CLUSTAL format seed alignment for MF_00036_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYA_LEIXX       --------------MQTAEIHRRWLDFFARRGHTVVPSASLVSDD-PSLLFTVAGMVPFV
SYA_CUTAK       --------------MRTAEIGQRFVDFFESKGHTVVPSASLLYND-PTLLFVNAGMVPFK
SYA_CORJK       --------------MQTHEIRQRFIEHFTKAGHTEVPSASLILDD-PNLLFVNAGMVPFK
SYA_THEFY       --------------MKSAEIARRFLAFFEKNGHTVVPSASLIAED-PTLLLVNAGMVPFK
SYA_BIFLO       --------------MRTADIAKRYLDYFAKHDHLIVPSASLISPN-PTTLFTIAGMVPFI
SYA_TROW8       --------------MLTSDLRLLFLDFFAKRGHKVSPSASLISND-PSVMFTIAGMLPFI
SYA_PROMA       MAVERLSSNSEMKSLTGEEIRAAFLNFYAERGHEIVPSASLVPND-PTVLLTIAGMLPFK
SYA_SYNP6       MAAPALS---------GDQIRETFLKFFEGKGHRRLPSASLIPED-PTVLLTIAGMLPFK
SYA_PROMP       MKSQTKNT-----PITGDEIRKEFLNFYHEKLHKIIPSASLIPDD-PTVMLTIAGMLPFK
SYA_DEIRA       ----------MTAPLTTAEIRERYLYFFETKGHLRLPSHSTIAPD-PTTLFTVAGMQPFK
SYA_THET8       --------------MRTAEIREKFLSFFEGKGHLRLPSFSLIPEDDPSLLFTSAGMAPLK
SYA_THEMA       -----------MRYMTSEEIREAFLKFFEKKGHKILPSASLIPDD-PQLLFTVAGMVPFK
SYA_RHOBA       --------------MKTDELREKYLAFFETKGCVRQPSDVLVPAWDPSVLFTPAGMNQFK
SYA_FUSNN       -------------MLTGNEIREKFIEFFMQKQHKHFESASLIPD-DPTLLLTVAGMVPFK
SYA_LACAC       -----------MKKLNSSEFRQMFLDFFKEHGHMIMPSASLIPQDDPTLLWINSGVATMK
SYA_STRT2       -----------MKQLTSAQIRQMWLDFWKSKGHAVEPSANLVPVNDPTLLWINSGVATLK
SYA_GEOKA       -----------MKKLTSAQVRRMFLEFFQEKGHAVEPSASLIPVDDPSLLWINSGVATLK
SYA_STAS1       -----------MKNLKASEIRQNFIDYFVEKGHMVEPSAPLVPIDDDSLLWINSGVATLK
SYA_MYCPN       ------------MKWTTDKVRQTWLDYFTAKGHLALPSKSLIPVNDPSLLWINSGVATLK
SYA_MYCGA       ----------MNKHLSGSQIRQIWLDFFKSKKHEIIESKSLVPINDPSLLWINAGVATLK
SYA_MYCPE       ----------MSKKLTTNEIRKLWLDFFKSKNHTEVESKSLIPKNDDSLLWINSGVATLK
SYA_UREPA       -----------MLKLSTNEIRKKWIEFFESKDHLFIEPKSLIPKNDPTLLWINSGVSTLK
SYA_MYCHJ       -----------MEKLSANKIRQLWIDFFRERNHFFIESKPLVPQNDDSLLWINSGVATLK
SYA_MYCMO       --------------MKSKEIRNKWLNFFESKGHLIIPSKSLIPIKDDSLLWINSGVATLK
SYA_MYCPU       -------------MLSSKEIRQKWITFFESKNHLKLESKSLIPVDDPSLLWINSGVATLK
SYA_MYCS5       --------------MNSKEIRKAWLDFFESKNHFIVPPKSLIPVNDNSLLWINSGVATLK
SYA_MYCMS       -----------MKKLSTNQIRKIWLDFFISKNHYFLETVSLIPVDDPSLLWINSGVATLK
SYA_ONYPE       --------------MTSFEIRQMWLKFFASKNHHIAKSSSLIPRNEANLLWVNAGITPLK
SYA_CLOTE       -----------MKNMGLNEIREAYLNFFEGKGHLRMESFSLVPKNDKSLLLINAGMAPLK
SYA_CALS4       -----------MEKLGMNEIREKFLSFFESKGHLRLPSFSLVPKNDKSLLLINSGMAPLK
SYA_LEPIN       -----------MKPKSVSEIREIFLNYFKDKSHNVVPSSSLLPAGDPTLLFTTAGMVQFK
SYA_DEHMC       -------------MFSSDELRENYLKFFEEKGHKRIVSSSLIPHNDPTLLLTTAGMVQFK
SYA_CHLAB       --------------MLSNTLRSNFLKFYANRHHTIVSSSPVFPHNDPSILFTNAGMNQFK
SYA_PARUW       --------------MLTQSIRRQFLEYFKKHQHQIVSSSSVLPHDDPTLLFNNAGMNQFK
SYA_AQUAE       ------------MSLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFK
SYA_CAMJR       -----------------MDIRKAYLDFFASKGHEITPSSPLVP-DDATLLFTNAGMVPFK
SYA_WOLSU       -----------------MDIRKLFLDYFASKGHAVYESMPLVP-DDPTLLFTNAGMVQFK
SYA_HELPJ       -----------------MDIRNEFLQFFQNKGHEIYPSMPLVP-NDATLLFTNAGMVQFK
SYA_BUCAP       ------------MKKTTNEIRQSFLNFFKEKEHVIVPSSSLIPENDSTLLFTNAGMNQFK
SYA_BUCBP       ------------MIYTSNEICQMFLNFFYKKGHTILPGSTLIPNNDPSLLFTNSGMNQFK
SYA_WIGBR       -------------MKKTTEIRNIFLNFFYEKKHKIMDSSTLIPDNDKTLLFTNSGMNQFK
SYA_BLOFL       ------------MYKSIDVVRQEFLDFFHKQEHQVVPSSSLVPKNDQTLLFTNSGMNQFK
SYA_BLOPB       ------------MYKNIDDIRQEFLNFFKKKGHKIISSSTLIPNSDQTLLFTNSGMNQFK
SYA_COXBU       --------------MNSNQLRETFLNYFKQLDHEVVPGSSLIPENDPTLLFTNAGMVQFK
SYA_LEGPL       --------------MKSSEIRQAFLNYFVQRGHQLVASSSLIPSNDPTLLFTNAGMVQFK
SYA_ECOLI       ------------MSKSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFK
SYA_PSYA2       ----------MSQPFRSADIRQAFIDFFISKQHTPVASSSLIPHNDPTLLFTNAGMNQFK
SYA_IDILO       ------------MSMNSAQIRDAFLNYFAERGHEKVPSASMIPGNDPTLLFTNAGMVPFK
SYA_XANOR       --------MNAPAKFSTSQIRSDFLAFFEGRGHTIVPSAPLVPGNDPTLLFTNSGMVQFK
SYA_ACIFR       --------------MQAQAIRQAFLEYFVEQGHQIVPSSPLIPRNDPTLLFTNAGMVPFK
SYA_FRATT       -------------MITTKELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFK
SYA_ZYMMO       -------------MITTNEIRRSFLEYFEKNGHRIVPSAPLVPQNDPTLMFVNAGMVPFK
SYA_RUEPO       -------------MPSLNDIRSTFLNYFAKQGHTIVPSSPLVPRNDPTLMFTNSGMVQFK
SYA_CAUVC       -------------MPSLNEIRSTFLDYFGKADHAVTPSAPLVPQNDPTLLFVNAGMVPFK
SYA_GLUOX       -------------MTSTNDIRSAFLEYFGSQGHRIVPSASLVPQNDPTLLFTNAGMVPFK
SYA_PELUB       -----------MADKTLNQIRTTFLDYFEKNDHKIVESSNLVPNNDPTLMFANSGMVQFK
SYA_RICFE       -----------MTKFTTEEVRSKFITYFKANNHTHVPASSLIPHNDPSLMFVNSGMVQFK
SYA_ANAMM       -----------MSSGSLSSIRKKFLEFFVKNGHKLYASAPLVATGDASLLFTSAGMVPFK
SYA_EHRRW       ----------MIKHNLVSDLRRLFIDFFVKNGHQFFPSSQLVIKDDPSLLFTNAGMVQFK
SYA_WOLTR       --------------MKLNEIRERFIKFFVRNNHKQVFSSPLIPEHDPTLMFTNAGMVQFK
SYA_DESPS       --------------MKGNEIRSRFLEYFKGNGHTVAESSSLVPKDDPTLLFTNAGMVQFK
SYA_GEOSL       --------------MTGKEIRARFLKFFADRGHAVVPSSPLIPHNDPTLLFANAGMNQFK
SYA_DESVH       -------------MITANEIRRRFLEFYKAHGHEAVRSSSLVPKDDPSLLFTNAGMVQFK
SYA_SYMTH       --------------MTSAEIRQKFIDFFKSKGHVHVPSSSLVPHNDPTLLFTNAGMNQFK
SYA_BDEBA       --------------MKSSEIRNAFIKYFEKNGHKVVPSSSLIPENDPTLLFANAGMNQFK
SYA_CHLTE       --------------MNSREIRQSFLDFFAGKEHRIVRSAPVIPAEDPTLLFTNAGMNQFK
SYA_BACFN       -------------MLTAKETRDSFKNFFESKGHQIVPSAPMVIKDDPTLMFTNAGMNQFK
SYAC_HUMAN      ----------MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFK
                                       :  .:             .       :   :*:  : 

SYA_LEIXX       PYLTGIVPAP-------FPR--ATSVQKCIRT----LDIEEVGKTPRHGTFFQMCGNFSF
SYA_CUTAK       PYLMGTEPSP-------WKR--ATSIQKCVRT----LDIDEVGKTTRHGTFFQMLGNFSF
SYA_CORJK       PYFLGQQNPP-------FENGTATSIQKCVRT----LDIDEVGITTRHNTFFQMAGNFSF
SYA_THEFY       PYFLGQRTPP-------YPR--ATSVQKCVRT----IDIDEVGKTTRHASFFQMLGNFSF
SYA_BIFLO       PYLMGEQTPP-------KRR--MASNQKCVRT----LDIDEVGKTTRHGTFFQMLGNFSF
SYA_TROW8       QCFLALEPPP-------HPR--VVSVQKCIRT----SDIDEVGKTPRHGTFFQMMGNFSF
SYA_PROMA       PVFLGHQDRP-------SAR--VTSCQKCIRT----NDIENVGRTARHHTFFEMLGNFSF
SYA_SYNP6       PIFLGQQVAE-------VPR--ATTSQKCIRT----NDIENVGRTARHHTFFEMLGNFSF
SYA_PROMP       PVFLGLKERP-------SKR--ATSSQKCIRT----NDIENVGVTARHHTFFEMLGNFSF
SYA_DEIRA       ENFMGAPAVFDG-----QPSKRVTTAQKCVRV----GDIENVGRTRRHLSLFEMMGNFSF
SYA_THET8       PYFLGAKPIFGG-----REWRRVTTCQECLRV----GDIENVGRTSRHNTYFEMLGNFSF
SYA_THEMA       PIFWGKVEPV---------YTRVATCQKCLRT----VDIENVGKTPRHHTFFEMLGNFSF
SYA_RHOBA       DHFLGKVKLD---------FTRATTCQKCLRT----GDIDNVGRTAFHHTFFEMLGNFSF
SYA_FUSNN       PYFLGQKEAP---------CPRVTTYQKCIRT----NDLENVGRTARHHTFFEMLGNFSF
SYA_LACAC       KYFDGSVVPK---------NRRITSSQKSIRT----NDIENVGKTARHQTFFEMLGNFSV
SYA_STRT2       KYFDGSVIPE---------NPRITNSQKAIRT----NDIENVGKTARHHTMFEMLGNFSV
SYA_GEOKA       KYFDGRIVPENPRICIVPENPRICNAQKSIRT----NDIENVGKTARHHTFFEMLGNFSI
SYA_STAS1       KYFDGRETPR---------KPRIVNSQKAIRT----NDIENVGFTARHHTFFEMLGNFSI
SYA_MYCPN       DYFSAKKTPP---------SKRLANAQICLRV----NDIENVGFTSRHQTLFEMLGNFSI
SYA_MYCGA       KYFSGEENPI---------NPRLANSQRCIRA----NDIENVGVTSRHHTVFEMLGNFSI
SYA_MYCPE       TFFSGKENPP---------SKRLTNSQRCLRT----NDIENVGLTSRHHTFFEMLGNFSI
SYA_UREPA       DYFSGKVKPP---------HKRLVNSQKAIRT----NDIFNVGLTSRHHTFFEMLGNFSI
SYA_MYCHJ       DYFTGKKIPP---------SKRLVNSQKALRT----NDIENVGLTSRHHTLFEMLGNFSI
SYA_MYCMO       DFFSGKKIPP---------SKRLTNSQKSIRT----NDIENVGKTARHHTFFEMLGNFSI
SYA_MYCPU       DYFSGKKTPP---------SPRIVNSQKSIRT----NDIENVGITARHHTFFEMLGNFSI
SYA_MYCS5       DYFSGKKNPP---------SKRMANSQKSIRT----NDIENVGITARHHTFFEMLGNFSI
SYA_MYCMS       PYFDGRKTPP---------SPRLTNSQKAIRT----NDIENVGVTARHHTMFEMLGNFSI
SYA_ONYPE       KYFDGTQTPP---------FRRITNVQKCIRT----NDIKNVGKTSRHHTFFEMLGNFSI
SYA_CLOTE       PYFTGVQTPP---------KSRVTTCQKCIRT----GDIENVGKTSRHGTFFEMLGNFSF
SYA_CALS4       PYFTGKETPP---------SRRVTTCQRCIRT----PDIERVGKTARHATFFEMLGNFSF
SYA_LEPIN       PLFTGAVELP---------YTRATSCQKCLRT----TDLEVVGKTERHCTFFEMLGNFSF
SYA_DEHMC       PYYMGVAKPE---------NPRMASCQKCFRT----TDIESVGDAS-HLTMFEMLGNFSI
SYA_CHLAB       DIFLNKETVS---------YSRATTSQKCIRAGGKHNDLDNVGHTSRHLTFFEMLGNFSF
SYA_PARUW       DVFLGKSYRD---------YNRAATSQKCIRVGGKHNDLENVGHTSRHLTFFEMLGNFSF
SYA_AQUAE       NVFLGLEKRP---------YKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSF
SYA_CAMJR       SIFTGEIPRPN--------PPRKTSCQTCIRAGGKHNDLDNVGYTARHHTFFEMLGNFSF
SYA_WOLSU       DIFTGKVPAPT--------NPRATSCQLCIRAGGKHNDLENVGYTSRHHTLFEMLGNFSF
SYA_HELPJ       DIFTGIVPRPS--------IPRAASSQLCMRAGGKHNDLENVGYTARHHTLFEMLGNFSF
SYA_BUCAP       EYFLGQKKKF---------YPRVTTVQNCLRTGGKHNDLENVGYTKRHHTFFEMLGNFSF
SYA_BUCBP       DIFIQKNYNFK--------YNRVTTLQNCLRTGGKHNDFENVGYTPQHHTFFQMLGNFSF
SYA_WIGBR       DIFLGFKKPK---------YIRVATAQRCIRVGGKHNDLNMIGKTNRHHTFFEMLGNFSF
SYA_BLOFL       DIFLGLVKPS---------YKRVVTAQRCMRAGGKHNDLNNVGYTECHLTFFEMLGNFSF
SYA_BLOPB       NIFLGIDKPL---------FKRVATAQRCVRAGGKHNDLNNVGYTERHLTFFEMLGNFSF
SYA_COXBU       DVFLGVETRP---------YQRAVSIQPCMRAGGKHNDLENVGYTARHHTFFEMLGNFSF
SYA_LEGPL       DLFLGLETRP---------YQRAVTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSF
SYA_ECOLI       DVFLGLDKRN---------YSRATTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSF
SYA_PSYA2       ETFLGMEPRD---------YTRAVTSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSF
SYA_IDILO       DVFLGTDKRR---------YDKATSAQRCLRAGGKHNDLENVGYTARHHTFFEMMGNFSF
SYA_XANOR       DVFLGAEKRS---------YVRAADVQRCLRAGGKHNDLDSVGYTARHHTFFEMLGNWSF
SYA_ACIFR       DVFLGLETRP---------YRRAVSSQRCMRAGGKHNDLENVGYTARHHTFFEMLGNFSF
SYA_FRATT       DVFLGIEKKD---------FSRAVTVQKCLRAGGKHNDLDNVGYTARHHTFFEMLGNFSF
SYA_ZYMMO       NTFTGLE-SRP--------YKTATSSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSF
SYA_RUEPO       NCFTGVD-KRD--------YVRATTAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSF
SYA_CAUVC       NVFTGAE-TPA--------HPRAASSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSF
SYA_GLUOX       NVFTGQE-TRP--------YSRATTAQKVVRAGGKHNDLDNVGYTARHHTFFEMMGNFSF
SYA_PELUB       NIFTGLE-KRD--------YVRATTSQKCVRAGGKHNDLENVGYTPRHHTFFEMLGNFSF
SYA_RICFE       NVFTGQE-KRP--------YNKAVTSQKSLRAGGKHNDLENVGYTARHHTFFEMLGNFSF
SYA_ANAMM       QAFTSGSSVDG--------AKTAVSSQKCLRAGGKHNDLENVGYTNRHHTFFEMLGNFSF
SYA_EHRRW       QRFTSVD-DRS--------INTAVSSQKCLRVGGKHNDLENVGHTNRHHTFFEMLGNFSF
SYA_WOLTR       NIFTGIQ-KTD--------IKRAVSSQKCLRVGGKHNDLENVGYTTRHHTFFEMLGNFSF
SYA_DESPS       RVFMGDDKRG---------YVRAVTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSF
SYA_GEOSL       DCFLGLEKRD---------YVRACSSQKCVRAGGKHNDLENVGRTARHHTFFEMLGNFSF
SYA_DESVH       KIFLGQEKRA---------YSRATTSQKCLRVGGKHNDLENVGRTARHHTFFEMLGNFSF
SYA_SYMTH       DTFLGLEKRE---------YTRAVTAQKCVRAGGKHNDLDEVGFTARHHTFFEMLGNFSF
SYA_BDEBA       NTFLGLEKRD---------YSRAVTAQKCVRAGGKHNDLENVGFTARHHTFFEMVGNFSF
SYA_CHLTE       DVFL-----GKGTR----EYTRAADTQKCIRASGKHNDLEDVGRDTYHHTFFEMLGNWSF
SYA_BACFN       DIIL-----GNHPA----KYHRVADSQKCLRVSGKHNDLEEVGHDTYHHTMFEMLGNWSF
SYAC_HUMAN      PIFLNTIDPSHPMA----KLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSF
                                          *  .*.     *:  :*    * : *:* *.:*.

