITGNGQAQKIQVERMVTRILNLTKMPTPADAADALALAICHALRPAGALQGG
RUVC_CORGL            TPSEVKKAISGNGRADKKQMTVMITRILGLGEPPKPADAADALSLAVCHCWRAPMLMRAQ
RUVC_STRCO            TPSEVKAAVTGSGRADKAQVGAMVTRLLRLAAPPKPADAADALALAICHIWRAPAQNRLQ
RUVC_MYCS2            TPSEVKAAVTGSGRADKSQVTEMVTRILALQAKPTPADAADALALAICHCWRAPMIARMA
RUVC_MYCTU            TPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTPADAADALALAICHCWRAPTIARMA
RUVC_DICTD            TPLEVKLSVVGYGRATKNQIQYMVKEILKLKDIPKPDDVADALALCISYIYKQEGC----
RUVC_CAUVC            STRLVKKAVVGTGAADKAQIGFMIARLLPTAGKT-TADCADALAVAITHANLRVANRRVA
RUVC_RHORT            QPSVVKKAVVGTGGAAKDQVGMMIRTLLPGATLE-TADAADALAIAICHAHYRAGALSLA
RUVC_RHOS4            APNAVKKTVVGVGHAAKEQIQHMVRLHLPGVHLA-GPDAADALAVAICHAHHVQSSGRLE
RUVC_AGRFC            APNAVKKAVIGVGHGEKQQIHMMLKILMPKAEFK-GNDAADALAIAICHAHNRGGDRMRR
RUVC_BRADU            APNQVKKTVVGAGHADKQQIAMMLKILLPKAEPP-SADAADALAIAITHAHHRQST----
RUVC_KORVE            APLAVKSAVVGYGKAEKCQVQAMVARLLNLPQVPEPADVADALAIAICHLHTSATLTRMH
RUVC_XANCP            AATEIKLALVGKGGADKVQVQHMVGIMLNLKGKL-QADAADALAVAITHAHVRATAQRLG
RUVC_FRATT            SAKQIKQAVVGTGGAAKSQVQHMVQSLLGLSKKP-PEDAADALAIAICHYHSSKSLAKIS
A0A088ACT6_APIME      TALQVKQAVVGKGKAAKEQVQHMVVQMLSLSGTP-QADAADALAVALTHALRNYSLASRI
RUVC_NEIG1            TALQVKQAVVGKGKAAKEQVQHMVVQMLGLSGTP-QADAADGLAVALTHALRNHGLAAKL
RUVC_NEIMB            TALQVKQAVVGKGKAAKEQVQHMVVQMLGLSGTP-QPDAADGLAVALTHALRNHGLAAKL
RUVC_BORPE            TALQIKKAVMGTGRAAKEQVQMMVQRLLSLDGTP-APDSADALACAICHAHVGPLHDKLD
RUVC_BURPS            TALQLKQAVVGYGRATKEQMQEMVARLLSLSGRP-GTDAADALGMAICHAHGGNTLNTLG
RUVC_COXBU            SARQIKQAVVGYGAATKAQVQHMVHLLLQLEKAP-PADAADALAIALCHATSSRLSE---
RUVC_PSEAE            TASQVKQAVVGTGGADKQQVQMMVMHLLKLTQKP-QIDASDALAIALCHAHTQQSLVPHG
A7T3Z8_NEMVE          TATQVKQAIAGSGGADKEQVQLMVMHLLKLVQKP-QIDASDALAIALCHAHHRQSLIPHG
RUVC_GEOSL            TAMQVKQAVVGYGHARKEQVQQMVKSLLNLPEIA-QADASDALAVAVCHANSAVMKSVLR
RUVC_SHEON            SATQIKSAVVGTGRAKKEQVQHMIQQLLKLPAAP-QADAADALGVAVCHYHTNQSLVALS
RUVC_VIBCH            AARLIKQAVVGTGAADKSQVQHMVQQMLKLPGKP-QADAADALGVAICHANTNKTLIALA
RUVC_ALIF1            AARLIKQAVTGTGGADKSQVQHMVMSMLKLPAKP-QADAADALGAAICHANTNKTLIALA
RUVC_HAEIN            AARLVKQTVVGIGSADKVQVQEMVTRILKLSDKP-QADAADALAIAITHAHSIQHSLHIA
RUVC_YERPE            AARQVKQTVVGTGAAEKSQVQHMVRSLLKLPANP-QADAADALAIAITHCHLSQNTLRLG
RUVC_ECOLI            AARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANP-QADAADALAIAITHCHVSQNAMQMS
RUVC_SHIDS            AARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANP-QADAADALAIAITHCHVSQNAMQMS
RUVC_SALTY            AARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANP-QADAADALAIAITHCHVSQNAMQMS
RUVC_FUSNN            TPLQVKIGITGYGKAEKKQIQQMVQKFLGLSEIPKPDDAADALAICITHINSLGSKLSFG
Q2FQ00_METHJ          TPKQVKLAITGSGLADKKQIQMMITRLLRLSEIPQPDDAADGLALALCHVNWMRMR----
RUVC_THEMA            APNEVKVSLSGYGRASKKQIQENVKRFLNLSEIPRPDDAADALAIAWCHALQSRARRVTH
D1BA53_THEAS          KPSEVKMAVCGYGGADKRQVQLMVTGLLGLKRCPSPDDVADALAVAIAGLSMCIGGYWG-
RUVC_CHLAA            KPLAVKQAVAGYGGADKRQMQEMVRLTLGLATIPRPDDAADALAIAICHAYTAPTLQRFG
RUVC_MOOTA            TPLEVKQAVAGFGRAPKEQVQRMVQALLGLEEKPRPDDVADALAVAVCHASFAPWRQ---
RUVC_PROMA            PPMQIKLAVAGSGHAKKDEVLEAVMRELRLKVPPRPDDAADALAIALTGLFQQ-------
RUVC_GLOVI            SPPQVKLALTGDGRADKRAIQEAVQRELGLITMPKPDDAADALAIALTGWFHHLPPAARE
RUVC_THEEB            TPPQVKQALTGYGNATKIEVQRAVQRELHLCTLPQPDDAADALAIALTASRHCGHING--
                           .    * . . *  :   :   :            *.:. .              