SYA_LEIXX       GDYFKEQAIAFAWDLLTTAETEGGLGFDPKDLWVTVY---------EEDDEAREIWRRVS
SYA_CUTAK       GDYFKNEAIQYAWELVTKPAEQGGLGFDPASIWVTVLGPGFHPDYPEGDIEAREAWR-AA
SYA_CORJK       GAYFKEGAITHAWTLLTNPVEEGGLGLDPERLWVTVF---------TDDDEAAEIWNKKI
SYA_THEFY       GDYFKEKAIPLAWELLTTSVADGGFGFDPERLWVTVY---------LDDDEAATIWREKV
SYA_BIFLO       GDYFKEEAIHYAWELLTTSQDEGGYGFDPEKLWMTTF---------TDDDEARSMWI-NE
SYA_TROW8       GDYFKKEAIEYAWEFLLSE-----LDLAPDRLWVTIHG---------DDKESEKFWL-LC
SYA_PROMA       GDYFKKEAIQWAWELSINV-----FGLNPSHIVISIFR---------EDDEAEQIWRDVI
SYA_SYNP6       GDYFKKEAIAFAWELVTEV-----FQVPAERLAVSVFE---------EDDEAFAIWRDQI
SYA_PROMP       GDYFKKEAIEWAWELVTDI-----YGLSAENIIVSVFH---------EDDDSVKIWKEDI
SYA_DEIRA       GDYFKRDAIHWAWEFLTGP---EWMGMDKDKMYVTVYK---------DDDEAFGYWTQDI
SYA_THET8       GDYFKKEAILWAWEFLT-----EHLKLDPGRLWVTVFE---------DDDEAYEIWRDLV
SYA_THEMA       GDYFKEEAIEWAWEFLT-----QVLGVPEEKLWVSVYE---------EDEEAFRIWNEKI
SYA_RHOBA       GDYFKEEAIHWAWEFLTDK---KWLGIPGERLTVTVYK---------DDDEAFGIWHDKI
SYA_FUSNN       GNYFKKEAIKWSWEFVTEV-----LKINKDKLWVTVFT---------TDDEAEKIWIEEC
SYA_LACAC       GDYFRDEAIPWAWEFLTSP---KWLGLPKEKLYCTVYP---------KDEDSFNVWVK-A
SYA_STRT2       GDYFRDEAIEWGYELLTSP---EWFDLPKDKLYMTYYP---------DDKDSYNRWIA-C
SYA_GEOKA       GDYFKREAIHWAWEFLTSD---KWIGFDPERLSVTVHP---------EDEEAYNIWRNEI
SYA_STAS1       GDYFKQEAIEFAWEFLTSE---KWMAMEPKLLYVTIHP---------EDKEAYRIWNEDI
SYA_MYCPN       GDYFKEEAIGFANDLLVN-----HYHLDPKRFYITVYQ---------DDELTFNTWLK-H
SYA_MYCGA       GDYFKKEAIEFGYELLTK-----FYGLNKDKLYITIYE---------DDNDAFNYWVG-Q
SYA_MYCPE       GDYFRKEAIEFGAELVFK-----VFKLDPKKIYITVYE---------EDQESFDLWVK-N
SYA_UREPA       GDYFKKEAIDWAYEFLIN-----VLKIDVKKLWVTVFE---------DDQFTNDEWIK-L
SYA_MYCHJ       GDYFKTEAIDYAYEFLTK-----KLKLDPKNLFITYYD---------GDDITFEKWKS-L
SYA_MYCMO       GDYFKKEAINFGFEFIFD-----VLKFDREKIFFTYFS---------EDLETLEILKS-L
SYA_MYCPU       GDYFKKEALAFAKEFVLD-----VLKLEKEKLYFTYYH---------EDLETKQIWLD-L
SYA_MYCS5       GGYFKKEAIEFATEFVLD-----VLKLDRSRLYFTYFH---------DDLETKNLWIS-Q
SYA_MYCMS       GDYFKKEAIELAWELLTDK---KYFDIDKNKLYITVFN---------EDTEAYNIWKDVI
SYA_ONYPE       GNYFKKEAIHYAFELLTSP---KWFAFPLEKLYITYFF---------QDQDTYQYWLD-L
SYA_CLOTE       GDYFKCEVIPWAWEFVTKS-----LNIPKDKLYVTIYL---------DDDEAYDIWTKST
SYA_CALS4       GDYFKKEAIPWAWEFVAEV-----LKLPVDRLWVTIYE---------EDDEAFEIWNKIV
SYA_LEPIN       GDYFKEEAIEYALDCSVNH-----FGFDKNKIWVTVYT---------DDDEAEKIW-LSK
SYA_DEHMC       GNYFKKEAIAWAWEYVTQR-----LNIPAERLWITVYL---------DDDEAIALW-KEQ
SYA_CHLAB       GDYFKEQAIAFAWEVSLSV-----FNFDPDRIYATVHE---------KDDEAFALWEQHL
SYA_PARUW       GDYFKTQAIRFAWEVSTQV-----FGFEPERIWPTVFR---------EDDETFELWTQYV
SYA_AQUAE       GDYFKKEAIEYAWEFVTEV-----LKLPKEKLYVSVYK---------DDEEAYRIWNEHI
SYA_CAMJR       GDYFKEQAIAYAWEFVTEV-----LKLPKDRLYVTVHE---------NDDEAFNLWQKHI
SYA_WOLSU       GDYFKEQAIDHAWEFVTEV-----LGFSKEVLWVTVHE---------SDDEAFELWQKHV
SYA_HELPJ       GDYFKEEAILFAWEFVTKN-----LGFKPKDLYISVHE---------KDDEAVKLWEKFV
SYA_BUCAP       NDYFKKEAITYAWELLTSRK---WFNIDKNKLWISVYE---------DDEETYKIWRDII
SYA_BUCBP       RDYFKLDAILYAWKFLTSKE---QLNLSKEKLWITVYQ---------DDLESYNIWKNII
SYA_WIGBR       GSYFKSDTIQFAWELLTSKK---WFDLSKEKLIVTIYY---------KDIESYNLWVEKT
SYA_BLOFL       GDYFKDDAIQFAWELLTDSN---WFGLSKDKIWVTTHI---------EDDESYNIWVKQV
SYA_BLOPB       GDYFKNEAIQFAWELLTDVN---WFNLSKNKLWVTVHN---------CDGESYDIWSNQI
SYA_COXBU       GDYFKRDAIKFAWDFLTNV-----LKLPPQRLWVTVFQ---------DDFESESIWLKEM
SYA_LEGPL       GDYFKREAIQYAWEFLTEV-----LHIPAERLWVTVYK---------EDLEAEGIWLKEM
SYA_ECOLI       GDYFKHDAIQFAWELLTSEK---WFALPKERLWVTVYE---------SDDEAYEIWEKEV
SYA_PSYA2       GDYFKQAGIGYIWEFLTSDE---WLAIDKNRLYVTIYE---------TDDEAFDIWHKDI
SYA_IDILO       GDYFKKQAIQYAWDFLTKE-----LKLPAEKLWVTVFT---------EDDEAYDIWVKDI
SYA_XANOR       GDYFKKDAIAWAWELLTQI-----WKLPTDRLLVTVYH---------TDEEAFALWRDMI
SYA_ACIFR       GDYFKREVIGFAWRFLTER-----LGLPPEKLWITVYE---------EDDEAADIWMNEI
SYA_FRATT       GDYFKKEAISFAWEFLTKE-----IKLPVEKLWVTIYA---------SDDEAFDVWHKHI
SYA_ZYMMO       GDYFKERVIELAWGLITKE-----WGLDPERLCVTVYH---------TDEEAFNLWRKIA
SYA_RUEPO       GDYFKSEAIPFAWELITRD-----FDIPKDRLYTTVYH---------TDDEAFEIWKKV-
SYA_CAUVC       GDYFKEQAILHAWTLLTAE-----FKLPKDKLLVTVYH---------TDDEAADLWKKIA
SYA_GLUOX       GDYFKPEAIEFAWTLLTRD-----FGLPKDKLLATVYA---------EDEDAADLWKKIA
SYA_PELUB       GDYFKEEAISYAWNLITKE-----FGIDKNRLYVTVYH---------NDEEAFNFWKKIA
SYA_RICFE       GDYFKEQAIYYAWNLLTKE-----FELPKDKLYVTVYH---------TDEEAASYWKKIA
SYA_ANAMM       GDYFKERAIELAWRFVTEE-----MCLSKDRLWITVYS---------EDQEAFDIWKKIT
SYA_EHRRW       GSYFKERAIELAWDFVTKE-----LALDKKRLYITVYH---------DDQDAFNLWKKIS
SYA_WOLTR       GDYFKETAIEFAWKFITEE-----LSLDKNRLSITIYH---------TDDKSYEIWRKVS
SYA_DESPS       GDYFKEEAIRLAWNFLTVE-----LGLPAEKMWVSVFE---------DDDEAFALWEKVE
SYA_GEOSL       GDYFKKEAIAFAWEFLTKD-----LGLDKDRLYVTVYT---------DDDEAADIWHLQE
SYA_DESVH       GDYFKEDAIKFAWKFLTEE-----LKLPKERLYATVFR---------DDDEAEQLWLKHS
SYA_SYMTH       GDYFKEDALAYAWEFITSPE---WLGLPKDRLWVSIYK---------DDEQAFDVWHNKV
SYA_BDEBA       GDYFKKDAIHFAWEFLTKE-----LAIPKEKLYVTVHI---------SDDEAADIWHNQE
SYA_CHLTE       GDYYKKEAIGWAWELMTEV-----WKLPKERLYATVYHD--DEE-------SFKLWQSET
SYA_BACFN       GDYFKKEAISWAWEYLVDV-----LKLNPEHLYATVFEG--SPEEGLERD-NEAASYWEQ
SYAC_HUMAN      GDYFKELACKMALELLTQE-----FGIPIERLYVTYFGG--DEAAGLEADLECKQIWQNL
                  *::                     .    :  :                         

SYA_LEIXX       GLAEERIQGLGKD-------TNYWST-----GQPGPAGPCSEIFFDRGPAYG-IDGG---
SYA_CUTAK       GIPDEQIQGRSLK-------DNYWHM-----GVPGPGGPCSEIYIDRGPAYG-PDGG---
SYA_CORJK       GVPEHKIQRLGME-------DNYWSM-----GIPGPCGPCSEIYYDRGPEHG-QEGG---
SYA_THEFY       GLPEERIQRRGKA-------DNFWSM-----GVPGPCGPCSEIYFDRGPEYG-AEGG---
SYA_BIFLO       GVDPEHIQKMGME-------DNFWTT-----GGPGPGGPCSEIYVDRGPAFG-KEGG---
SYA_TROW8       GVPQERVQ--SLD-------SNFWST-----GKAGPAGPCSEVFYDLHG--G-PGPG---
SYA_PROMA       GVNPRRIIRMDEK-------DNFWSS-----GPTGPCGPCSELYYDFHPELG-EEEI---
SYA_SYNP6       GVPEARIQRLGAK-------DNFWAS-----GPTGPCGPCSEIYYDFHPELG-NDGL---
SYA_PROMP       GIHPKRIIKLGEK-------DNFWSS-----GKTGPCGPCSELYFDFKPEKG-VQNI---
SYA_DEIRA       GLPAEHIHRFDAD-------ENFWPANAPLEGPNGPCGPCSEIYYDRGENYG-DDTWG--
SYA_THET8       GVPEERIGRFGED-------ENYWPGGAITHGPNGPSGPCSEIFYDRGPAYG-TPD-E--
SYA_THEMA       GLPEKRILRMGKE-------DNFWGPA----GPTGPCGPDTEIFYDTGYSKG-CPEGE--
SYA_RHOBA       GLPTQRISRMDED-------ENFWPASAPSEGPDGVCGPCSEIYYQLE------------
SYA_FUSNN       NFPKERIVRMGES-------ENWWSA-----GPTGSCGPCSEIHVDLGIQYG-GDENS--
SYA_LACAC       GMPADHIVK--LE-------DNFWDIG------EGPCGPDTEIFYDRGQENN-DVAEDDP
SYA_STRT2       GVEPSHLIP--IE-------DNFWEIG------AGPSGPDTEIFFDRGEEFD-PDNIGIR
SYA_GEOKA       GLPEERIIR--LE-------GNFWDIG------EGPSGPNTEIFYDRGEAFG-NDPND-P
SYA_STAS1       GLEESRIIR--IE-------GNFWDIG------EGPSGPNTEIFYDRGEDFG-QDDPA-E
SYA_MYCPN       GIPASRIIKCDRD-------RNFWDLG------LGPCGPCTEIYYDRGERFD-PHKVGEK
SYA_MYCGA       GINPHHIIRCDRK-------RNFWDLG------SGPCGPSTEIYYDRGEKYD-PNKLGEK
SYA_MYCPE       GAIKSHILKCDKS-------RNFWEIG------SGPCGPCTEIYYDRGEKYD-FQKLGEK
SYA_UREPA       GIIKEQIIKCNRD-------RNFWDVG------NGPCGPCTEIHYDRGERFD-PNKIGSK
SYA_MYCHJ       GFSNEKLIKGSRK-------TNFWDLG------QGPCGPCSEIYFDRGPKFD-SR--GSE
SYA_MYCMO       NVPDSQIIKGSRK-------TNFWDMG------NGPCGPNLEIFYDRGPKYS-NR--GIE
SYA_MYCPU       GFDPSHLIAGSRK-------TNFWDVG------MGPCGPNTEIFYDRGPKYD-PR--GVE
SYA_MYCS5       GFKEEQLIPGDRK-------TNFWEVG------KGPCGPNTEIFYDRGEKYD-QR--GIE
SYA_MYCMS       KIDEDHIFRLSRK-------TNFWDVG------QGPCGPNTEIFYDRGEIWD-PNKIGPR
SYA_ONYPE       GVEKNHLIP--LK-------SNFWQIG------PGPSGPCTEIFFDRGKTFD-PR--NKE
SYA_CLOTE       DIDPSRIFRLGKE-------DNFWEIG------QGPCGPCSEIHYQREGEK----INSVE
SYA_CALS4       GLPPERIVRMGKE-------DNFWEIG------TGPCGPCSEIYFDRGEEKG---CGKPD
SYA_LEPIN       GIPKERITRLGKK-------DNFWGPAG----DSGACGPCSELYLDRGIEKGGPNCATSG
SYA_DEHMC       GVPENRIVRLGAA-------DNFWGPAG----DSGPCGPCSEIHYDFGQETG----CGKA
SYA_CHLAB       --PSERIFRLTDK-------DNFWSMA-----ETGPCGYCSELLFDRGESFG-----TAT
SYA_PARUW       --PAERITRFGEK-------DNFWAMG-----DTGPCGPCSELLYDRGSDYG-----NAT
SYA_AQUAE       GIPSERIWRLGEE-------DNFWQMG-----DVGPCGPSSEIYVDRGE-----------
SYA_CAMJR       QKE--RIYKFGDK-------DNFWQMG-----DTGPCGPCSEIFYDQGQ-----EHFNSS
SYA_WOLSU       DAS--RIKRMGDK-------DNFWQMG-----DTGACGPCSEIFVDQGE-----EKFHGS
SYA_HELPJ       PVD--RIKKMGDK-------DNFWQMG-----DSGPCGPCSEIYIDQGE-----KHFKGS
SYA_BUCAP       RIPCHHIVKIGSKNNSQYDSENFWQMG-----ETGPCGPCTEIFYNYDD-----SNKSND
SYA_BUCBP       KIDKHKIIKIGNKYNS-SDSDNFWQMG-----EIGPCGPCTEIFYDYGN-----TLPGTI
SYA_WIGBR       NINPKNIIFIKDKNNILYNSDNFWTMG-----DTGPCGPCSEIFYFFGK-----SINYKN
SYA_BLOFL       GISTKRIVKIGNKNSDLYDSDNFWQMG-----NIGPCGPCSEIFYDFGS-----DLKGKP
SYA_BLOPB       DIPNEHIVKIGSNTNDFCDSDNFWQMG-----NIGPCGPCSEIFYDRGD-----RFQGGP
SYA_COXBU       KINPERFSRCGEK-------DNFWQMR-----DTGPCGPCTEIFYDHGP-----TISGGP
SYA_LEGPL       KVSPERFSRCGEK-------DNFWSMG-----DTGPCGPCTEIFYDHGP-----EVAGGP
SYA_ECOLI       GIPRERIIRIGDNKGAPYASDNFWQMG-----DTGPCGPCTEIFYDHGD-----HIWGGP
SYA_PSYA2       GIPSERIIRIGDNKGAPYASDNFWTMG-----DTGPCGPCTEVFYDHGA-----DIEGGL
SYA_IDILO       GVPEDRISRIGEK-------DNFWSMG-----DTGPCGPCSEVFYDHGE-----EVWGGP
SYA_XANOR       GIPESRIVRIGDNKGAPYASDNFWQMA-----DTGPCGPCTEIFFDHGD-----HIAGGP
SYA_ACIFR       GVDPARLSRCGEK-------DNFWSMG-----DTGPCGPCSEIFYDHGP-----HIPGGP
SYA_FRATT       GLAKERIIRIDSS-------DNFWSMG-----DTGPCGPCTEIFYDHGE-----DVAGGL
SYA_ZYMMO       GLPEDRIIKIATS-------DNFWSMG-----DTGPCGPCSEIFYDHGP-----EIPGGP
SYA_RUEPO       GVPESRIIRIATS-------DNFWQMG-----PTGPCGPCTEIFYDHGD-----HIWGGP
SYA_CAUVC       GLGDDRIIRIPTS-------DNFWSMG-----DTGPCGPCSEIFFDHGP-----HIAGGP
SYA_GLUOX       GLSDDRIIRIGTS-------DNFWRMG-----DTGPCGPCSEIFYDHGD-----SVFGGP
SYA_PELUB       GFSDDRIIKIATS-------DNFWSMG-----DTGPCGPCSEIFYDHGD-----HLEGGL
SYA_RICFE       GFRDDRIIRIKTN-------DNFWSMG-----DTGPCGPCSEIFYDHGE-----QIYGGL
SYA_ANAMM       GFPDDRIIKISTS-------DNFWSMG-----DTGPCGPCSEIFYDYGE-----HVQGGP
SYA_EHRRW       SFSDDKIIKIKTN-------DNFWSMG-----NVGPCGPCSEIFYDYGE-----SVKGGL
SYA_WOLTR       GFSNDKIIRIATD-------DNFWSMG-----NIGPCGPCSEIFYDYAK-----PNLQ--
SYA_DESPS       DLPKGRIVRLGEK-------DNFWAMG-----DTGPCGPCSEIHIDQGVGSS--PCDNPN
SYA_GEOSL       GVPRERIYRFGEK-------DNFWAMG-----DTGPCGPCSEIFWDNGP-EV--GCGSPD
SYA_DESVH       DIPAERIYRMGEK-------DNFWSMG-----DTGPCGPCSEILIDQGE-HM--TCG-PD
SYA_SYMTH       GVPADRIVRLGEK-------DNFWRMG-----DTGPCGPCSEIFWDMGPEYA--CDHPDG
SYA_BDEBA       GVPRERIFRFD-K-------DNFWKMG-----DTGPCGPCTEIFYDHGPKAG--TISDPF
SYA_CHLTE       DIEHSHILKFGDK-------DNFWEMG-----ETGPCGPCSEIHIDLTPDG-------SG
SYA_BACFN       YLPKDHIINGNKH-------DNFWEMG-----DTGPCGPCSEIHIDLRPAEE--RAKISG
SYAC_HUMAN      GLDDTKILPGNMK-------DNFWEMG-----DTGPCGPCSEIHYDRIGGR-------DA
                     ..              *:*          *  *   *:                 

SYA_LEIXX       ---PATDDDRYVEIWNLVFMQFLRGEGTGKDDFEILGDLPKKNIDTGLGLERVAFLKQGV
SYA_CUTAK       ---PEADEDRYLEIWNLVFETEDLSAVRAKDDFDIAGPLRSLNIDTGAGLERIAYLLQGV
SYA_CORJK       ---PIVDDTRYIEIWNLVFMENERGEGLGKGNFEIVGKLPKKNIDTGLGIERVACILQDV
SYA_THEFY       ---PVADEDRYLEVWNLVFMQFERGEGSGKEDYPILGELPSKNIDTGMGLERMAAILQGV
SYA_BIFLO       ---PIADENRYIEIWDLVFENYEVDNVKSKTDLHIVGELENKNIDTGAGLERLAYLLQGK
SYA_TROW8       ---PEGDPDRYLEVWNLVFMQNLRDN-----DGHIISSLPKKCVDTGMGLERIAMITQGV
SYA_PROMA       ---DLEDDTRFIEFYNLVFMQYNRNSS------GTLTSLANCNIDTGMGLERMAQILQGV
SYA_SYNP6       ---DLEDDSRFIEVYNLVFMQYNRDAA------GNLTALEKQNIDTGMGLERMAQVLQGV
SYA_PROMP       ---DLEDGDRFIEFYNLVFMQYNRDPD------GQLTDLKYKNIDTGMGLERMAQILQKK
SYA_DEIRA       DYYQTRESARFLEVWNLVFPQYDRQDLDA-SGQPVLKDLPFKNIDTGMGLERVASVVQDV
SYA_THET8       TGPNTGSGDRFVEIWNLVFTQYDRQ-GPI-PGPGILKPLPQKNIDTGMGLYRVAAILQDV
SYA_THEMA       GCTPANSEGRFVEIWNLVFTEYYQD------EEGKLHPLPRKNIDTGAGLERFCAMMQGV
SYA_RHOBA       ----DGSD---VEIWNLVFTQFNRVGTP----PDNLHPLPSKNIDTGMGLERTASVLQGV
SYA_FUSNN       KIGDEGTDNRFIEIWNLVFTEWNRMED------GSLEPLPKKNIDTGAGLERIAAVVQGK
SYA_LACAC       ENFPGGENARYLEIWNIVFSQYNH---L---PNGKYVDQPHKNIDTGMGLERVLSILQDA
SYA_STRT2       LLEEDIENDRYIEIWNIVLSQFNADPAV---PRSEYKELPNKNIDTGAGLERLAAVMQGA
SYA_GEOKA       ELYPGGENDRYLEVWNLVFSQFNHN------PDGTYTPLPKKNIDTGMGLERMCSILQDV
SYA_STAS1       EMYPGGENERFLEVWNLVFSEFNHN------KDHTYTPLPNKNIDTGMGLERMASLAQNV
SYA_MYCPN       LFFEDIENDRYVEVWNIVFSQFNNDGN------GNYSELAQKNIDTGAGIERLVAILQDA
SYA_MYCGA       LFFEDIENDRYIEVWNIVFSQFNNTGN------NNYTELLRKNIDTGASLERFACILQDV
SYA_MYCPE       LFFEDIENDRYIEIWNIVFSEFNNDGK------NNYTKLARQNIDTGAGLERLACILQDV
SYA_UREPA       LILEDIENDRYVEIWNIVFSQFNNDGH------NNYTELLQKNIDTGAGLERIACISQDV
SYA_MYCHJ       LIKNEIENDRFIEIWNIVFSEFNNDGQ------QNYTPLKSKNIDTGAGFERIVSILQDG
SYA_MYCMO       LLKNDIENDRYIEIWNIVFSQFNNDGN------GNYELLKQKNIDTGAGLERLACILQDT
SYA_MYCPU       LLKEDIENDRYIEIWNIVFSTFNNDGK------NNYSELKLKNIDTGAGFERIVSILQNA
SYA_MYCS5       LLKNDIENDRYIEIWNIVFSTYNSDGE------GNYTELNQKNIDTGAGLERIVSILQDA
SYA_MYCMS       LISDDIENDRYIEVWNIVFSQFNNDGN------NNYVELPRKNIDTGAGLERFASIFQNT
SYA_ONYPE       LIIQDLENDRFIEIWNIVFSQYNCDPKL---PIEKYQELPSKNIDTGAGLERLACILQNT
SYA_CLOTE       EFIKKSDDDEVIEFWNLVFTQFDKDEN------ENYNRLAHPNIDTGMGLERMATIMQGV
SYA_CALS4       CGIGCDDCDRYVEFWNLVFTQFNKDEQ------GNYHRLPNPNIDTGMGLERIAAIMQGV
SYA_LEPIN       TCKPGCDCDRFLEFWNIVFNQFNQDTE------GNLHPLKQTGIDTGSGLERVALLLQEV
SYA_DEHMC       DCNPSCKCGRFCEIWNLVFVQFNQDKS------GKRQNLPAPSIDTGMGLERLTILMQSK
SYA_CHLAB       SPLEDSEGERFLEYWNLVFMEFNRSAE------GSLLALPNKHVDTGAGLERLVSIISGT
SYA_PARUW       KPSEDSSGERFLEFWNLVFMQFNRQTS------GVQNPLPKPSIDTGAGLERVINLKMGV
SYA_AQUAE       ---EYEGDERYLEIWNLVFMQYNRDEN------GVLTPLPHPNIDTGMGLERIASVLQGK
SYA_CAMJR       EDYMGGDGDRFLEIWNLVFMQYERS------ADGVLSPLPKPSIDTGMGLERVTAIKEGK
SYA_WOLSU       EDYFGGDGDRFLEIWNLVFMQYERS------SDGTLTPLPKPSIDTGMGLERVAALKEGK
SYA_HELPJ       EDYFGGEGDRFLEIWNLVFMQYERS------NDGVLSPLPKPSIDTGMGLERVQALLEHK
SYA_BUCAP       FLKD--KNESFIEIWNIVFIEFNRI------SKTKIVPLINKSIDTGMGLERISAVLQNV
SYA_BUCBP       PGNNGCNVPRFVEIWNIVFIQFNKL------SNGKLIKLTESYVDTGMGLERISAVINNV
SYA_WIGBR       IKIY---DEEYIEIWNLVFMQFNLH------LNGKLSRLPITSIDTGMGLERISCVLQKV
SYA_BLOFL       PGYMQGLGSRYIEIWNLVFMQFNRQ------LNDRLIDLPMLSVDTGMGLERITAILQGV
SYA_BLOPB       PGSLEEFGERYVEIWNLVFIQFDRQ------ENGRLLSLPMLSVDTGMGLERITSILQGV
SYA_COXBU       PGSAEADGDRYVEIWNLVFMQYNRD------AKGNLLPLAKPSVDTGMGLERLAAVMQGV
SYA_LEGPL       PGSPDEDGDRYIEIWNLVFMQFNRD------REGCLHPLPKPSVDTGMGLERLAAVIQGV
SYA_ECOLI       PGSPEEDGDRYIEIWNIVFMQFNRQ------ADGTMEPLPKPSVDTGMGLERIAAVLQHV
SYA_PSYA2       PGTPEEDGDRYIEIWNCVFMQFNRQ------KDGTMLPLPAPSVDTGMGLERISAIMQGV
SYA_IDILO       PGTPEEDGDRYIEIWNLVFMQYNRQ------ADGTLEPLPDPSIDTGMGLERISAIMQNV
SYA_XANOR       PGSPDEDGDRFIEIWNLVFMQFDRQ------PDGTLVPLPAPCVDTGMGLERLAAILQHV
SYA_ACIFR       PGSPEEDGDRYIEIWNLVFMQFDRD------SSGTLTPLPKPSVDTGMGLERLAAVLQGV
SYA_FRATT       PGTPEQDGDRYIEIWNIVFMQYNRH------ADGSTTDLPKPSVDTGMGLERISAVLQNV
SYA_ZYMMO       PGSPDEDGDRFVEIWNLVFMQYEQV------NAETRLNLPRPSIDTGMGLERIASVLQGV
SYA_RUEPO       PGSPEEDGDRFIEIWNIVFMQNEKF------EDGSMVDLDMQSIDTGMGLERIGALLQGS
SYA_CAUVC       PGSPDEDGDRFIEIWNLVFMQFEQL------AGGERISLPKPSIDTGMGLERIAAVLQGQ
SYA_GLUOX       PGSPDEDGDRFVEIWNLVFMQFLDQ------PDGSRDALPRPSIDTGMGLERFAAIMQGK
SYA_PELUB       PGTKNEDGNRFIEIWNLVFMQYEQI------SKDKRINLPKPSVDTGMGLERIAALLQGT
SYA_RICFE       PGTKDEDGDRFIEIWNMVFMQYEQI------DKDTRIELPQKSIDTGMGLERMTAVLQHV
SYA_ANAMM       PGSKDADGPRFTEVWNLVFMQFCRD------EHGELNPLPHKCIDTGMGLERAAAVVQGV
SYA_EHRRW       PGTPEEDGARFTEIWNLVFMEYNRT------EEGELSVLPRKCIDTGMGLERIAAVMQGV
SYA_WOLTR       ------NDDRIVEIWNLVFMEFNKD------EEGNLQKLPKKCIDTGMGLERVAAVMQNV
SYA_DESPS       CAVG-CDCDRFLELWNLVFMQFNRA------EDGSLTALPRPSIDTGMGLERVAAVLQGK
SYA_GEOSL       CAVG-CDCDRYMEIWNNVFMQFNRS------ADGVLTPLPKPSVDTGMGLERISTVMQGV
SYA_DESVH       CGIGKCDCDRFLEIWNLVFMQYDQD------ATGKREPLPKPSIDTGMGLERITAVCQGV
SYA_SYMTH       CRIDTCGCDRWREFWNNVFMQYNQT------PEG-LVPLERTGVDTGLGLERMATIMQGV
SYA_BDEBA       KGIE-AGEDRFVEIWNLVFMQYFEN------PPGTLTPLPKPSVDTGGGLERMSAAMQGV
SYA_CHLTE       GPLVNVGDHRVIELWNLVFIQYDRQAD------GTLVPLPQKHVDTGMGFERVAAVLQGK
SYA_BACFN       RDLVNHDHPQVIEIWNLVFMQYNRKAD------STLEPLPAKVIDTGMGFERLCMALQGK
SYAC_HUMAN      AHLVNQDDPNVLEIWNLVFIQYNREAD------GILKPLPKKSIDTGMGLERLVSVLQNK
                            * :: *:                        :*** .: *        

SYA_LEIXX       ENMYEIDQVRPVLDRAAELAG------------KPYGNEAHEDDV---------------
SYA_CUTAK       DNMYETDQVFPVIEKASEMSG------------KRYG-ARHDDDV---------------
SYA_CORJK       DNVYETDLLRPVIDVAQEVTG------------AKYG-ADQANDV---------------
SYA_THEFY       DNIYETDTLGRILRRAAELTG------------TTYG-ENERADV---------------
SYA_BIFLO       NNIYETDEVFPVIEAAEQLSG------------LKYG-ENEDADV---------------
SYA_TROW8       GTIYDTDELKPILDEAGYISG------------KRYG-KDRRDDI---------------
SYA_PROMA       ANNYETDLIYPLLEKIASLID------------VQYEDLNATIKA---------------
SYA_SYNP6       PNNYETDLIFPIIQAVAAIAQ------------RDYASESESVKV---------------
SYA_PROMP       KNNYETDLIFPIIQKASEISK------------IDYYSSGERTKI---------------
SYA_DEIRA       PDFYSNDVFKPIVERVAELSG------------KPYEG--ETS-V---------------
SYA_THET8       EDFYRTDTFFPIIQEVARMSG------------RPYEG--KTS-V---------------
SYA_THEMA       YSNFDTDLFQPIIKRIEELTG------------VGYKTDEEKD-V---------------
SYA_RHOBA       PTNFHIDSLFPIVEAASEVCG------------VKYEYESDNG-R---------------
SYA_FUSNN       TNNFETDLLFPILEEAGKITG------------SQYGKNPETN-F---------------
SYA_LACAC       PTNFETDLFLPIIHATEEMTD------------GKKYGENDEDTT---------------
SYA_STRT2       KTNFETDLFMPIIREIEKMS-------------GKAYDPDGE-TL---------------
SYA_GEOKA       PTNFETDLFLPIIRATEQIA-------------GERYGEDPDKDV---------------
SYA_STAS1       RTNYETDLFMPIIHEVEKVS-------------GKTYLENDNYDV---------------
SYA_MYCPN       PTNFDTDIFLKLIGIIEQHCK--HKYDTNLYFKFDQKLNE--AQS---------------
SYA_MYCGA       PTNYDTDLYLPIIRTIEKHTN--HKYVVDHYFSKDQSEQD--VLR---------------
SYA_MYCPE       PTNYDTDAFVNVRSVIEKYSN--KKYDNNLYFESKKDSEKVFINK---------------
SYA_UREPA       PTNFDSDVFMRITKSVEQFSE--YKYDMNEYFHPNVTQNK--INF---------------
SYA_MYCHJ       PTNYDTDLFLPIIAEIEKNTV--FRYKIENYFLKEPRQTQ--INK---------------
SYA_MYCMO       PTNFETDLFLPIIKEIEKLSI--YKYKIDNYFLKDKIQEK--INL---------------
SYA_MYCPU       PTNYDTDLFLPIIRAIEKLTN--KKYVVENYFQNEPVQRE--INT---------------
SYA_MYCS5       PTNFDTDLFLPIIHEIEKYTS--YRYKIENYFIKDKAQKE--INS---------------
SYA_MYCMS       PTNFETDIFYPTIKKVEQLTNNQFKYSIDNYFNPNKKQTR--INT---------------
SYA_ONYPE       KTNFETDLFFPLIKALEKMTQ-----------IKYTGQES--------------------
SYA_CLOTE       NSIFEVDTIKAVLDEISEIAN------------IKYGENKEKDIS---------------
SYA_CALS4       DTIFDVDVIRGIRDFISDLAE------------VEYGKDADKDVS---------------
SYA_LEPIN       DSVYDTNELRKIISFYEELSG------------ISYEDKTLSEISEKKNNNQQISSQVRN
SYA_DEHMC       KNVYETDIFAPIVEKACLLSG------------RKYGCDAATDRA---------------
SYA_CHLAB       NTVFEADVLRLLISKTETLSG------------EKYHADEPLGAA---------------
SYA_PARUW       NSVFETDILRSIIAQIELLSG------------IAYHPQDQQSAA---------------
SYA_AQUAE       NSNFEIDIIFPLIQFGEEVSG------------KKYGEKFETDVA---------------
SYA_CAMJR       FSNFDSSLFMPIINEISKLCN------------KTYVYESG-------------------
SYA_WOLSU       SSNFDSSLFMPMIRKVEELTG------------KPYHYESG-------------------
SYA_HELPJ       LNNFDSSLFAPLMEEISELTG------------LDYASEFQ-------------------
SYA_BUCAP       HSNYKIDIFQKLIQKISNFTE------------IKDLN-NI-------------------
SYA_BUCBP       TSNYEIDLFKPLIKHILELST------------VNTPK-NK-------------------
SYA_WIGBR       NSNYSIDLFKKLIYEISKIIE------------IKNIK-NY-------------------
SYA_BLOFL       HSNYLIDVFKNLIVDISNIMK------------VKEYINNR-------------------
SYA_BLOPB       NSNFSIDVFKKLISSISRIMK------------INDIYINR-------------------
SYA_COXBU       HDNYDIDLFQYLLKALRTLLK------------TEDLHNT--------------------
SYA_LEGPL       HSNYEIDSFQYLIKAIAQLGQ------------DIDLNHT--------------------
SYA_ECOLI       NSNYDIDLFRTLIQAVAKVTG------------ATDLSNK--------------------
SYA_PSYA2       HGNYEIDLFVHLMDAAAEILE------------IENQQQS--------------------
SYA_IDILO       HSNYEIDLFQALIKAAAEIIG------------TNDLDNK--------------------
SYA_XANOR       HTNYEIDLFQALIGKASALTG------------ITDLENK--------------------
SYA_ACIFR       HNNYDTDLFKPLIAAAAAISG------------KTYGSDAAT------------------
SYA_FRATT       HSNYEIDLFQALIKKAQQVTH------------AKDINSP--------------------
SYA_ZYMMO       HDNYDTDTFKALIAASGELTH------------TATDGQF--------------------
SYA_RUEPO       HDNYDTDLFKALIEASADATS------------VDPYGDQ--------------------
SYA_CAUVC       HDNYDIDLFKALIAASVELTG------------VKAEGAQ--------------------
SYA_GLUOX       RDNYDTDTMRALIEASAEIMH------------QDADGPF--------------------
SYA_PELUB       HDNYETDHFKKLILSASDTLN------------VKVTDDN--------------------
SYA_RICFE       NNNYDIDLFQEIINFTENIVK------------VKIEGEA--------------------
SYA_ANAMM       CDNYDTDLFKAVIRKSQDVFG------------SPDN-----------------------
SYA_EHRRW       HDNYDINLFKALIAMSKKESG------------NSSC-----------------------
SYA_WOLTR       YDNYDIDLFSALISKSQEYCG------------NVEN-----------------------
SYA_DESPS       FNNYDSDLFAPIIAVLEDISG------------VKYGAA---------------------
SYA_GEOSL       KSNYDTDLFQGIIGHVEKLSG------------KRYRHS---------------------
SYA_DESVH       FSNFDTDIFQAIIQYTCGLAN------------VSYRSD---------------------
SYA_SYMTH       WSNWDIDLWQPIFARIHELSG------------KKYEGE---------------------
SYA_BDEBA       FNNYDTDLFQPMIQLACKIGN------------IEYISDKEVLAKN--------------
SYA_CHLTE       SSNYDSDVFAPLFDRITELTGTVYT----------ASLDS--------------------
SYA_BACFN       TSNYDTDVFQPLIKAIAQMAGTEYG----------KNEQ---------------------
SYAC_HUMAN      MSNYDTDLFVPYFEAIQKGTGARPYTG-----KVGAEDAD--------------------
                   :  .                                                     

SYA_LEIXX       -----------RLRVVADHVRSALMLMTDGVTPSNEGRGYVLRRLLRRTVRAMWLL-GVE
SYA_CUTAK       -----------RLRVVADHVRSGLMLMTDGVTPGNEARGYVLRRLLRRVVRAMRLL-GVA
SYA_CORJK       -----------RFRVIADHSRTGLMLMLDGVTPGNEGRGYILRRLLRRIIRSARLL-GAT
SYA_THEFY       -----------SLRVIADHVRTATMLVADGVRPGNEKRGYVLRRILRRSIRNLRLLSGDE
SYA_BIFLO       -----------RFRVVADHVRSALMIMSDGVRPSNVGRGYVLRRLLRRTVRSMRML-GVT
SYA_TROW8       -----------SLRVLADHIRSSLMLVADGLRPSNEGRGYILRRLLRRSVRAAKLL-GIQ
SYA_PROMA       -----------SFKVIGDHTRACVHLIGDGVSASNLGRGYVLRRLLRRVVRHGRLI-GIT
SYA_SYNP6       -----------SLKVIGDHLRAVTHLIADGVTASNLGRGYVLRRLIRRVVRHGRLI-GID
SYA_PROMP       -----------SLKIIGDHIRAVIHLISDGVIASNLGRGYILRRLIRRMVRHGRLL-GLK
SYA_DEIRA       -----------SHRVVAEHIRSVSMIVADGTAFSNTGRGYTARKIMRRAIRHGYML-GLR
SYA_THET8       -----------SHRVIADHVRAVVAALSDGATFSNTGRGYVIRRLLRRALRHGYLL-GLS
SYA_THEMA       -----------SIRVIADHIRAITFLISEGVFPSNEGRGYVLRRIIRRAMRHGILL-GMS
SYA_RHOBA       -----------RLRRITDHARASVFAVHENVYPGPKDARSVIRRLIRRAVLDGYQM-NLR
SYA_FUSNN       -----------SLKVITDHARAVTFLVNDGVIPSNEGRGYILRRILRRAVRHGRLL-GYK
SYA_LACAC       -----------AFKIIADHVRAVSFAIADGALPSNSGRGYVLRRLIRRADLNGQRLGIKG
SYA_STRT2       -----------SFKVIADHIRSLAFAIGDGALPGNEGRGYVLRRLLRRAVMHGRRLGISD
SYA_GEOKA       -----------AFKVIADHIRAVTFAIGDGALPSNEGRGYVLRRLLRRAVRYAKHIGIDR
SYA_STAS1       -----------AFKVIADHIRTIAFAIADGALPANEGRGYVLRRLLRRAVRFSQSLDINE
SYA_MYCPN       -----------AFRIISDHFKAITFTIAEGVLPGPNERSYIVRRLLRRALLACKKLDLDL
SYA_MYCGA       -----------AFRVIADHLKCGVFAIADGVLPGAKDRDYIIRKLLRRAFVYAKKLNAKP
SYA_MYCPE       -----------CFSVIIDHFKAVIFAISDGALPSNKDRGYILRKLLRRSFLYLNYLKVSF
SYA_UREPA       -----------AYKVIADHMRATVFAIADGAIPSNKERGYILRRLIRRTMVLVRRLNINN
SYA_MYCHJ       -----------SFRIIADHIRAITLAINDGVQPSNLHRGYIIRRLIRRAYWNGKELGI-S
SYA_MYCMO       -----------NFKIISDHLRTAVNAINDGAKPSNNGRGYIIRRLIRRAYRSGIFLGIKG
SYA_MYCPU       -----------YFKIIADHMRSVANAIGDGAGVSNVGRDYIIRRLIRRAYRTGIQLGIKD
SYA_MYCS5       -----------YFKIIADHMRTVVNAIADGEKPSNLSRGYILRRLIRRSYYKAIQLKITK
SYA_MYCMS       -----------AFKVIADHIRATVFAISDGVFPGNKDRGYIIRRLIRRSCVFGKELGIKQ
SYA_ONYPE       ------------FKIIADHLKTLVFAINDGAVLTNEKRGYVLKKLLRRAANEGKKLGLDK
SYA_CLOTE       ------------LRVITDHVRSVTFMISDGILPSNEGRGYVLRRLLRRASRHGKLL-GIK
SYA_CALS4       ------------IRVITDHIRGITFMISDGILPSNEGRGYVLRRLLRRAARHGKLL-GLN
SYA_LEPIN       ETKSIQDSRKTAFRVVTDHIRSVLFSIGDGIYPDRTGRGYVIRRLIRRATLFGRKL-NFK
SYA_DEHMC       ------------LRIVSEHSRGITFLIADGVIPDKAGRGYVLRRLLRRAVLFGRRL-GLE
SYA_CHLAB       ------------FRVIADHVRSLSFAIVDGLIPGNTERGYVLRKILRRSVNYGKRL-GFT
SYA_PARUW       ------------FRVIADHLRCLSFAIADGVQPSNVDRGYVLRKVLRRAVRYGRTL-KLE
SYA_AQUAE       ------------LRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKL-GIE
SYA_CAMJR       ----------ASFRVIADHIRSSVFLLAQGVSFDKEGRGYVLRRILRRALRHGYLLGFKQ
SYA_WOLSU       ----------ASYRVIADHIRSICFLLAQGVNFDKEGRGYVLRRILRRAVRHGYLLGLNA
SYA_HELPJ       ----------PSFRVVADHARAVAFLLAQEVHFNKEGRGYVLRRILRRALRHGYLMGLKE
SYA_BUCAP       -----------SLKIIADHIRSCAFLIAENILPSNEHRGYVLRRIIRRALRHGHKIGIKN
SYA_BUCBP       -----------SIYVIADHIRACSFIISENIIPSNEKHGYVLRRIIRRAIRHGHNLGIKS
SYA_WIGBR       -----------SLRIIADHIRSAIFLIYDGVIPSKEGRGYVLRRIIRRAIFHGNYILNKS
SYA_BLOFL       -----------SLYVIADHIRACVFLIKDGVVPSNEGQGYVLRRIIRRSVRHGRKLGVND
SYA_BLOPB       -----------SVYVIADHIRACSFLIQDGVLPANEGRGYVLRRIIRRAILHGKKLGVND
SYA_COXBU       -----------SMRVIVDHIRSVAFLIADGVIPSNEGRGYVLRRIIRRAVRHGYKLGQEE
SYA_LEGPL       -----------SLKVIADHIRSCSFLIVDGVLPSNEGRGYVLRRIIRRAVRHGNKLGLPS
SYA_ECOLI       -----------SLRVIADHIRSCAFLIADGVMPSNENRGYVLRRIIRRAVRHGNMLGAKE
SYA_PSYA2       -----------SLKVIADHIRAVSFLIADGVTPSNEGRGYVLRRVIRRAVRHGNKLGADS
SYA_IDILO       -----------SLRVIADHIRSCSFLITDGVMPSNEGRGYVLRRIIRRAVRHGHLLGAKD
SYA_XANOR       -----------SLRVIADHIRACSFLIVDGVLPSNEGRGYVLRRIIRRALRHGWMLGVRQ
SYA_ACIFR       ---------DISLRVLADHIRACSFLITDGVLPANEGRGYVLRRIIRRAVRHGRKLGMET
SYA_FRATT       -----------SLKVIADHIRACAFLIADGVLPANEGRGYVLRRIIRRAIRHGNKVGAKE
SYA_ZYMMO       ---------KASHRVIADHLRAAGFLVADGVLPANEGRGYVLRRIMRRAMRHAHLIGAKE
SYA_RUEPO       ---------NVHHRVIADHLRSTSFLIADGVMPSNDGRGYVLRRIMRRAMRHAHLLGAKD
SYA_CAUVC       ---------APSHRVIADHLRSSSFLLADGVSPSNEGRGYVLRRIMRRAMRHAYLLGASE
SYA_GLUOX       ---------KASHRVVADHLRSTAFLIADGVLPSKEGRGYVLRRIMRRAMRHLHIMGAKE
SYA_PELUB       ---------QSSFRVIADHLRASSFLLAEGVLPSNEGRGYVLRRIMRRGMRHSHLLGSKK
SYA_RICFE       ---------KFSYRVIADHLRASSFLIADGVIPSNEGRGYVLRRIMRRAMRHAHMLGSKE
SYA_ANAMM       ---------SIAHRVIADHIRAAAFLISEGLSPGNEGRNYVLRRIIRRAVRYAYQLDPSN
SYA_EHRRW       ---------EIAHRVIADHVRSAAFLIAEGLTPGNEGRDYILRRIIRRAARYVYMLKYTD
SYA_WOLTR       ---------KAAHKIIADHLRAAAFLIAEGVLPGNEGRNYILRRLIRRAVRYIHQLGYND
SYA_DESPS       ------ADTDTAIRVIADHARATSFLVADGVLPSNEGRGYVLRRIMRRAVRYGKKLGLEK
SYA_GEOSL       ------EKDDVSMRVMADHVRATTFLICDGVLPSNEGRGYVLRRIMRRAARHAKMLGFAE
SYA_DESVH       ------DETDTALRVIADHSRAIAFMITDGILPSNEGRGYVLRRLIRRAYRFGRLIGLTD
SYA_SYMTH       ------GPEAVAFRVIADHARCCTFLIADGVRFSNEGRGYVMRRILRRAVRFGRVLGFAE
SYA_BDEBA       ---PAAAEVTSALRVLADHCRSTSFLIADGALPSNEGRGYVLRRIMRRAIRYGRKLSADK
SYA_CHLTE       -------PSDIAMRVIADHCRTLTFALSDGAMPGNEGRGYVLRRILRRAVRYAGT-LGCH
SYA_BACFN       --------NDIAMRVIADHIRTIAFSITDGQLPSNAKAGYVIRRILRRAVRYGYTFLGQK
SYAC_HUMAN      -------GIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNAS
                               : :* :     : :             ::::**            