Q8F836_LEPIN          LR---------------------------------------------------------
RUVC_SYNY3            -----------------------------------------------------------
RUVC_DEIRA            RLAAAGR---------AARTGDAPLRR--------------------------------
RUVC_THET8            L----------------------------------------------------------
RUVC_RHOBA            LA---------------------------------------------------------
RUVC_THEYD            -----------------------------------------------------------
A6GW52_FLAPJ          SYTGWDA---------FVKQNEERVKK--------------------------------
RUVC_CAMJE            -----------------------------------------------------------
RUVC_HELPY            -----------------------------------------------------------
RUVC_SALRD            YTGWAS----------FVDANPDRVSE--------------------------------
RUVC_CHLTE            LRKNGK----------GRSKGWAAFVNEHPELMA-------------------------
RUVC_RICPR            -----------------------------------------------------------
B7PXR6_IXOSC          -----------------------------------------------------------
RUVC_DESVH            LA---------------------------------------------------------
E9G9D5_DAPPU          D----------------------------------------------------------
RUVC_BIFLO            EREQHLTAAQRQWAEAAQNSTRRRINHDRGM----------------------------
RUVC_CORGL            SQYSEQELEK------RRRVQQGKLGKAKSTYNAEQAQSHASDPAKAAHPSQFQRTDTN
RUVC_STRCO            QAVALHTAQGPRRPH-KLHPSKGRPA---------------------------------
RUVC_MYCS2            AAEAMAEE--------QRRKFQAKIKAARG-----------------------------
RUVC_MYCTU            EATSRAEARAAQQRH-AYLAKLKAAR---------------------------------
RUVC_DICTD            -----------------------------------------------------------
RUVC_CAUVC            -----------------------------------------------------------
RUVC_RHORT            ----------------LARAGGGR-----------------------------------
RUVC_RHOS4            AA--------------LARAAR-------------------------------------
RUVC_AGRFC            LLAAG------------------------------------------------------
RUVC_BRADU            ----------------ALRLKVVGV----------------------------------
RUVC_KORVE            AKA--------------------------------------------------------
RUVC_XANCP            V---------------NTQQAWSRKR---------------------------------
RUVC_FRATT            G---------------ASRVSQKRIK---------------------------------
A0A088ACT6_APIME      QQ--------------GLTIKSGRFR---------------------------------
RUVC_NEIG1            NPS-------------GMQVKRGRFQ---------------------------------
RUVC_NEIMB            NPS-------------GMQVKRGRFQ---------------------------------
RUVC_BORPE            RLGTAAQLGS------RPRLRNGRLVG--------------------------------
RUVC_BURPS            GIAPALAKK-------GLRVRRGRLVG--------------------------------
RUVC_COXBU            ----------------KLMQAKGTLT---------------------------------
RUVC_PSEAE            LV--------------GARRRGGRLRL--------------------------------
A7T3Z8_NEMVE          L----------------------------------------------------------
RUVC_GEOSL            SIR--------------------------------------------------------
RUVC_SHEON            GR--------------ATTRTYGRYR---------------------------------
RUVC_VIBCH            GQ--------------ATSARRGRYR---------------------------------
RUVC_ALIF1            GK--------------ATGARRGRYR---------------------------------
RUVC_HAEIN            NSVKMTETQEKMTALLKTRYSRGRFRLKI------------------------------
RUVC_YERPE            ND--------------QMTLSRGRIR---------------------------------
RUVC_ECOLI            ES--------------RLNLARGRLR---------------------------------
RUVC_SHIDS            ES--------------RLNLARGRLR---------------------------------
RUVC_SALTY            ES--------------RLNLARGRLR---------------------------------
RUVC_FUSNN            RTNNLNKIVVPSGTNKISLEEYKNLLKK-------------------------------
Q2FQ00_METHJ          -----------------------------------------------------------
RUVC_THEMA            EKD--------------------------------------------------------
D1BA53_THEAS          -----------------------------------------------------------
RUVC_CHLAA            LS---------------------------------------------------------
RUVC_MOOTA            ----------------REKEVAGR-----------------------------------
RUVC_PROMA            -----------------------------------------------------------
RUVC_GLOVI            A---------------VPAYSVG------------------------------------
RUVC_THEEB            -----------------------------------------------------------