SYA_LEIXX       AATFPALFPVSRD----AMKAAYPEVET--EFARTSQLAYAEEETFLRTLVAGTSILDTA
SYA_CUTAK       DPVLPELLSVSRD----LMADSFPDVLT--QWDRVIGAATAEEDTFRRTLSSGTAMLDAA
SYA_CORJK       GETLEKFMDTVRE----TMTPSYPEIAE--NYERIRAVALAEEKSFLKTLESGSQMFDNW
SYA_THEFY       SFHMHDLTAVAID----AMGDQYPELRA--DADKIHSIIDAEEKNFADTLRAGTTLFNRA
SYA_BIFLO       DPVLPTLFPTSKA----AMEASYPELND--TFHEVSESAYGEEDAFRRTLETGTTILDVA
SYA_TROW8       ENCFDQLFAKAAQ----VMKVGYPELEG--KLAEIKQVACLEEQSFSRALNAGTQLLSRS
SYA_PROMA       KPFLVQIAEVAIE----LMQSAYPQLLE--RRQLIFKELQREETRFLETLEKGEKLLAEL
SYA_SYNP6       RPFTAEIAETAIA----LMAAQYPNLRE--REAAIKAELTREEQRFLETLERGEKLLAEL
SYA_PROMP       NEFLSKLASVGIK----LMQENYPDLKN--NCDHILSEIKIEEIRFRETLERGEKLLDEL
SYA_DEIRA       EPQLYRLVELVVD----SMGGAYPELQH--NQSRVEASVRAEEEQFLKTLEGGIKRLGGL
SYA_THET8       DPFLHRLAPLVAE----LLGDFYPEMRE--NLPAVEKQIRLEEERFLETLEGGLKRLDAL
SYA_THEMA       EPFLYRIVDAVVE----KMGKVYPEIVR--GEGMVKEVLSAEENRFLKTLEQGMKVFDEI
SYA_RHOBA       EPFLYKLVEAVAD----ASKAAYPELGQ--TTQRVSEAIESEEKAFFSTIDGGMKRIHRL
SYA_FUSNN       DLFMYKMVDKVVE----KFEIAYPDLRK--NVENIRKIVKIEEEKFSNTLDQGIQLVNQE
SYA_LACAC       AF-LYKLVPVVGK----IMESHYPEIMD--QRGFIENVIQNEEERFQSTLDTGLTLLDDL
SYA_STRT2       AF-LYKLVPTVGQ----IMESYYPEVLE--KRDFIEKIVKREEETFARTIDAGSSMLDEL
SYA_GEOKA       PF-MYELVPVVGE----IMHDYYPEVKE--KADFIARVIRTEEERFHETLHEGLAILAEV
SYA_STAS1       PF-MYRLVDIVAD----IMEPYYPNVKE--KADFIKRVIKSEEERFHETLEEGLAILNNL
SYA_MYCPN       KF-IDPMVDAIIS----VYGSYYQQLQG--KNQVVQQAIWKEVTAFDKTINLGLMLFEKS
SYA_MYCGA       EY-LVETINVIIN----TYSDFFKYLIP--NKEIVIQAITNEANNFTKTLDYGFEIFNEA
SYA_MYCPE       EN-SKEIINTIIS----NNETYYPYLKE--NLNNVINTIKLEYDLYCESINNSFKKLNEL
SYA_UREPA       LLWVDAVVDAIAS----TMGDFYTYLKDEKTLTKIKMILNKEVQLFEKTLQLGLNIFENS
SYA_MYCHJ       HPFLYKLVEIVGK----TLDYRFD-------IPTISKIILNEEENFAKTLEIGYNLLESQ
SYA_MYCMO       KSFLHKMTQIVRD----SLIYDID-------VEKVSKIIKKEEEMFSKTISEGINLLKEK
SYA_MYCPU       EAFLYKLVPVIKD----SLIFDYD-------TKHVAKVIKDEELLFSKTIDQGKKILEKE
SYA_MYCS5       SPFLYKLVDVIKA----SLPFEYD-------SKKVAEVIKEEEVLFSQTISKGKEILEKF
SYA_MYCMS       AF-LYKLVDSVIE----SMKEFYPYLID--KKTLVEQTIKDEEEKFLKTLSKGYDLLENI
SYA_ONYPE       PF-LHQLVPPTAA----MMKDFYKELCT--NQEIIAKVLLQQENIFEQTLKTAEKTFLQH
SYA_CLOTE       GNFLYKVCKVVIE----NSHKAYKELKE--KEEYIKKIIKLEEERFAETIDGGIQILNEY
SYA_CALS4       DAFLYKVVDSVVE----NYGGAYPEIIE--RKDYIKKIIKLEEERFKETVDQGLAILQDY
SYA_LEPIN       EPFLYKLVDKVIE----IYKARYPELQR--NAAAITKTILVEEELFLKTLELGLEKIESL
SYA_DEHMC       RPFLVDMAGAVIN----RMSGIYPELKK--RQTYVLEMIASEEARFSETLATGLELLEEI
SYA_CHLAB       QPFLAEIVPALVD----AMGEAYPELRL--SVSQIQEVMTIEEENYFKSLHRGGNLLQQV
SYA_PARUW       KPFLAEVLPQLVS----TMGSDYPELVK--GQDRIAEILTIEEEAFIRTLKRGGNILNQV
SYA_AQUAE       NPFLYKGVDLVVD----IMKEPYPELEL--SREFVKGIVKGEEKRFIKTLKAGMEYIQEV
SYA_CAMJR       AFMYKLVDIVCDL-----MGGHYTYLNE--KKDFIKEQIRLEEERFLSTIENGIEIFNEE
SYA_WOLSU       PFLHEVAEVVCGQ-----MGDHYGYLKE--KREHIKRLTFQEEERFFATIAGGMEVFKKE
SYA_HELPJ       AFLYKVVGVVCEQ-----FSNVHAYLKE--SKEMVMKECFEEEERFLETLESGMELFNLS
SYA_BUCAP       NFFYKLVPSLIEI-----MGDSAKILRK--KEKIIEETLKIEEIQFSQTLDKGLKILNAE
SYA_BUCBP       LFLHKLIPTLINT-----MGKFNPVLKK--QQNKIENVLKLEEQKFIETLEKGLKLLHKE
SYA_WIGBR       CFFYKLVSPAINI-----MSYIDSKIIK--KKKEIENIIKEEEKIFFFSIKKGMIFLNKN
SYA_BLOFL       IFLYKLVNLVIVH-----MNYVSNILYD--QKDLIEQILFNEEKLFNNTLKKGLELLEKS
SYA_BLOPB       IFFYKLVSPLIKY-----MQHIADILHE--KKDFIAEILLSEEKLFQDTLKRGLELLEKQ
SYA_COXBU       PFFYQLTKPLVEE-----MGGAYPLLRK--SQALIEQTIKQEEIQFSNTLTKGLKILDHE
SYA_LEGPL       PFFFKLVQPLIDV-----MGDAYPELIN--SKAHIERILQQEENQFTRTLEQGLRLLQDH
SYA_ECOLI       TFFYKLVGPLIDV-----MGSAGEDLKR--QQAQVEQVLKTEEEQFARTLERGLALLDEE
SYA_PSYA2       DFFYKMVAPLVAE-----MGIAYPELKD--KQSVIENTIQKEEAQFAKTLAQGLRLLASE
SYA_IDILO       TFFFRLVDELARQ-----MGEAYPELEQ--KKQIIKDALEREEQQFARTLERGLAILSDE
SYA_XANOR       PFFSKMVPTLVEL-----MGEAYPELVV--AKDTVARALLAEEERFAETLDAGMKIFDEV
SYA_ACIFR       VFFHQLVAPLVAE-----MGSAFPELTR--AQREVERALEREETRFRETLERGLSLLEEA
SYA_FRATT       IFFYKLVAELVSQ-----MGEVYSQLID--KRELIEKTLIKEEELFLKTIENGIKIFDAE
SYA_ZYMMO       PLMYRLVPALLSE-----MGMAYPELVR--AKALIEETLRLEETRFRQTLANGLKILEDE
SYA_RUEPO       PVMHRLVRTLVGQ-----MGAAYPELGR--AQALIEETLLLEETRFKQTLDRGLKLLDDE
SYA_CAUVC       PLMHRLAPTLVRE-----MGQAYPELRR--AEALIVETLRQEEERFRTTLGRGMGLLDEA
SYA_GLUOX       PVFYRLLPALIQQ-----MGAAYPELVQ--HQALIAQTMKGEEERFTALLERGLTLLSDE
SYA_PELUB       PVFYNIFKTLLEE-----MSNNYPELER--AQSLIKETLKTEEEKFLVLLDRGIKILNEE
SYA_RICFE       PLMYKLLPKLVDL-----MGNVYPELKR--AESFISSILEQEEIRFKTTLERGLKLLTEE
SYA_ANAMM       VAIHEVLPVLTKEGSAGYMGDAYPELVR--CEQSITSTLRSEGEGFVDTLRRGMALLEKE
SYA_EHRRW       SLMYKIFPVLIDETSNAYMADYYPELFK--AKDLIISILKTEEENFKDTLVRALPLLEKE
SYA_WOLTR       PLLHRIFPVLIDSTSSAYMGGVYPELIR--AKSLIETTLKSEEENFKDTLIKGINLLKKF
SYA_DESPS       PFMDRVTKAVCAE-----MQNAYPQLVA--TAALLEKVVNNEEERFRETLEHGLVQLDEK
SYA_GEOSL       PVICRMVEAVNAM-----MGDAYPELLE--REEYIRKVIRAEEERFAETLDRGLAILNEA
SYA_DESVH       TFLHKTALKVVDI-----MGDDYPELRE--NSDFMARVVREEEDRFNRTLDKGLSMLEDE
SYA_SYMTH       PFIWKVAGAVADV-----MGDAYPEVRE--RLPVIQDELRREEERFLRTLEQGMNRLEEI
SYA_BDEBA       SFLPGMAEALIES-----MGSVYPELKT--RRDHILNTIRDEEDRFIATLDKGTAILEDE
SYA_CHLTE       EPIIYKMVEVLVR----TMGDVFPELEK--QQATVEKIIRAEEESFLVTLGRGTEIFNEV
SYA_BACFN       QAFMYKLLPVLID----SMGDAYPELIA--QKELIEKVIKEEEESFLRTLETGIRLLDKT
SYAC_HUMAN      RGFFATLVDVVVQ----SLGDAFPELKK--DPDMVKDIINEEEVQFLKTLSRGRRILDRK
                                                         :   :   :  .   .   

SYA_LEIXX       VANTQ-KAG---------------------KRELAGDTAFLLHDTYGFPIDLTLEMAEEA
SYA_CUTAK       VVETK-ASG---------------------SKTLSGEKAFQLHDTYGFPIDLTLEMAAEQ
SYA_CORJK       AHEAK-ERG---------------------EDTVPGDVAFSLHDTHGFPIDLTQEMAAEA
SYA_THEFY       VRRTK-ETG---------------------GTVFSGADAFQLHDTYGFPIDLTLEMAAEH
SYA_BIFLO       VNKAKSDSA---------------------EPVVAGEDAFKLHDTYGFPIELTLEMAAEQ
SYA_TROW8       MSSSK--------------------------KRVSGDLAFRLHDTHGFPIDLITEIAKDS
SYA_PROMA       LSKAP--------------------------SVITGEAAFELYDTYGFPVELTEEIAEEN
SYA_SYNP6       LAAAT--------------------------DQIRGEDAFVLYDTYGFPLELTQEIAEEK
SYA_PROMP       ISSGQ--------------------------KMITGFKAFELYDTYGFPLELTEEIAQEN
SYA_DEIRA       LSGMEKGS----------------------T--LVGKDAFELYDTYGFPVDLTKEIAEEY
SYA_THET8       LSGLKPGE----------------------V--LPGKEAFRLYDTYGFPLDLTVEIAAER
SYA_THEMA       VEKKGK---------------------------IDSEDAFRLYDTYGLPLELTLEIAKEK
SYA_RHOBA       FEEMNDEA----------------------SVMVPGAEAADLLTTYGVPPELVQTLAAEQ
SYA_FUSNN       IDNLLTNG----------------------KNKLDGEISFKLYDTYGFPYELTEEIAEER
SYA_LACAC       IEKAKNSDDKTISG----------------------KDAFKMFDTYGFPYELTFESAQDA
SYA_STRT2       LANLKKSGKDTLEG----------------------KDIFKLYDTYGFPVELTEELAEDE
SYA_GEOKA       IEKAKEQGSDVIPG----------------------EEAFRLYDTYGFPIELTEEYAAEA
SYA_STAS1       VAQAK-TSTHEISG----------------------KDAFKLYDTYGFPVELTEEIATQE
SYA_MYCPN       IAHNALQP----------------------------QVAFQLYETYGFPIEMIKELVDKR
SYA_MYCGA       KTTNNITA----------------------------ETIFKLVETYGFPLDLIKELSAEA
SYA_MYCPE       LNKKLLDA----------------------------SDLFNLVTTYGFPIEIVQSLQELL
SYA_UREPA       IRNQELDK----------------------------EITFKLVDTYGFPIELIKEICEQR
SYA_MYCHJ       LKINKN----QIKPVTV----------------------FKLFETYGFPVELTKEILAEK
SYA_MYCMO       IKSKFP----KDNSIDIENKSQVAKYFKENNLTFDFSIAFELFSTFGFPVEIIKEILEDE
SYA_MYCPU       FEKSKK---IDASI------------------------VFKMFDTYGYPVELTKEMAKEK
SYA_MYCS5       ISENSSKDLFPGDL------------------------AYKLHETYGFPFELTEEILLQK
SYA_MYCMS       IKTKNTVS---------------------------DKDALLLFESYGFPIEQTIEISELS
SYA_ONYPE       LTQNTLSG----------------------------QNFFKLYDTYGIPEDLILDYAKKK
SYA_CLOTE       VDELINKGE----------------------KVLPGDKAFKLYDTYGFPIELTKEILEEK
SYA_CALS4       INELKAQGK----------------------TVLEGAKAFKLYDTYGFPLDLTKEILQES
SYA_LEPIN       VQKTKAGGK----------------------TIFSGADAFLLYGTYGFPAEMTEEIVAEQ
SYA_DEHMC       VRQTKGGR-------------------------ISGQDAFKLYDTYGFPVEMTTEIAAEK
SYA_CHLAB       LKSS--SSSSTIS----------------------GEDAFKLKDTYGLPLDEIALLAKDY
SYA_PARUW       IEKSR-ASHQIIS----------------------GDDAFKLKDTYGLPIEEILLIAKDS
SYA_AQUAE       IQKALEEGRKTLS----------------------GKEVFTAYDTYGFPVDLIDEIAREK
SYA_CAMJR       LKNTK------------------------E--IFSGEVAFKLYDTYGFPLDLTADMLREK
SYA_WOLSU       LEKTQ------------------------S--VFSGEAAFKLYDTFGFPLDLTEDMLREK
SYA_HELPJ       LTHLN------------------------ENKIFDGKIAFKLYDTFGFPLDLTNDMLRSH
SYA_BUCAP       IKKST------------------------NKTI-SGKTAFYLYDTFGFPIDLTSDICSEK
SYA_BUCBP       LKQIQ------------------------PKHVLSGKLAFNLYDTFGFPIDLTIDICKEH
SYA_WIGBR       LKKIK------------------------NNIL-KGEIAFKLHDTFGFPIDLTNDICIKN
SYA_BLOFL       LKNLN------------------------QDKILSGEIAFQLYTTYGFPLELTKDICCER
SYA_BLOPB       LIRL-------------------------KGNCLNGEIAFNLYDTYGFPFELTQDVCLKR
SYA_COXBU       MAGL-------------------------PSRQIPGNLIFQLYDTYGFPPDLTADIARER
SYA_LEGPL       IKNL-------------------------KGQELSGEVAFKLYDTYGFPIDLTADIIREQ
SYA_ECOLI       LAKL-------------------------SGDTLDGETAFRLYDTYGFPVDLTADVCRER
SYA_PSYA2       LEGLQ------------------------DGDTLSGEAAFKLYDTYGFPVDLTADITRER
SYA_IDILO       IGEL-------------------------KGNVIPGDVVFKLYDTYGFPVDLTADIAREQ
SYA_XANOR       AS--R------------------------SQDIIPGADAFRLYDTYGFPVDLTADIARER
SYA_ACIFR       IADLA------------------------AGAAIPGEIIFRLADTFGFPVDLTADIARER
SYA_FRATT       IENL-------------------------KDNTISGEVAFKLYDTYGFPFDLTADMAREK
SYA_ZYMMO       TQHLK------------------------SGDTLPGAVAFRLYDTYGFPYDLTADALRAR
SYA_RUEPO       LTALP------------------------EEAPLPGEAAFKLYDTYGFPLDLTQDALREK
SYA_CAUVC       TANLA------------------------AGGVLDGETAFKLYDTYGFPLDLTQDAVRAK
SYA_GLUOX       LDRLG------------------------DKEALPGDVAFKLYDTFGFPLDLTQDALREK
SYA_PELUB       LEKV--------------------------EKILPGEVAFKLYDTFGFPLDLTEDILKNK
SYA_RICFE       TETLT------------------------KGNELSGEIAFKLYDTYGFPLDLTEDILKNR
SYA_ANAMM       IGGLS------------------------PGQVLLGDVAFKLYDTFGFPLDITLDIAKER
SYA_EHRRW       LTYLS------------------------TGDVLSGDIIFRLYDTYGFPVDITLDIIKER
SYA_WOLTR       TTDLK------------------------PGDTLSGESAFKLYDTYGFPLDITLDILKER
SYA_DESPS       ISQLLTSG---------------------GDAVIDGPFIFKLYDTFGFPFDIVRDIALER
SYA_GEOSL       VADLKNEG---------------------R-TVIPGETLFRLYDTFGFPTDLTADIVRSE
SYA_DESVH       LATLSASG---------------------A-AHVPGDIAFRLYDTFGFPLDIVNDIAEKR
SYA_SYMTH       LARMRQKG---------------------E-TVISGQDAFVLYDTYGFPLDIVRDVAREQ
SYA_BDEBA       LKKAKSKG---------------------I-KELSGEVVFRMYDTYGFPADLTRVIANEQ
SYA_CHLTE       VADMKTA----------------------GSTTISGADAFKLYDTFGFPLDLTRLMAAEV
SYA_BACFN       MADTKAN----------------------GKTEISGKDAFTLYDTFGFPLDLTELILREN
SYAC_HUMAN      IQSLG------------------------DSKTIPGDTAWLLYDTYGFPVDLTGLIAEEK
                                                            :.* * :         

SYA_LEIXX       G-----------------------------LSVDRAAFDTLMADQRARAKADAKAKKTA-
SYA_CUTAK       G-----------------------------LEVDRNKFTALMAEQRARAKADSQAKKGL-
SYA_CORJK       D-----------------------------LKVDIDGFHELMAEQKARAKADNNAKKLG-
SYA_THEFY       G-----------------------------LKVDEETFHQLMQRQRETAKRDAQAKKLG-
SYA_BIFLO       G-----------------------------VKVDEAKFRELMAEQKSRARADA-LKKRH-
SYA_TROW8       G-----------------------------LDVDMDGFFTLMKEQKDRSRAALSRSKPI-
SYA_PROMA       D-----------------------------LRVDMKGFKKAMDEQRRRAKSAAMTIDLT-
SYA_SYNP6       G-----------------------------LTVDLAGFEAAMAAQRQRSQAAHETIDLT-
SYA_PROMP       N-----------------------------IGVDVKGFDKEMSAQKERAKAASQIIDLT-
SYA_DEIRA       G-----------------------------VSVDEAGYAESLEHAQEIARAGSKYGKSE-
SYA_THET8       G-----------------------------YGVDTEGFQKAMEEQQSRSRAAMAFEREI-
SYA_THEMA       G-----------------------------VEVDVQEFNKYMEEQQRKSRAAMGDVEFA-
SYA_RHOBA       N-----------------------------FTFDWSGFREAMDKHADESDGGQRVLFQ--
SYA_FUSNN       G-----------------------------VIVLREEFEAKMEEQKEKARSAREVVME--
SYA_LACAC       G-----------------------------LKVDKKGFDAEMQAQKDRARKARGDLQSM-
SYA_STRT2       G-----------------------------FKIDHEGFKAAMKEQQDRARASVVKGGSM-
SYA_GEOKA       G-----------------------------MTVDHAGFEREMERQRERARAARQDVDSM-
SYA_STAS1       N-----------------------------LSIDMQTFEEEMQQQRDRARQARQNSQSM-
SYA_MYCPN       Q-----------------------------LQVDWKAVEQLMEQHRLISKQN-SNTLSF-
SYA_MYCGA       K-----------------------------IKLDLDGFEELFKKHQEISKAN-NGEVGL-
SYA_MYCPE       TQSKDAKNLKLAEDIINSINPSDKKISISKLKIEFDEFEKLFDEHRLIANAN-ASVKGM-
SYA_UREPA       N-----------------------------VKVDLEAFDAMFKHHQLISKANKANLKVM-
SYA_MYCHJ       -----------------------------NIDFDLSQLVEFQEKHSQISRAK--KTTGM-
SYA_MYCMO       Y----------------------------EIELDISNLPKYLEEHANKSRSE--NSSAM-
SYA_MYCPU       -----------------------------GVEISLEEFEKYRQEHELKSKSK--KGDGM-
SYA_MYCS5       -----------------------------DIKINKEEFNLAKEKHIEASRNQ--KETGM-
SYA_MYCMS       N-----------------------------VTVDVEGFKKLLEQTKQATRNARKDLKAW-
SYA_ONYPE       N-----------------------------ITTDYQKFQELLHDHQNLSKQNQTSQIHM-
SYA_CLOTE       S-----------------------------IDIDEGGFTKEMEAQKQRARAAREETNYM-
SYA_CALS4       G-----------------------------ITIDEEGYKEELEKQRVRARSSRKEDNSL-
SYA_LEPIN       G-----------------------------LDFDKKGFQEELEKDRQFSRESWKVNKVS-
SYA_DEHMC       G-----------------------------LSVDLDGFESEMEIQRTKARSSRKFSFDA-
SYA_CHLAB       N-----------------------------FSVDLDTFYQLEKEAKERSRK--NVIKSH-
SYA_PARUW       G-----------------------------LKVDEPRYQQLEEEAKQRSRHVHKTVHQI-
SYA_AQUAE       G-----------------------------LGIDLEGFQCELEEQRERARK-HFKVEAK-
SYA_CAMJR       N-----------------------------LKVDEEKFELFMNEQKARAK-ASWKGSG--
SYA_WOLSU       G-----------------------------IRVDLAAFEACMKEQRARAK-ASWKGSG--
SYA_HELPJ       G-----------------------------ACVDMQGFENCMQEQVKRSK-ASWKG----
SYA_BUCAP       N-----------------------------IKIDFKGFNIAKEEQKKRSSIKNKFYK---
SYA_BUCBP       N-----------------------------ISINIMEFKRYLNQHKQ-NSINKNFLN---
SYA_WIGBR       K-----------------------------INVDEKGFFHAMNEQKN-KSYKNSCFN---
SYA_BLOFL       N-----------------------------IKVDQLEFDQIMLTERRNSKRLSQFHK---
SYA_BLOPB       G-----------------------------IHVDQEGFDQAMLTQKKYTKELNKFDI---
SYA_COXBU       D-----------------------------FVMDYAGFDKAMERQREQSQQAHQFVA---
SYA_LEGPL       G-----------------------------LHIDMEAFNQLMQQQREQSQAASQFTT---
SYA_ECOLI       N-----------------------------IKVDEAGFEAAMEEQRRRAREASGFGA---
SYA_PSYA2       G-----------------------------IVIDEAEFDEHMQAQRERARDAGKFDV---
SYA_IDILO       E-----------------------------LTIDEQGFEQAMSEQRQRAQQASQFGM---
SYA_XANOR       G-----------------------------MRVDMEGFECAMERQRETARAAGKFGG---
SYA_ACIFR       D-----------------------------LIMDMEGYEAAMADERSPLPCRLGGSG---
SYA_FRATT       G-----------------------------LKVDEQAFLAQMQIQKQRSKEAGKFNV---
SYA_ZYMMO       N-----------------------------LTVDQAGFDAAMAEQRKAAR-AAWKGSG--
SYA_RUEPO       G-----------------------------RKVDTDGFDAAMAEQKAKAR-AAWAGSG--
SYA_CAUVC       G-----------------------------LTVDTDAFDAAMQKQREMAR-ANWAGSG--
SYA_GLUOX       G-----------------------------RTVDEAGFETAMAEQRKRAR-AAWVGSG--
SYA_PELUB       S-----------------------------MTVDGEKFDLLMKESKKLAK-KNWKGSG--
SYA_RICFE       D-----------------------------ISVDHKRFEEQMLAQKERAR-KSWLGSG--
SYA_ANAMM       G-----------------------------LKFDQEGFNKGMGEQKARSR-KHWVGSG--
SYA_EHRRW       G-----------------------------IRFDEKGFYDNMEQQKTRSRLSHLIKST--
SYA_WOLTR       K-----------------------------INFDQKGFDNAMEEQKERAR-AKWTGSG--
SYA_DESPS       G-----------------------------VGFDEAGFATAMAEQRAKSRASRKG----E
SYA_GEOSL       G-----------------------------FTIDEDGFEACMERQREQAREHWKG----S
SYA_DESVH       G-----------------------------FSVDEDGFKALMKEQKERAKAAWKG----S
SYA_SYMTH       G-----------------------------FTVDEQGYQAAMAEQRARARAARDV----S
SYA_BDEBA       G-----------------------------IEVNEAAFEKEMEDNRAKSKASWKGKSMGA
SYA_CHLTE       G-----------------------------LGIDEAGFEHCMMEQKTRARMDRKG-----
SYA_BACFN       G-----------------------------MTVNVEEFDAEMQQQKQRARN---------
SYAC_HUMAN      G-----------------------------LVVDMDGFEEERKLAQLKSQGKGAGGEDLI
                                                                            

SYA_LEIXX       --------------LADLSVYSGLRALG--ETVFTGYTELETESSVLGLIIDGH------
SYA_CUTAK       --------------LTDREAYSQVRALG--ETPFLGYTDLTVDTTVTGIIANGT------
SYA_CORJK       --------------HVDQTIYRPFVDNH--PTVFTGYENLADEASVLGIIRDGA------
SYA_THEFY       --------------NADISVYGNLLETGG-PTEFLGYTDSESEARVLGIIVNGE------
SYA_BIFLO       --------------NVDLSVYDDFKKTLVSPIDFLGYTDMSARAKVIGIMQEGKG-----
SYA_TROW8       --------------VSDTTGYEGL------RSNFLGYEMLQVDTKITALVKDGT------
SYA_PROMA       --------------LQDTIDKVVSEVGE---TNFLGYQQLEQFSQVQAIVVNGV------
SYA_SYNP6       --------------VQGSLDRLAEQIHP---SEFVGYGDAVATAKVTALLREGQ------
SYA_PROMP       --------------LEGSLEREIDLFDK---TLFNGYDSLDSDAEIKGIFLEST------
SYA_DEIRA       --------------LFGGHQ---EALDGLPATQFVGYDQTSGDGQVLALLSGG-------
SYA_THET8       --------------FKKGAQVLEELYAERGATEFLGYNALEAEAEVLALLAGD-------
SYA_THEMA       --------------RRYEYL---EKLPKDFRTEFTGYEKLEDEGEVVLVARDD-------
SYA_RHOBA       ---------------TGP---LETLKEALRETPFVGYEQTEATAVVKGIITGDGKGKG--
SYA_FUSNN       ---------------KGQDSFIEEFYDKYGVTEFTGYEKTE-------------------
SYA_LACAC       --------------GRQDVT---LMNIKDKSE-FEYGVYEEPHAKLIDIVVDD-------
SYA_STRT2       --------------GMQNET---LANITEPSE-FLYEA-ETAESRLSVIVADD-------
SYA_GEOKA       --------------QVQGGV---LGDIKDESR-FVGYDELVAASTVIAIVKDG-------
SYA_STAS1       --------------QVQSEV---LKKITTDST-FVGYDVMDKASVITDIIQNG-------
SYA_MYCPN       --------------EKQNEH---LVNF-KTASEFLYEANEIT-AKVIGLFDEQY------
SYA_MYCGA       --------------KKQNEN---LLKF-KTPSKFFYDKNNIK-TKVVAIFDDKF------
SYA_MYCPE       --------------ENQNEE---LLNLPTLDSSFDYEIESVKNSKVLKIFDENW------
SYA_UREPA       --------------ESQNES---LMQL-DVDSTFHYEIFRWENAKIITLFNEDF------
SYA_MYCHJ       --------------QKVINS---LTQIKAKISDFIGYHTHHIETKISFLANKDE------
SYA_MYCMO       --------------QKVINS---LELVKEKVSEFVGYSTLKTKSKILYLLNETE------
SYA_MYCPU       --------------KKVINF---LANIDKKVDEFVGYDTLETTSKILYLFNSES------
SYA_MYCS5       --------------DKVINS---LALIKAKEDEFIGYEHTNSVSKILHLLNEEN------
SYA_MYCMS       --------------DKQNEL---FTKLKVESEFTGWSETSRDNAKVIYMFTDQK------
SYA_ONYPE       --------------NKQEES---FLQF-LTPSEFIGYTNFTCKTKVIKVFDKG-------
SYA_CLOTE       --------------GSEDTI--INKLPIELQTEFLGYSELSVEAKIIAIIK---------
SYA_CALS4       --------------WEQD----IYSTLGDISTKFVGYEVYESEAKVLAIVK---------
SYA_LEPIN       ----------------------LMTGLNVDKTEFLGYSSVSGKGNITHLFYNSPKSSNSL
SYA_DEHMC       --------------AATAEA--VKNMRHAEKTCFVGYELAIQKSTIKDILT---------
SYA_CHLAB       --------------NATDTV--YDALSLGENSTFVGYHDLSCDTFIEAIIKNGE------
SYA_PARUW       --------------AGENIF--ADFVKVRGETKFAGFTQNSLKSSVVGLFVNGE------
SYA_AQUAE       --------------KVKPVY--SHLKELGKTSAFVGYEHMEWESQVVGLVKGEG------
SYA_CAMJR       --------------DKTASGDFKNLLEKFGENHFVGYEKAECESKILALLDEDF------
SYA_WOLSU       --------------DELKEGDFALLLEAFPSNSFVGYEKEAHTSKLLAILNRDY------
SYA_HELPJ       ---------------KQNNADFSAILNAYAPNEFVGYETTECLANALGFFDSDF------
SYA_BUCAP       --------------DYNKDII------INDTCIFEGYKKNKTKSLVKYIFIKN-------
SYA_BUCBP       --------------TRNAYYIE--DNNINIKTHFVGYQFNKTQSIINNIIIKNN------
SYA_WIGBR       --------------KFNLKLL------NNYCTKFCGYSYLKCESQILNIYNLK-------
SYA_BLOFL       --------------NFNNIIL----SSYAKTSTFVGYKCFSCQSKIIALLQDNE------
SYA_BLOPB       --------------SYEKLSL----CNV--SSIFVGYDKLICKSRVMALFQNNK------
SYA_COXBU       --------------NYA------QKASIGGETQFVGYETLNSQA-NVISLLQND------
SYA_LEGPL       --------------DYH------AVSQLDHQSEFHGYEKESMEA-KIIGLLQEG------
SYA_ECOLI       --------------DYN------AMIRVDSASEFKGYDHLELNG-KVTALFVDG------
SYA_PSYA2       --------------DYS------SVIQVENPTTFIGYEQLEQEGVAIDALYQDG------
SYA_IDILO       --------------DYN------QQLKSDNKTAFTGYDDVVGQA-KVVELFKDG------
SYA_XANOR       --------------GVA---LPADLVASMSPTVFLGYEAYDADALRVVALLKQG------
SYA_ACIFR       --------------EVKTERVYHDLAMRLPVTEFTGYSTCADEG-KVVALIRDG------
SYA_FRATT       --------------DYN------SLINSQVKSEFRGYSTLIEDA-KVLEIYQDG------
SYA_ZYMMO       --------------EKASDEIWFDIADQLGGTEFTGYTAEKGS-GQIIALIKDG------
SYA_RUEPO       --------------ESTDNAIWFDVLDVAGATDFLGYDTEKAE-GQALALVVDG------
SYA_CAUVC       --------------QQGAAAAWFSIKEKAGATDFVGYETTETT-GVVKAIVVDG------
SYA_GLUOX       --------------DAAAETVWFDARDKHGPSEFLGYVSEKAD-AEVQGIFRGN------
SYA_PELUB       --------------DSSVDQIWFDIKDRLGATDFLGYSTDKAE-GVVTLILKNN------
SYA_RICFE       --------------ESKTDQLWFDIKEQHGSTEFLGYTLNEAE-CKIIALIKDN------
SYA_ANAMM       --------------EDASHRLWEELQAQHKNTRFVGYDCCSTK-ASVLSITRDG------
SYA_EHRRW       --------------EQLNGKIWEDIRQNYNNTRFVGYDNFQVQ-SKILSMVMNN------
SYA_WOLTR       --------------EKSIEQIWFNLIDKFGKTEFVGYEFSEVKDAKVLVILSSK------
SYA_DESPS       -------------GVKLHDEGVKALADAGKKAEFLGYEGLEADSVVEGLLSEQG------
SYA_GEOSL       -------------GEEGIAEVHKTLHSRGVRSRFTGYEARTAYSPVTVLL-KGG------
SYA_DESVH       -------------GEKDIASRFQPLLEEGMRSEFIGYDHLCGEGRIVALMDEHA------
SYA_SYMTH       -------------YITEVQSRIAGHLEGVAPTRFVGYTELAGEGRVLAVFDQEG------
SYA_BDEBA       -------------DEAHMIKFAKDYLQSGKSVTFLGYEGTIGDGKVMGLS-NGQ------
SYA_CHLTE       ------------KMQMQDDGGEWQWFAPEAPTTFVGYDMLETEATLVAAR----------
SYA_BACFN       --------------AAAIETGDWIILK-EGTTEFVGYDYTEYETSILRYR----------
SYAC_HUMAN      MLDIYAIEELRARGLEVTDDSPKYNYHLDSSGSYVFENTVATVMALRREK----------
                                                                            

SYA_LEIXX       ---------------------SANKAVEGQVAEVILGATALYAEAGGQDADTGTIVGPG-
SYA_CUTAK       ---------------------SVTAAEPGAVVEIVLAETPFYAEMGGQDSDSGIIRANG-
SYA_CORJK       ---------------------LVETAPEGAAAQVILDRTPFYAEAGGQMADRGEMTSTS-
SYA_THEFY       ---------------------STGAARKGDQVELVLDRTPFYAESGGQLADKGTITVDGR
SYA_BIFLO       ---------------------SVPAVTGPANVEVILDRTPFYAEAGGQLADQGEILSDDG
SYA_TROW8       ---------------------ILTSAKQGDCVDIALEQTPFYATAGGQEADRGFIESDN-
SYA_PROMA       ---------------------SSQECNVGDKIDIVLNMTPFYGEGGGQIGDRGIISSASS
SYA_SYNP6       ---------------------SVEAAEAGDRVQIVLDHTPFYAESGGQVGDRGVLTGES-
SYA_PROMP       ---------------------LVKQASEGQKVLIVLDQTSFYGESGGQVGDIGTILSND-
SYA_DEIRA       --------------------ERLSHLPAGSEATVVLSQTPFYGEGGGEVGDTGRLEWDG-
SYA_THET8       --------------------QSLLEAGPGTEVQVVLDKTPFYAEGGGQIGDFGLLEWPG-
SYA_THEMA       --------------------ETVEEASEGT-VEVVFSRTPFYAEKGGQVSDTGMVEWRD-
SYA_RHOBA       ---------------DDGQLLSHLDRPEDAVLRLVLDHSPFYGESGGQVGDIGVISNDN-
SYA_FUSNN       ---------------DEGKLLSLREAK-DRKYLLIFDKTPFYAESGGQVGDQGKIYSDN-
SYA_LACAC       --------------------KLVDKAN-GEHATLVFDKTPFYAERGGQVADHGGIYNQDG
SYA_STRT2       --------------------ARHDSVN-SGQALLVFEQTPFYAEMGGQVADHGTISDAAG
SYA_GEOKA       --------------------RLVEEVKAGEEAQIIVDVTPFYAESGGQIADQGVFESE--
SYA_STAS1       --------------------ELVESAEAGETIYFILRETPFYAVSGGQVADQGTISNE--
SYA_MYCPN       --------------------QPVQKLHNQ-SGYVVFDQTVLYATSGGQRYDEGYCINHSQ
SYA_MYCGA       --------------------NPVDQIEVG-SGWAVFESTPIYATSGGQRFDEGYCLKKG-
SYA_MYCPE       --------------------KPVEEIKNK-DCWVILDKTCFFATTGGQEHDTGKINKFD-
SYA_UREPA       --------------------ELVDGLDHE-DGYVVFDNTCFYATSGGQQHDTGYIIKNDQ
SYA_MYCHJ       --------------------EVAETNGEN-LSYVIFEKTPFYATAGGQKHDQGWIIQNNS
SYA_MYCMO       --------------------EIHFTNSENEISYLILDKTPFYATAGGQRHDKGLLIQDKN
SYA_MYCPU       --------------------KLNKLEGQG---YFILDKTPFYATSGGQKHDQGYVEQDGK
SYA_MYCS5       --------------------ELSENDGTS---YLILDKTPFYATSGGQKHDRGYIEQNGV
SYA_MYCMS       --------------------QVESITNQE--VFVILDKTPFYAEKGGQAADSGIIFNDQM
SYA_ONYPE       ---------------------------------IVLEKTPFYANMGGQIEDEGWIDNTKV
SYA_CLOTE       ------------------GEELVEELKQGDKGIIIVDKTPFYSEKGGQIGDTGILAGKNV
SYA_CALS4       ------------------DNEVVEQAEAGDDVSIILDVTPFYAESGGQVGDSGVIEEEDT
SYA_LEPIN       SQVDSKLQSSTPAGTGSYDSKQVSSLKEGQAGAIVLNKTPFYPEGGGQVGDIGFLRQGKN
SYA_DEHMC       ------------------EGGTVDSIEEGDEASIVLDESPFYAEMGGQVGDTGEIITGGG
SYA_CHLAB       ---------------------QVSYLKEKEKGILILKETPFYAEKGGQVGDSGEIFCSDG
SYA_PARUW       ---------------------FVEEMQSGQEGLVFLSETPFYAEMGGQVGDTGTLENSNS
SYA_AQUAE       ---------------------LVSELKEGEEGEVVLKETPFYPEGGGQIGDAGIIESDKA
SYA_CAMJR       -------------------KEVSTLKD---AGWVMLENTPFYATSGGQSADSGFIAKR--
SYA_WOLSU       -------------------KRVSSLGAGE-SGFVMLEETPFYAESGGQCGDEGELRARGR
SYA_HELPJ       -------------------KEITEANPNQ-EVWVLLEKTPFYAEGGGAIGDRGTLFKDNE
SYA_BUCAP       -------------------ESVFLIYKGQ-TATIFLDKTSFYPESGGQIGDIGELYH---
SYA_BUCBP       -------------------KKTLQINDYQ-NSILFLNETPFYGESGGQIGDSGIIHN---
SYA_WIGBR       -------------------EEIKEIKENQ-EGIIILDKTPFYGESGGQVGDSGEIKS---
SYA_BLOFL       -------------------LINKMCDVDQ-ESMVILDITPFYGESGGQIGDSGYLKG---
SYA_BLOPB       -------------------SINKIYTKE--EGIVILNNTPFYGESGGQIGDCGQLNT---
SYA_COXBU       -------------------QPINRLNESE-KGVVVLDRTPFYAESGGQVGDQGFLYF---
SYA_LEGPL       -------------------NEVKSLNKGA-KGAVILDHTPFYAESGGQVGDKGLLIG---
SYA_ECOLI       -------------------KAVDAINAGQ-EAVVVLDQTPFYAESGGQVGDKGELKG---
SYA_PSYA2       -------------------NPADSLTEGM-EGVVVLDRTPFYAEGGGQVGELGEIRT---
SYA_IDILO       -------------------KPVEQLQAGE-NGIVVLSETPFYAESGGQIGDKGVLVA---
SYA_XANOR       -------------------RPVERAQAGD-EVIVFTDRTPFYAESGGQVGDSGQLNG---
SYA_ACIFR       -------------------EEVAFLEAGD-MGVVILDRTPFYGESGGQAGDRGELQS---
SYA_FRATT       -------------------QLVASTSEQV-SAVVVLDKTPFYAESGGQVGDKGILEG---
SYA_ZYMMO       -------------------KRVETAKQGD-DITIITNQTPFYGESGGQKGDIGVITG--N
SYA_RUEPO       -------------------ALSDRIAEGG-SGWVVTNQTPFYGESGGQVGDTGVIRRLEN
SYA_CAUVC       -------------------AEVESASAGQ-TVEVLLDRTSFYAESGGQAGDTGVIEA---
SYA_GLUOX       -------------------DELASAPAGDDTVAILLNQTPFYGESGGQVGDHGTLTA---
SYA_PELUB       -------------------KEVQDLQEND-EGIIITNQTPFYGESGGQVADTGIISK---
SYA_RICFE       -------------------NLVNDIKEIDTQFLLISNQTPFYGESGGQMGDIGMIFS---
SYA_ANAMM       --------------------MAVQSVNSGEKACLLLDVSPFYAESGGQEGDKG-----SI
SYA_EHRRW       -------------------DRNVTVANVGDKVSILMDITPFYAEAGGQQADTGLL---SV
SYA_WOLTR       -------------------NEVIDSAKEGEKITIILDKTPFYGESGGQVGDTGSFIIPSI
SYA_DESPS       -------------------SGVEKLVAGE-KGRVFVAATPFYAEAGGQMGDRGSVRW---
SYA_GEOSL       -------------------AEVAEATAGD-RVEIITDATPFYGESGGQVGDTGTIST---
SYA_DESVH       -------------------LAVERLAAGQ-KGYLVTNRTPFYGASGGQSGDIGTIAS---
SYA_SYMTH       -------------------N-ATGAGEGS-SVIIVLDRTPFYAEGGGQVGDTGQIVA---
SYA_BDEBA       -------------------AEVQELKTGD-TGLMILNATTFYGEGGGQSGDVGYIMH---
SYA_CHLTE       --------------------VSGDK------LLMVLDQTPFYAESGGQVGDHGTLETAGY
SYA_BACFN       --------------------QVKQKNQT--LYQIVLDYTPFYAESGGQVGDTGVLVNEFE
SYAC_HUMAN      --------------------MFVEEVSTGQECGVVLDKTCFYAEQGGQIYDEGYLVKVDD
                                                      : ::   **   : *       

SYA_LEIXX       ----Y-----------------VLDVLDVQKPVRGLVSHRVLVRSGEVGV----------
SYA_CUTAK       ----I-----------------DFEVLDVQRPVPGLIVHKVHL-DGDLAV----------
SYA_CORJK       ----G-----------------AARVEDVQKVGKKVWVHHVTVSGGELAV----------
SYA_THEFY       ----G-----------------VVDVEDVQKPIQGLFVHRGTVREGEVVV----------
SYA_BIFLO       ----A-----------------VLEVDDVQKPIKDLIVHQCRLTEGTLVV----------
SYA_TROW8       ----F-----------------SGKVVTVFSPLPGLTVHRCEIVSGLVVS----------
SYA_PROMA       DDSEC-----------------LIEIDSVRR-VKGAFVHSGLVKNGVLTL----------
SYA_SYNP6       ----L-----------------IVRIEDVQK-ESGFFVHYGQIERGLLQV----------
SYA_PROMP       ----L-----------------EVVVDNVIR-KKNVFLHYGIVKKGILSL----------
SYA_DEIRA       ----G-----------------AGIVRDTQKTKQGVFLHDVLVEQGELKE----------
SYA_THET8       ----G-----------------RARVETTRKTERGIFLHKARVEEGVLRV----------
SYA_THEMA       ----G-----------------KALVEYVFEASEGVIVHRIKILDGTLRR----------
SYA_RHOBA       ----F-----------------EFEVIDTQR-HASMIVHHGRLIRGKINE----------
SYA_FUSNN       ----F-----------------AGKVLDVQK-QKDIFIHTVKLEKGMPEE----------
SYA_LACAC       ---EL-----------------VAKVTDVQHAPNDQNLHFVDLILPMEK-----------
SYA_STRT2       ---TT-----------------VARVVDVQRAPNGQALHTVEVEGELVV-----------
SYA_GEOKA       ---TG-----------------TAVVKDVQKAPNGQHLHAIIVERGTVKK----------
SYA_STAS1       ---NF-----------------EIAVTEVTKAPNGQNLHKGEIQFGTVKK----------
SYA_MYCPN       N--DQ-----------------RVSFQGVFKGPNKQHFHFF-LTGSFQL-----------
SYA_MYCGA       ---NL-----------------VVHFDNVIKAPNKQHLHHF-KKASFWL-----------
SYA_MYCPE       -------------------------VVDVIKSPQGYHLHKV-VKGTFKI-----------
SYA_UREPA       ----------------------QFFVDDVFKAPNRQHVHHV-KNASLSM-----------
SYA_MYCHJ       ----------------------TIEILDVFKD-KFLNNIHV-FKGKIVK-----------
SYA_MYCMO       ----------------------RIEVLEVFKD-KHLNNVHK-VKGKILK-----------
SYA_MYCPU       ----------------------KFKILEVFKD-KNWNHVHL-VKGEIDS-----------
SYA_MYCS5       ----------------------KLEILNVFKD-KFGNHVHK-VVGKLSK-----------
SYA_MYCMS       ----------------------KGFVIDVQQGPTHQNIHRIKVQGTLKV-----------
SYA_ONYPE       --------------------------TKITKLPNGQILHEV--QGNFCE-----------
SYA_CLOTE       ----------------------KVKIQDCRNNISGKILHFVEILEGSIKL----------
SYA_CALS4       ----------------------LIKVNDCKK-VGNKFIHIGTVERGLISV----------
SYA_LEPIN       ----------------------VFKVFDTQK-ENDSIIHFGEVLSGEFIV----------
SYA_DEHMC       ----------------------RFEVKNTLHLPNGVFLHQGRVINGCLKI----------
SYA_CHLAB       ----------------------TFIVSHTTSPKAGMVIHHGEVSQGQLHS----------
SYA_PARUW       ----------------------KFSVEDCVVPYKGLIAHKGKLNTGSLKN----------
SYA_AQUAE       ----------------------LFKVEDTQKPTEGIIVHIGKVLKGTLKV----------
SYA_CAMJR       ------------------------EVLDTQKFFNLNLSFIK--AGEELKV----------
SYA_WOLSU       IVA---------------------QVQGTKKYFGLNLSRIE--ALDEICE----------
SYA_HELPJ       EAA---------------------LVLDTKNFFGLNFSLLE--IKKALKK----------
SYA_BUCAP       -KKSR------------------FIVENTKK-YGDTIGHYGKLISGKIIV----------
SYA_BUCBP       -KTGK------------------FIVNCTKM-FGNIIGHVGTLASGYLNI----------
SYA_WIGBR       -KDGV------------------FSVIDTKK-LGNYFYHYGKVIQGILKI----------
SYA_BLOFL       -ECGV------------------FKVKNTKK-YGQIIVHIGVLISGIFLI----------
SYA_BLOPB       -ISGF------------------FQVSNTKK-YGQTIGHLGIVNSGTISV----------
SYA_COXBU       -EKGS------------------FRVKDTKK-QGDIYLHIGEMLQGHLNV----------
SYA_LEGPL       -KEFS------------------FQVDDTQK-VGQAVVHYGEVIKGELTL----------
SYA_ECOLI       -ANFS------------------FAVEDTQK-YGQAIGHIGKLAAGSLKV----------
SYA_PSYA2       -ATGV------------------FDVQDTKK-SGQAIIHYGVVTMGEIKT----------
SYA_IDILO       -NGPA------------------FEVTDTQY-IGKAIAHHG-VAKAAVKL----------
SYA_XANOR       -PGVL------------------IEVADTQKFAGQFHGHVGRISEGTLAL----------
SYA_ACIFR       -NDAL------------------FAVTDTQKPMGHLHVHLGRVESGRLQI----------
SYA_FRATT       -IGFE------------------FVVEDVQK-SGEAILHIGKLVKGHLNL----------
SYA_ZYMMO       NDLKM------------------TVTDTQK-PLGRIHAHIAKIEKGEIKI----------
SYA_RUEPO       RDHVA------------------LVEDSRKFADGKVYAHKVTMERGALAK----------
SYA_CAUVC       HGRES------------------RVLDTQK-QAGELHVHRVELA-SDLKV----------
SYA_GLUOX       PGVRV------------------EITDTQK-RNGDLIVHYGKVVEGTLKP----------
SYA_PELUB       EAFEF------------------EVSDVQK-KLGDLFVHYGKVKRGSVKL----------
SYA_RICFE       KDSEI------------------EVIDTLK-YLGSIIVHKCILKKGQIKI----------
SYA_ANAMM       TGVSGVKNSGGAN---------IAEVTYTRKA-SNLHIHECTITSGVFNV----------
SYA_EHRRW       VRRDGKDLFGSSN---------IADVTNTKNIFDGLYIHECIVKSGSLII----------
SYA_WOLTR       TPVLDTKIQKKNDRSCDRITEGIAIVENTNKV-NDLYLHRCIVKSGSICK----------
SYA_DESPS       -QGGQ------------------ASVYATQAEGTGLILHDLLVEEGELSL----------
SYA_GEOSL       -GSAH------------------VEVTETLRPFPDLIVHRGTVVEGTIRQ----------
SYA_DESVH       -PSGK------------------VRVVDTIKPSPELVVHHVEAVEGDILL----------
SYA_SYMTH       -PGLR------------------VEVEDCRKLPSGHHLHYGTVQEGFLEV----------
SYA_BDEBA       -DTNR------------------ARVINTTKI-DDIVLHHVEIEHGSFKV----------
SYA_CHLTE       RLD-----------------------VTDTRKDGEQIVHVVTSAHDKVRDCAVTPADVSF
SYA_BACFN       TIE-----------------------VIDTKKENNLPIHITKKLPEHPE-----------
SYAC_HUMAN      SSEDK-----------------TEFTVKNAQVRGGYVLHIGTIYGDLKVG----------
                                                                            

SYA_LEIXX       --GVPATSLVDADYRRGAKQAHSGTHIIHAALRQVLGSNAHQSGSYNKAGYLRLDFSWNQ
SYA_CUTAK       --GDRVTALVNPATRFGACQAHTATHVIHAALRELVGPSATQAGSYNKPGYLRFDFSATK
SYA_CORJK       --GQKVQATVDKAWRHQARQAHSGTHLIHAALREVLGPTAVQAGSMNKPGYLRFDFNYGE
SYA_THEFY       --DDTVHAAIDTGRRASVSRSHSATHLIHSALRNTLGPSAGQAGSENQPGRLRFDFTSDK
SYA_BIFLO       --GAEVNANIDLARRGAIARSHTATHMVHKALREELGPQATQRGSEDAPNRLRFDFQWSK
SYA_TROW8       --GEVVRASVDSANRFAACQSHTATHVIHAVVREMFGSTSVQMGSYNRAGYLRFDFSCSY
SYA_PROMA       --GDNVQCTVDSFSRRCAQANHTATHLLQAALKKAVDSDITQAGSLVDFDRLRFDFHFVR
SYA_SYNP6       --GDSVTAQIDRACRRRAQANHTATHLLQAALKLIVDEGISQAGSLVAFDRLRFDFNCPR
SYA_PROMP       --GQKVKTKVNDLARAKAAANHTATHLLQSALKVVVNESVGQKGSLVAFNKLRFDFNSSK
SYA_DEIRA       --GTRVRGVVSPERA-AIQRHHTATHLLHAALRAVLGGGVQQKGSRVAADQLRFDFSHGA
SYA_THET8       --GERVRAVVDPRRR-DTERNHTATHLLHAALRAVLGPHVRQAGSLVAPDRLRFDFTHPE
SYA_THEMA       --GQKVILRVDKKRREATMRNHTATHLLHAALKKVLGDHVRQAGSLVAPDRLRFDFTHFK
SYA_RHOBA       --GETCTAKVDVENRTALARAHSATHILHHALHTHVGRHAEQQGSKVEPDRLRFDFTNPK
SYA_FUSNN       --NKTYKLEVDVVKRLDTAKNHTATHLLHKALREIVGTHVQQAGSLVDSEKLRFDFSHYE
SYA_LACAC       --GQEYVLKIDKERREGLRHSHSATHLLHAALRQVLGEHTHQAGSLVDPDYLRFDFTAME
SYA_STRT2       --GANYKLEIDHSRRHRVMKNHTATHLLHAALHNIVGNHAVQAGSLNEQEFLRFDFTHFE
SYA_GEOKA       --GSRYTARVDEAKRMRIVKNHTATHLLHQALKDVLGRHVNQAGSLVAPDRLRFDFTHFG
SYA_STAS1       --NAEVSASVNHKERRSIKKNHSATHLLHAALKEVLGDHVNQAGSLVEADRLRFDFSHFG
SYA_MYCPN       --GDKVILVHDGKWRQLVKNNHSLEHLLHAALQNEIDPLIKQDGAFKSAQKATIDFNFSR
SYA_MYCGA       --NEKVELMHDENWRKLVRKNHSLEHILHATLKNTISETIKQSGAFKSAAKATLDFNYPT
SYA_MYCPE       --GEKVDGQINSFDRNIIRKQHSSEHLMHSALKRVVSPTIKQEGAFKSIEKITLDFSFNR
SYA_UREPA       --NEHVILQINEQDRKSITANHTAEHLLHYCLKHVLSPDIKQEGAAKYPHKVTFDFTYHA
SYA_MYCHJ       --NQPVFLKLDTKNRLNLERNHSGTHLLFASLRQEFGSEIKQLGSDNNEDRLTFDFPLNR
SYA_MYCMO       --SELINAEVDSNIRIGLERNHSGTHLVFNALSREFGKEIEQLGSDNNEERLTFDFPLSK
SYA_MYCPU       --SKELKCVVDAKNRKNLERNHSATHLLFKVLRDQIGPFVVQLGSNNNEKRLTFDFPSQN
SYA_MYCS5       --NYPVTCQVDLKIRRGLERNHSGTHLMFCALRNVFGNQIKQLGSDNNEDRLTFDAPFDS
SYA_MYCMS       --NDLINCRVDEEKRIYTMKNHSGTHMIHYALREVLGTSVMQSGSYNDENGLRMDFTYHR
SYA_ONYPE       --GQEVYACIEKTKRNQISYHHTATHLLEAVLQKQLGSHLKKQGSSVGFSSLRYDFNHFE
SYA_CLOTE       --QDTVNLTVDRLRRDAIRKNHSATHLLHEALKKIVGAHIEQAGSFVDEHRLRFDFNHFS
SYA_CALS4       --GDKVVAKIDVSKRKGAARNHTATHLLHKALKEVLGDHVNQSGSLVAYDRLRFDFSHYQ
SYA_LEPIN       --SQELEAEVEITRRERLKFHHSGTHLLNGALRTLLGDHVLQKGSIVSPEYLRFDFSHPS
SYA_DEHMC       --SEAATAHINEERRRDIARNHTATHILQTALREVLGEQVQQRGSVVTPDRLRFDFSHLK
SYA_CHLAB       --AQAVTAQVHCLRRKNISNNHTGCHLLHKALEMTLGDHIRQAGSFVDDTKIRLDFTHPK
SYA_PARUW       --GEMITASIDKKRRQKIANNHTATHLLHWALHQILGEHIKQAGSVVDPQRLRFDFSHHK
SYA_AQUAE       --GDTVHARVDKERRWDIMRNHTATHLLHAALRNVLGEHVRQAGSLVADKYLRFDFTHFS
SYA_CAMJR       --NDIVHARIDTEKREQIARHHSATHLLHHALREILGSHVSQAGSLVESNKLRFDFTHHK
SYA_WOLSU       --GETLEAVVSRE-RLEVQKHHSATHLLHAILRQKLGDHVAQAGSLVEKDRLRFDFSHPK
SYA_HELPJ       --GDQVIAQVSDE-RLEIAKHHSATHLLQSALREVLGSHVSQAGSLVESKRLRFDFSHAK
SYA_BUCAP       --NDSIYSKINHVYRNAIQLNHSATHLLHAALQKVLGKNAIQKGSLVSNTHLRFDFSYSG
SYA_BUCBP       --HDTVCAEINLPKRKSIQINHTATHLLHASLRKILGKHVFQKGSFISDQSLKFDFSHNA
SYA_WIGBR       --NNKITAYVNKIKRNKISLNHSSTHLLHYAINCLLDKNIIQKGSLICEKYLSFDFSYGK
SYA_BLOFL       --GEQVFAQVNRLKRKDISVNHSSTHLLHSALLKILGSHVTQQGSLINDKYFRFDFSHYN
SYA_BLOPB       --GEEIVAQVDQHKRKCISLNHSATHLLRAALSQVLGSHVTQKGSLVNDRYLRFDFYHHA
SYA_COXBU       --KDKVRAEVDVSRFDIMR-NHSATHLLHEALRRVLGERVMQKGSLVEAKRLRFDFSHAK
SYA_LEGPL       --DLSIHAQVDHIRRDAIRLNHTATHLLHAALKQIVGQHVQQRGSLVDAERARFDFSHFE
SYA_ECOLI       --GDAVQADVDEARRARIRLNHSATHLMHAALRQVLGTHVSQKGSLVNDKVLRFDFSHNE
SYA_PSYA2       --KQTADAQVLSSIRAASAKNHSATHLLHAALREVLGDAVTQKGSLVSSEVLRFDFSYDK
SYA_IDILO       --SDSVKAEIDSERRENIKRNHSATHLLHAALRNLLGEHVTQKGSLVEADKMRFDFSHFE
SYA_XANOR       --GDVLAGGIDVQRRGKTILNHSATHLLHAALREVLGTHVQQKGSLVAPDRLRFDFSHFQ
SYA_ACIFR       --GDMVVASVDEVARRATAAHHSATHLLHAALRNILGSHVQQKGSLVNPERLRFDFSHPE
SYA_FRATT       --NDELTARVSDKPRLATAANHSATHLLHKALKLVLGGHAEQKGSLVDENRLRFDFTHDK
SYA_ZYMMO       --GDDIQLQVDINHRNRLRANHSATHLLHAALRDQLGQHVSQKGSMVSAERLRFDFSHQK
SYA_RUEPO       --GDAVELEVDHARRSAIRANHSATHLLHEALREALGDHVAQRGSLNAADRLRFDFSHAK
SYA_CAUVC       --GDQVVASVDADRRNTTRSNHSAAHLVHAALHHVLGPHVAQKGQMVDGERMRFDFSHGG
SYA_GLUOX       --GMAVHAEIDHARRTAVRGHHSATHLLHEALRRQIGTHVTQKGSLNAPERLRFDISQPR
SYA_PELUB       --KDNVELKIDTQRRNNIRAYHSATHLLHEALRRVLGEHVTQKGSLVQSDRLRFDFSHMK
SYA_RICFE       --GENANFSIDIKYRQNLRIHHSATHILHAVLHEVLGKHVTQKGSLVAPTYLRFDISHSK
SYA_ANAMM       --GDTVDAAIDVDRRERLKANHSATHILHSVLRTHIDGNIQQKGSLVAEDKLRFDFNYAS
SYA_EHRRW       --GDIVSAEINSHRRKDLCANHSATHLLHYILRMEIDNNIMQKGSLVGNDKLRFDFSYNM
SYA_WOLTR       --DDIVTASTDKERRQNLRRNHSATHLLHFALRKILGDHVTQKGSLIAPDRLRFDFSHNT
SYA_DESPS       --GLEVTLQVDDEERKATASNHSATHLLQAALISVLGDHVKQSGSLVGPERLRFDFTNFS
SYA_GEOSL       --GDACDLKVAPG-RDATARNHTATHLLQSALRQVLGDHVKQSGSLVGPDRLRFDFTHFA
SYA_DESVH       --DQEVDLTVTEDDRVASARNHTCTHLLHAALRRVLGDHVKQAGSLVAPDRLRFDFTHIA
SYA_SYMTH       --GQQVEARVDARKRKDTQKNHTATHLLHKALREVLGTHVQQAGSLVAPDRLRFDFTHTG
SYA_BDEBA       --GTAVVTGVDPVERRNTAANHSATHLLHAALRKVLGTHVTQAGSLVDSQKTRFDFTHNK
SYA_CHLTE       DGVVSVKAAVDRDRRVATERNHTATHLLHAALRKVLGEHVQQKGSLVTPERLRFDFSHFS
SYA_BACFN       ---APMMACVDTDKRAACAANHSATHLLDEALREVLGEHVEQKGSLVTPDSLRFDFSHFQ
SYAC_HUMAN      ---DQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEAD-QKGSLVAPDRLRFDFTAKG
                                     *:  *::   :   ..    : *          *     

SYA_LEIXX       ALSPETRSEIEEISNSAIRQNLEVTTRELPLAEA-KALGAMALFGEKYGDT-VRVVDIGG
SYA_CUTAK       GLSDSLKDEIEERCNVAIHDDFEVTDTQMPLEDA-KAMGAMAMFGEKYPPI-VRVVELAG
SYA_CORJK       QLTEHQLNQIEEIANGAVDSDYQVNTIETSLEEA-KAMGAMALFGENYGSE-VRVVEIGG
SYA_THEFY       PLDATEIAQVEEEVNEVLARNIEVQYLETTLDEA-LRMGALAMFGEKYGNR-VRVVDMT-
SYA_BIFLO       APAKSVISAVEERVNDKLRDNLAVTTKEMKFDDA-IALGAMHLFGEKYGDI-VRVVSIGE
SYA_TROW8       APTDSQRIELEERANRAIQSCLEISSTYTTLEKA-VASGAIALFGERYGDT-VRMVEIGG
SYA_PROMA       PVSGAELEHIEKLINGWISEAHSLVISEMSINEA-KRVGAIAMFGEKYGEV-VRVVDVPG
SYA_SYNP6       AVTPEELRQIEDQINQWIAEAHGTVVEVMPIATA-KAKGAVAMFGEKYGAE-VRVIDVPG
SYA_PROMP       PITKDQIFKVETLVNSWILENHSLNIKNMAKSEA-LERGAVAMFGEKYDDE-VRVVDVPS
SYA_DEIRA       AMSAEEIAQVETLVSRWVSANFPVSWREMPIAEA-KAAGATALFGEKYGDV-VRVVRVEG
SYA_THET8       PLKPEELERVELLVNRWIMADFPVTWRYMPLEEA-RKEGAMALFGEKYGEV-VRVVRVEG
SYA_THEMA       GLSSAEIEQVEDLVNEWIMEAIPVEVRYTSYEEA-VKSGVVALFTEKYGDV-VRVVEVPG
SYA_RHOBA       AIDDETLVKIEQDVLGMVGKGDEIRWDTVSLADA-REAGAMMLFGEKYPDP-CRMVSMGT
SYA_FUSNN       ALTEEQLSKIEDIVNKKIREGIEVVVSHHSIEEA-KKLGAMMLFGDKYGDV-VRVVDVHG
SYA_LACAC       PMTPRELKSVEELVNQKIWDAIQVKTTITTPEEG-EKMGALALFDGKYGD----KVRVVQ
SYA_STRT2       AVTPEELRAIEEQVNEEIWKATPVTTIETDIDTA-KSMGAMALFGEKYGK----RVRVVS
SYA_GEOKA       QVKPEELERIEAIVNEQIWKSLPVDIFYKPLEEA-KAMGAMALFGEKYGD----IVRVVK
SYA_STAS1       PMTQEEIDTVERRVNEEIWNSIEVDIQEMPISEA-KQLGAMALFGEKYGE----IVRVVN
SYA_MYCPN       ALTWAELERVEHRIRQIIQQDIQREEIFTDLEGS-QKLNAIAYFEEEYSN--HELLRVIR
SYA_MYCGA       RLTDEDLDKIETKMRQVIADKIPVTVHHVDYETS-QKMNAIAYFEEEYKK--HELLRVIK
SYA_MYCPE       KLTYKEILGVEKEVKRIIATKNPTQVLMKTLDEA-KEMGAIGYFEQVYKKI-SGKLRVLY
SYA_UREPA       QPTKAQLDKLENVLNEMVQSNFDVQELHMDLDEA-KAVGAAAYFEDVYKKL-KGKLRVIK
SYA_MYCHJ       KPSDQEIKSVENRINSYINQKIKRKYLVTNLEEA-QKLNAIMTLEESEYMD-PNSLRLVI
SYA_MYCMO       KPSWEEIKNVEKRVNEYINMSVDREYIITTLEGA-KKLNAVMTLEEQEYMD-PNEVRIVN
SYA_MYCPU       KPSKEKIKEIEKQVRKIIELSIDRQYSNETIDKA-KEMGAIITIEETEYMD-PTNVRIVT
SYA_MYCS5       KPTNEEILKVENLVKSYIQKEVDRQYLIMGIDQA-KEINAIMTLEEAEYMD-SSKLRIVN
SYA_MYCMS       LPTNQELLKAQNLVLEKIKNKIDRQTYFCSLEESVKKHQALAFFTEKYDQ----IVRVIK
SYA_ONYPE       KITPQTLLQIEKEVNQLIQKSVPVKIEQLSIPDA-QKKYATLLEQNQKAKY-KDKVRIVS
SYA_CLOTE       SLTKEELKNVEKLVNKKIMEVIPVNTKVMNIEEA-KESGAVALFDEKYDEK-VRVVSLG-
SYA_CALS4       AVSKEELKKIEERVNEKIYEQLPVVVEEKNYEDA-LKEGAVALFTEKYGDK-VRVVKID-
SYA_LEPIN       SLTSEEIRQIESWVNESIRKNFPVETKELSIEDA-KKTGAVATFGEKYGER-VRVVQMG-
SYA_DEHMC       PMSKDEMRRVEEFVNDKIRRNLPVYAEEMPYRHA-LEEGVTALFGEKYGDR-VRVLRVGR
SYA_CHLAB       AIAPEDLASIELLVNEKIRENHRVETREAAYSDVMNSKEIKQFFGDKYSDV-VRVVSAG-
SYA_PARUW       ALSLEESRQIEDLVNQKIRENLPVKCYEIKYEEAQKKEDIKQFFGEKYGST-VRVIDID-
SYA_AQUAE       ALTEEELKRVEELVNEKIRENLPVNVMEMAYDEALKTGAI-AIFEEKYGER-VRVISCGE
SYA_CAMJR       ALNKEELESIEKRVNKMIINSSEAILENMPLEEA-KKSGAIALFNEKYQGN-VRVLTLGE
SYA_WOLSU       ALTHEEVGMVEEEVNRLISLSIPSRTREMRVDEA-KASGAMALFGEKYGDL-VRVVDFGE
SYA_HELPJ       ALNDEELEKVEDLVNAQIFKHLTSQVEHMPLNQA-KDKGALALFSEKYAEN-VRVVSFKE
SYA_BUCAP       NINLSQIQNIENIINKKIRSNDLIKIKNLSLEEA-KKKKAIALFDYKYQSS-VRVVFIKD
SYA_BUCBP       PMNLREIQEVENIINKKIQKNISVSTTLTTLQEI-QNKKVMALFQDKYKDK-VRMISIND
SYA_WIGBR       KINIEKINEIENIINEKIRDNVIIHSNNMDLKNA-LKIGAKALFKNKYKDL-VRVLNIGD
SYA_BLOFL       AITITQINEVENLINQQIWDNLLVTENIMLMESA-RNIGAIMLLHKQYTEK-VRVIQIGD
SYA_BLOPB       TMTTTQMNTVENIVNEQIWKNAPITVDVMPIELA-RNSGAVILINKQYDKK-VRVLKIGN
SYA_COXBU       PLTPEELQAVERLVNQQIQANLLSTIEVMTPEEA-KKKGALALFGERYGKE-VRVLEMGD
SYA_LEGPL       PLTPQQIQQIEEVVNAQIRANNEVITQVMDIESA-KQSGAVALFGEKYSDA-VRVLSMGD
SYA_ECOLI       AMKPEEIRAVEDLVNTQIRRNLPIETNIMDLEAA-KAKGAMALFGEKYDER-VRVLSMGD
SYA_PSYA2       PVSPAEIMRIERLVNEQIQANTPTRIENMPIDEA-IKQGAMALFGEKYGND-VRVLTMGT
SYA_IDILO       PVTTEQLAQLEREVNAQVRANLPLQTQLMAIDEA-KEAGAMALFGEKYDEQ-VRVVRMGD
SYA_XANOR       PITADELAVIERKVNAEVRTNHGVEVHNMAMQEA-LDFGAMALFGEKYGEN-VRVLKMGG
SYA_ACIFR       PVTAAQLREIERVVNAAIRNNVGAETRILPVAEA-QALGAMALFGEKYGDE-VRVVRMGD
SYA_FRATT       AISRSKIEQIELLVNQQIRANYPVTTIETSQQKA-KSLGAEALFGEKYGDI-VRVISMGD
SYA_ZYMMO       ALSDQELAAIEAEVNQQILNNSVVTTRLMTPESA-VEAGAMALFGEKYGNE-VRVLSMGS
SYA_RUEPO       ALTEAELAQVGAEVNRFIRQNSRVETRIMTPDDA-RAIGAQALFGEKYGDE-VRVVSMGR
SYA_CAUVC       PLTAEELDRIEAEVNEVIRQNVPAETKEMAPQEA-IEAGAVALFGEKYGDS-VRVLTLGK
SYA_GLUOX       PLTDEELAAVEAEVNARIRENAPVETRLMTQEEA-VAEGAMALFGEKYGDE-VRVVSMGK
SYA_PELUB       PISDEEIRKIEHYVNSIIEKKSEVKTRIMTPKEA-VENGALALFGEKYGDE-VRVLSMGD
SYA_RICFE       AVTNEEITLIEDKVNEIIRDNHEVDTTLMTTEDA-VKQGAMALFGEKYDSE-VRVVKMGE
SYA_ANAMM       ALTKEQIALIEREVNRRIMSNKPVLTDHCSFEAA-VQGGAIALFGEKYSEHSVRVVSMGD
SYA_EHRRW       ALTEKQIKLIENRMCDLIRQNHPVETNICNLQNA-MDNGAIALFTEKYDNHEVRVVNIGN
SYA_WOLTR       QVTRDQLSLIEDMVNSLIRENLSAFTKIQSMNQA-IGEGAMALFGKKYGDQ-VRVVNIGD
SYA_DESPS       QLTAAEIAQVETLVNEQIRNNAVIATDVLSKQEA-IAGGATALFGEKYDDD-VRVVSMGD
SYA_GEOSL       AMTPEEIRRVEEIVNSCIMANDDVHAREMALDEA-MEIGATALFGEKYGDT-VRVVRVGE
SYA_DESVH       PMTPEELAAVEREVNRVIMADIPLETDHMHYDDA-VKRGAMALFGEKYGDE-VRVVAIAD
SYA_SYMTH       PMTPEQIAAVEEMINAEIEAAEPVTWTEMPLDEA-RALGAMALFGEKYGEI-VRVVSVGD
SYA_BDEBA       PVSSEEIKKIEDLVNEQIARCNPVQTEMMSHKAA-LEKGAMALFGEKYASD-VRVLTMGD
SYA_CHLTE       KVSAEELEQVEHEVNAEIRKAASVTKHADVPYEEALALGALAFFGDKYADR-VRVVEVP-
SYA_BACFN       KVTDEELRKVEHLVNAKIRANVPLQEHRNIPIEEAKELGAIALFGEKYGDH-VRVIQF--
SYAC_HUMAN      AMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDP-VRVVSIGV
                                 :                                     :    

SYA_LEIXX       -P--------------WSRELCAGTHVARSAEIGLINLVSESSVGSTNRRVESLVGLEAF
SYA_CUTAK       -P--------------WSRELCGGTHVASTGRIGMLSLLGEQSVGSGTRRVEALVSTDAF
SYA_CORJK       -P--------------FSMELCGGIHVEHSSQVGPISVLGESSVGSGVRRIEAYTGMDSF
SYA_THEFY       -E--------------YSRELCGGTHVAATGQLGLVKVLGESSVGSGVRRVEALVGLDAL
SYA_BIFLO       DG--------------WSRELCGGTHVDHVGKIGMVNILSEASIGSGVRRVDAVVGQGAY
SYA_TROW8       -P--------------WSRELCAGTHLRNSSEIAVVSLVSETSVASGIRRVECLTGFDAF
SYA_PROMA       ----------------VSKELCGGTHVTNTAEIGLFKIVSETGIAAGIRRIEAIAGQGVL
SYA_SYNP6       ----------------VSMELCGGTHVANTAEIGLFKIISEAGVASGVRRIEAVAGPAVL
SYA_PROMP       ----------------VSMELCGGTHVKTTSELGCFKIISEEGISAGVRRIEALSGQSAF
SYA_DEIRA       DVDFGG-------HAVSSMELCGGAHVSRTGDIGAFVIVSDENVAAGVRRIEALAGEQAT
SYA_THET8       SP---L-------EGLESKELCGGCHVRRTGEIGAFLIRSEEAVSAGVRRIEAVTGEEAI
SYA_THEMA       VS----------------KELCGGTHVKNTGQIGLFKIISEESVSSGVRRIEAVTGFSAL
SYA_RHOBA       FS----------------RELCGGTHLTNTKQVGSFEVVVEESVSTGTRRIEALTGERAK
SYA_FUSNN       FS----------------TELCGGTHIDNIGKIGLFKITSEGGIAAGVRRIEAKTGYGAY
SYA_LACAC       MSDF-------------SSEFCGGTHVDNTDQIGIFKITSESAVGAGMRRIEAVTSKKAY
SYA_STRT2       IGDY-------------SVELCGGTHVANTAEIGMFKIIKEEGIGSGTRRILAVTSREAY
SYA_GEOKA       VGDY-------------SLELCGGCHVPNTSAIGLFKIVSESGIGAGTRRIEAVTGEAAY
SYA_STAS1       MAPF-------------SIELCGGIHVNNTAEIGLFKIVSESGTGAGVRRIEALTGKSAF
SYA_MYCPN       FGDF-------------SVELCGGTHVEHTGLIENCFITDYYARGTGRWRIEIISSNETI
SYA_MYCGA       IGDY-------------SVELCGGTHVDNTKEIEECFITNLYSLGAGRWRIEIMSSYETI
SYA_MYCPE       LCPE-------------SIEICGGTHVYNTGDIEDFMVTGLTSKGSGSWRIEAVSSNYLV
SYA_UREPA       MGP--------------SIELCGGTHAHHTSEIERIKIVECASKGAGSWRITMVTGHDNL
SYA_MYCHJ       FDKI-------------TTDLCGGTHIENTELLEKFTILSCQSKGSGIYRIRAVTSWNKY
SYA_MYCMO       FPKI-------------TADLCGGTHIENTKKIETFKIISLDSKGKNKFRIKAITSKKIV
SYA_MYCPU       FKNI-------------TSDLCGGTHIPNTKLIENFKIISVENKGTGIFRISAITTEKLV
SYA_MYCS5       FNGI-------------TADLCGGTHLENTKLLEDFKITSVEKKAAGVYRIRAISSKETI
SYA_MYCMS       FGDF-------------SSELCGGTHVNNTSEIEDFIITGIESKGSGLYRIKCLTSFRAV
SYA_ONYPE       IDTF-------------SVDLCGGTHATNTKDLEHFTILSCESISSGIYRIEAVCN-NNC
SYA_CLOTE       ---------------DFSKELCGGTHVSNSGEIGLFKIISETGVAAGVRRIEGVTGFNAL
SYA_CALS4       ---------------DYSMELCGGTHVKNTSEIGIFKIVSESAVGAGLRRIEALTGIEAI
SYA_LEPIN       ---------------DASIEFCGGTHVSRTGEIGYFFIKKESSPGAGNRRIEGVCGPAVI
SYA_DEHMC       --------------PAVSAELCGGTHVTASGEIALFKIMSESSVGAGLRRIEAVTGREAE
SYA_CHLAB       ----------------FSHELCGGTHADFTGDLGYFRILKEHAVATGIRRIEAVTGKEAE
SYA_PARUW       ----------------YSKELCGGTHTSALGNIGLFRILKESGIAAGIRRIEAVTGAEAE
SYA_AQUAE       ----------------FSKELCGGTHVSATGDIGYFKIISESSVGAGVRRIVAQTGRWSV
SYA_CAMJR       -----------------SKELCGGTHVKNTAQIGSFYIVKESGVSAGVRRIEAVVSKAAL
SYA_WOLSU       A----------------SVELCGGTHVENSAHIGSFYITKESGVSAGVRRIEAVCGMAAY
SYA_HELPJ       A----------------SIELCGGIHVENTGLIGGFRIVKESGVSSGVRRIEAVCGKAFY
SYA_BUCAP       ----------------FSIELCGGTHTKRTGNIGLFKIIEQSSVSSGIKRIEAVTGQQAI
SYA_BUCBP       ----------------FSVELCGGTHTKYTGDIGLFKITSEISISSGIRRIEAVTGKHAI
SYA_WIGBR       ----------------FSIELCGGTHANRTGDIGCFVITNFSKISSDTYRIKAITGETAI
SYA_BLOFL       ----------------CSIELCGGTHVSNTNEIGLFIITKEFGIGSGVRRIEAVTKNAAL
SYA_BLOPB       ----------------FSTELCGGTHAEHTGEIGVFMITKECSIAAGIRRVEAVTNNVAL
SYA_COXBU       ----------------FSTEICGGTHTERTGEIGLFKIVSESGCAAGIRRIEALTGKAAL
SYA_LEGPL       ----------------FSKELCGGTHARRTGDIGLFKIVAEYGIASGIRRVEMVTGRYAL
SYA_ECOLI       ----------------FSTELCGGTHASRTGDIGLFRIISESGTAAGVRRIEAVTGEGAI
SYA_PSYA2       DSIVDG------QRMPFSIELCGGLHVQRTGDIGVLKITSESGIAAGIRRIEAVTAMNAI
SYA_IDILO       ----------------FSMELCGGTHVKATGDIGLFRITSEGGIASGVRRIEVVTGEAAV
SYA_XANOR       ----------------YSTELCGGTHVTRTGDIGLFKITSEGGVSSGVRRIEAVTGQGAL
SYA_ACIFR       ----------------FSMELCGGTHVEALGDIGVFKILSESGVAAGIRRIEAVTGAVAL
SYA_FRATT       ----------------FSIELCGGTHVAYTGDIGLFKVTSEGSIASGVRRIEAVTADKAI
SYA_ZYMMO       CLNDQNE-----ES-SWSVELCGGTHVSALGQIGLFHIVSETAVSSGIRRIEAVTGEEAR
SYA_RUEPO       AETGKGA-----DGKTWSIELCGGTHVAQTGDIGMFVLLGDSASSAGVRRIEALTGQAAF
SYA_CAUVC       SLAD--------EAKAYSVELCGGTHVARTGDIALFKIVSEQGVAAGVRRIEALTGEAAR
SYA_GLUOX       GDDD---------RPAYSIELCGGTHVGRVGEIGPFRIVSESGVSAGVRRIEAVCGLAAE
SYA_PELUB       EEGK-----------FFSTELCGGTHVVNTADIGKFKIISQSSIAAGVRRVEALRDAQLI
SYA_RICFE       ----------------TSLELCGGTHVRRTGDIGCFKITSESAIAAGVRRIEAVCGEFVI
SYA_ANAMM       -----------------SKELCGGTHVRYTGDIGAFKIVSESGIALGVRRIEAITGQSVV
SYA_EHRRW       -----------------SKELCCGTHVKYTGEIGCFKIISESSIACGIRRIEAVTGQYAI
SYA_WOLTR       -----------------SKELCGGTHVERTGEIGLFKIITECSIASGVRRIEALTGQEAI
SYA_DESPS       ----------------YSRELCGGTHVGATGEIGLFVILSESGIAAGVRRIEALTGRAAL
SYA_GEOSL       ----------------VSMELCGGTHVHAAGDIGFFKILSEAGIAAGVRRIEALTGMGAL
SYA_DESVH       ----------------ESVELCGGTHLRATGQAGLFLIVSESGVAAGVRRIEALTGWNAM
SYA_SYMTH       G---------------WSRELCGGCHVSNTSEVQYFKILSESGIGGGVRRIEAVTGPGVI
SYA_BDEBA       ----------------FSCELCGGTHVKNTSEIRLFKIVSEAGVSSGVRRIEAITADNAL
SYA_CHLTE       ---------------GISIELCGGTHVGNIGQIGMVKIVSESSVAAGIRRIEAVTGAAAE
SYA_BACFN       ---------------GSSIEFCGGTHVAATGNIGMVKIISESSVAAGVRRIEAYTGARVE
SYAC_HUMAN      PVSELLDDPSGPAGSLTSVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQ
                                   ::* * *           :      .    *:         

SYA_LEIXX       KDLAVERTIVSQLSSSLKTPR---------------------------------------
SYA_CUTAK       RHMAAERALVNELTGILKVQP---------------------------------------
SYA_CORJK       RFLSTEKSLVSGLATSLKTPS---------------------------------------
SYA_THEFY       RRVSTESALVGQLSEQLKAPR---------------------------------------
SYA_BIFLO       DFNAREHALVSQLSDKLNARP---------------------------------------
SYA_TROW8       SHFAQERALVDTVMRTLGATR---------------------------------------
SYA_PROMA       DYLNDRDGVVKILSERFKAQS---------------------------------------
SYA_SYNP6       EYLNVRDAVVRDLSDRFKAKP---------------------------------------
SYA_PROMP       EYFSDKNSLVSQLCDLLKANP---------------------------------------
SYA_DEIRA       AWLRGRLNASAKAAALLNTSP---------------------------------------
SYA_THET8       RFARGSLNRLKALAERLEVGE---------------------------------------
SYA_THEMA       ELLRNQKKLIDQLKEILGARE---------------------------------------
SYA_RHOBA       EHREQTQALLNEVAGKLNCDA---------------------------------------
SYA_FUSNN       LVEKEEADILKNIEQKLKATN---------------------------------------
SYA_LACAC       EYLA-----NRSSLLDDIQEVVKAT-----------------------------------
SYA_STRT2       LAYR-----EEEDALKSIAATLKAP-----------------------------------
SYA_GEOKA       RFMS-----EQLAILQEAAQKLKTS-----------------------------------
SYA_STAS1       LYLE-----TIQSQFNAVKSQVKVK-----------------------------------
SYA_MYCPN       AAYLNEQNGKLSETINSLHNTLNNIANPALNKQK----------TALTKQLNHFHLPQVI
SYA_MYCGA       YNYLVDKQNEIKQEKDHMFNELGNYDLTHY--------------LDFSKKLHSFNLPNSI
SYA_MYCPE       DKFK---NNVIKKAIDDFNNYFKKYKELNIK--------------DDEVEKYKKTDINSI
SYA_UREPA       AKYI---HDLYVDYLNEINHLKVNLDINDHKL-------------NDLYNAFANWKNLSI
SYA_MYCHJ       FEFLKGKIQEILSKISALKNKIKKIEPNFGLN----------------------------
SYA_MYCMO       EEYLKDEISKNKLVLENLIEKNKSLFQGYKMN----------------------------
SYA_MYCPU       RAFNQEHFDNLIEQQQNIIKKIQKINPSFKYK----------------------------
SYA_MYCS5       EKYLENQKQELMQELLVLVKKLKDMQFDFKVS----------------------------
SYA_MYCMS       NEYLNEQFKVYKDQAESIIDKYNQNKDLLKND------------QLENIYLQIKNTTINK
SYA_ONYPE       QESLNAKLVPYQNDLHQLTQKAKSLQTQNLIF-------------------DVKNFPPIT
SYA_CLOTE       KYIEEKEALLEGLCEVLKCSNK--------------------------------------
SYA_CALS4       KYLNEQKEILDRVSETLKAQEK--------------------------------------
SYA_LEPIN       ETFQNRFSELTESVQNLNLKIKSELGEEGTKILILSFIPGPDEIREKLEKEGASAVSFFR
SYA_DEHMC       AFINLQQDSLSELSGMLESTAE--------------------------------------
SYA_CHLAB       VLARQDNQDLNEIALILQSPR---------------------------------------
SYA_PARUW       LLQRQDEDLLRTLAQQLKVPI---------------------------------------
SYA_AQUAE       ETAFKEHQTLKKASSALGVGE---------------------------------------
SYA_CAMJR       EFVKNQLEELSKVKDELKN-----------------------------------------
SYA_WOLSU       HYGKEALQEIAEAKEILKA-----------------------------------------
SYA_HELPJ       QLTKEENKELKNAKTLLKN-----------------------------------------
SYA_BUCAP       DYLHIKDNDMQNISFLLKCQ----------------------------------------
SYA_BUCBP       SIIHHQEKTINNIANMLNSK----------------------------------------
SYA_WIGBR       AFIQKKFNDINTISSLIKSN----------------------------------------
SYA_BLOFL       SVIQNKKKLIQNIAQIAQSD----------------------------------------
SYA_BLOPB       SAIHQYKMLLKNIFQSTQSD----------------------------------------
SYA_COXBU       DYIESAEQQLRSLSDLLKTN----------------------------------------
SYA_LEGPL       AWVNEQLGFMNNLAATLKTT----------------------------------------
SYA_ECOLI       ATVHADSDRLSEVAHLLKGD----------------------------------------
SYA_PSYA2       KNIQQSEQQLSELASQLKVK----------------------------------------
SYA_IDILO       RYTQQQQSVLQQIAGELKTE----------------------------------------
SYA_XANOR       DYVADEERRLLEAAHLLGGN----------------------------------------
SYA_ACIFR       EAIQRDEERLQAAAGLLKVA----------------------------------------
SYA_FRATT       RHTFTNENKIIAIKDSLKAN----------------------------------------
SYA_ZYMMO       LWLVGRDRLLRETASILKAV----------------------------------------
SYA_RUEPO       DHLSQEGARLSQVTAMLKAQ----------------------------------------
SYA_CAUVC       RFLLDQAGVAKALADQFKTP----------------------------------------
SYA_GLUOX       ALALETESRLKQIADLLKVP----------------------------------------
SYA_PELUB       DFLKEKENQSNLSDQKNEAV----------------------------------------
SYA_RICFE       KLMREKDSLLKSIESSLKTN----------------------------------------
SYA_ANAMM       DGLRKDGDILLHISERLGVP----------------------------------------
SYA_EHRRW       DYFRQQEKVLYQVAESVKSP----------------------------------------
SYA_WOLTR       DYARDNEINLRKIAELVKAP----------------------------------------
SYA_DESPS       AYVQGRLSTGNELADLLSC-----------------------------------------
SYA_GEOSL       RHVQQLEDERKEIAALIKA-----------------------------------------
SYA_DESVH       HAVLAQRSEQAQLSAMLKA-----------------------------------------
SYA_SYMTH       RHLEEAQARA--------------------------------------------------
SYA_BDEBA       QYMMSAVTHLDDALAAAGFQKSPHYIKHLETTG---------------------------
SYA_CHLTE       ALLWQEYRDLQEIKNLLKLKADEE------------------------------------
SYA_BACFN       EMLDTIQDTLSDLKALFNNTPD--------------------------------------
SYAC_HUMAN      KALRKAESLKKCLSVMEAKVKAQTAPNKDVQREI-------------------ADLGEAL
                                                                            

SYA_LEIXX       ---EQLPEKIADLMA-------SLKAAEKRIQA-----------FEARAVLDRVQGLLEA
SYA_CUTAK       ---DQLADRVSKLAA-------DLKEAERKLGA-----------ARTRELLGQVDDIVAG
SYA_CORJK       ---EELPDRIDALTA-------KLKAAEKQIQQ-----------LRAQQLQGQVGQLVEK
SYA_THEFY       ---EELPQRIDSLVS-------RLRAAEKEIER-----------LRAAQVLQAAGKLAES
SYA_BIFLO       ---DELAERVNALLA-------KLKESDRRLAS-----------MYESQLAASVPALVAD
SYA_TROW8       ---QEMEGAIDDLRE-------NLKRSKHALQT-----------AKDKFLSAFAPRLLQE
SYA_PROMA       ---NEIVDRVIALQD-------EVKSLTKLLVK-----------AQDEVAFTKALSLKNK
SYA_SYNP6       ---EELSDRVTALQE-------ELKANQKQLTA-----------LKAELAIAKSDALVSQ
SYA_PROMP       ---NQLLDRVNSLQS-------ELINKNKEIQK-----------MKDEIAYFKYSSLSSS
SYA_DEIRA       ---EGLEERVSGLQG-------QLKAAEKETA-------------QARRQLAEAQMGGGG
SYA_THET8       ---AALEERLEKLLA-------ELKEKEREVE-------------SLKARLVQAALGGGG
SYA_THEMA       ---DELTDRVLSLRE-------KVKELEKKLS-------------QGRISEERIAM----
SYA_RHOBA       ---SVAAAATVALIE-------EVRRLKKELSSGKAADYPAEFVFDAKAAKAETTDISDY
SYA_FUSNN       ---SNLVEKVEKNLE-------TLKDTEKELE-----------ILKQKLALFETKA----
SYA_LACAC       -KPENIVDKIDSIEN-------ELRDSQKQVEA-----------LTKKINQAKAGEIFDN
SYA_STRT2       -QLKEVPNKVASLQE-------QLHALQKENAT-----------LKEKAAAAAAGDVFKD
SYA_GEOKA       -PKE-LNARLDGLFA-------ELKELERENES-----------LAARLAHMEAEHLTRQ
SYA_STAS1       -SDDQVLEKIVHMQD-------EEKELTKQLEQ-----------KNKEVTSLKMGDITNQ
SYA_MYCPN       TDLRKCQALLNELKI-------TVNELKTEDFK-----------WKQKQLAEKIKQELLE
SYA_MYCGA       KDLRKTLRAFEQIKE-------EYKAIKLELDK-----------KKTKDRANQIKK--LA
SYA_MYCPE       H-YLELKEINEILKN-------KINTLVIRKEK-----------ENLSKESNEIKN---K
SYA_UREPA       DDYDLLNEKFAELKQ-------SLINFKIEFDK-----------QNAKQAIIDIKN---T
SYA_MYCHJ       LPNLVDLEQQFDYLK-------KIEDDLRIYYK-----------KLLKSQLRIAKSELDA
SYA_MYCMO       FSWSKNLDEQNEQIT-------KHIDQARSDYK-----------KLLKNSENKLEKLESD
SYA_MYCPU       NQFKSDDLEQRQVEV-------EESILALQQEF-----------KKALKSQENVEINFEN
SYA_MYCS5       LDESLELSSQIQEIK-------NLTNLASEAIK-----------NKIKENSKKISIDLNE
SYA_MYCMS       DNLLVIKNLLDQSKE-------VNKDYDKKVND-----------LITANKLLKYKDLTPS
SYA_ONYPE       QSYQDILNYQKHIKA-------QQQALVLFEKK-----------VLEYHQKNMVQAESNF
SYA_CLOTE       ----DIINKATSQIE-------EIKNKEKEINN-----------LKSKLASGSQEDILKN
SYA_CALS4       ----EVVSKIENLQQ-------SLKDKEREIEG-----------LKTKIASILAETLIDS
SYA_LEPIN       DLSENIATKIEENTS-------SFLKIKKNLAE-----------RDFENNTSVIENVLAS
SYA_DEHMC       ----ESPRKLAELKE-------EIDTLKKAVQN-----------LERQMSRGEAEELLSK
SYA_CHLAB       ---DQILNKLQNILD-------EKKEQTKLISD-----------LENKLIYSLLDKVIDR
SYA_PARUW       ---HQVLEKLEKLQE-------ENKQFIAELKE-----------IKKKELNVLINGFIKK
SYA_AQUAE       ---EEVIQKIEELKE-------EIKDREREIQR-----------LKQELLKLQIREVVKE
SYA_CAMJR       ---NDILSGIKKLKNEIL-------SLKNELKNSSK-----------TELDSKN------
SYA_WOLSU       ---KELKLGIEKLKEQVR-------ELKSEMSALSS-----------SKSGAISEGV---
SYA_HELPJ       ---NDVIAGINKLKESV----------KNSQKAPVS-----------MDLPVEK------
SYA_BUCAP       --NSKITEKIKKIII-------QVEKLEKKTDQLQK-----------RENIYQIKKLSK-
SYA_BUCBP       --TNNIEQTITKLLN-------NNIHLKKQIYTLYN-----------QNIYNIVNSLSK-
SYA_WIGBR       --SNEIVNKIEKITE-------NLKILEKKNKNLKN-----------KIIKNYIKLIFN-
SYA_BLOFL       --DVNLLNVIHEFKA-------RYEKLDREIKLLNS-----------KQEIQKVLSLVR-
SYA_BLOPB       --DKNILSKIHEFKC-------RYQKLEKEIDTLRN-----------QQIIQQSLSFIK-
SYA_COXBU       --RKNLAAKLSQILE-------DHRKLEKELAKLKQ-----------RLASQQLESLIN-
SYA_LEGPL       --PNSLQEKVSQLLL-------DNKNQEKMIAKLLS-----------EKAQKSGADILG-
SYA_ECOLI       --SNNLADKVRSVLE-------RTRQLEKELQQLKE-----------QAAAQESANLSS-
SYA_PSYA2       --RPEVAQRVRTMAD-------KQRDLEKQLERLEQ-----------KIASAQAANLLD-
SYA_IDILO       --PSSVAEKVQQLQH-------KFRELERKNEQLQQ-----------KLAQQAGGGLIA-
SYA_XANOR       --ATEVVDKVRALTE-------RQKRLQRELESLKA-----------KLASGATADLGA-
SYA_ACIFR       --PAELDQRLAQTLE-------RLRQLEKELEKVKR-----------DEAVRAGAGLAA-
SYA_FRATT       --DTNLIDKIKSMLE-------QIKNQEKQIAKLKK-----------ELLSGSSNDI---
SYA_ZYMMO       --PEEVPTRTAAILD-------ERRKSERALADAQK-----------ALALANANGGQGG
SYA_RUEPO       --PAEVAERVRALMD-------ERKALQNEVAQLRR-----------DLAMAGGAGQGGG
SYA_CAUVC       --VAEVATRVDALIA-------DRKRLEKELAEAKK-----------QLALGGGGAASG-
SYA_GLUOX       --VADAASRVAALLE-------ERKSLTAQVSDLQR-----------KLATGEGT-----
SYA_PELUB       --IKELETKIIKLGGKPNLQNKDQVTLIKDLNRQFD-----------QLSVISILKDKDK
SYA_RICFE       --KNELITKVNNILE-----------RNKELEKELE-----------KVHLARLDLSIEQ
SYA_ANAMM       --VGEVSEGLERLLK-------EKLELKKKLVCAWH-----------EIIKSSIS-----
SYA_EHRRW       --VEDVLVQIDKINR-------ENQELKQKLWAAYF-----------DIIDMQGV-----
SYA_WOLTR       --VNEITSRLSILNQ-------ERKESETKIKSLYK-----------KLVSAENI-----
SYA_DESPS       -KSGDLVPKVESLLT-------AVKEGEKRVAQLAG-----------QLASSGLDDLLN-
SYA_GEOSL       -EGGDNVERLQRLLT-------RQKDMQREIETLES-----------RLNAARSADLLA-
SYA_DESVH       -RPGEIVSRVESLQK-------ENRTLRKDMERAAA-----------QATSGQGRNIMD-
SYA_SYMTH       ------VEAQEQLRS-------RMKEMEKELEQLRA-----------KLAASQTDSLVE-
SYA_BDEBA       -ETATLANRVESLKD-------QVKQLEKEMKKLQGG--------QVNVDDLAANALTF-
SYA_CHLTE       -----AGPKIKELLE-------EKKALDKQLQESRLA----GLLDRLAASLAGGEEVNGC
SYA_BACFN       -----LGVAIRKYID-------ENAGLKKQVEDFMKE----KEAAVKERLLKNVQEINGI
SYAC_HUMAN      ATAVIPQWQKDELRE-------TLKSLKKVMDDLDRA----SKADVQKRVLEKTKQFIDS
                                                                            

SYA_LEIXX       VS-------------------------------------------------------RRG
SYA_CUTAK       TT-------------------------------------------------------PAG
SYA_CORJK       AE-------------------------------------------------------TIG
SYA_THEFY       AR-------------------------------------------------------DHG
SYA_BIFLO       TK-------------------------------------------------------NSA
SYA_TROW8       FK-------------------------------------------------------SVS
SYA_PROMA       VV-------------------------------------------------------SLT
SYA_SYNP6       AI-------------------------------------------------------PVG
SYA_PROMP       AN-------------------------------------------------------KVG
SYA_DEIRA       S----------------------------------------------------AAQTREL
SYA_THET8       -----------------------------------------------------GASLEEK
SYA_THEMA       --------------------------------------------------------KQLE
SYA_RHOBA       NAVRAAVRGLTRRLNVAITDVLSRLDSLLADRSKLVEQLKQVTAGGKISADDLIADGTKV
SYA_FUSNN       ----------------------------------------------------AISGMEEI
SYA_LACAC       VKQA--------------------------------------------------------
SYA_STRT2       VKEA--------------------------------------------------------
SYA_GEOKA       VKDV--------------------------------------------------------
SYA_STAS1       VEEI--------------------------------------------------------
SYA_MYCPN       LAKQ--------------------------------------------------------
SYA_MYCGA       LDNL--------------------------------------------------------
SYA_MYCPE       FTEV--------------------------------------------------------
SYA_UREPA       FNTQ--------------------------------------------------------
SYA_MYCHJ       NKII--------------------------------------------------------
SYA_MYCMO       FSIM--------------------------------------------------------
SYA_MYCPU       LEFE--------------------------------------------------------
SYA_MYCS5       IELE--------------------------------------------------------
SYA_MYCMS       LNKD--------------------------------------------------------
SYA_ONYPE       LPPQ--------------------------------------------------------
SYA_CLOTE       IKEV--------------------------------------------------------
SYA_CALS4       AISV--------------------------------------------------------
SYA_LEPIN       SVDT--------------------------------------------------------
SYA_DEHMC       AEDY--------------------------------------------------------
SYA_CHLAB       CQQIED------------------------------------------------------
SYA_PARUW       IEQLGN------------------------------------------------------
SYA_AQUAE       -ENVGD------------------------------------------------------
SYA_CAMJR       ------------------------------------------------------------
SYA_WOLSU       ------------------------------------------------------------
SYA_HELPJ       ------------------------------------------------------------
SYA_BUCAP       ----------------------------------------------------------KI
SYA_BUCBP       ----------------------------------------------------------HN
SYA_WIGBR       ----------------------------------------------------------KI
SYA_BLOFL       ----------------------------------------------------------EV
SYA_BLOPB       ----------------------------------------------------------DV
SYA_COXBU       ----------------------------------------------------------QV
SYA_LEGPL       ----------------------------------------------------------EI
SYA_ECOLI       ----------------------------------------------------------KA
SYA_PSYA2       ----------------------------------------------------------EV
SYA_IDILO       ----------------------------------------------------------QA
SYA_XANOR       ----------------------------------------------------------AA
SYA_ACIFR       ----------------------------------------------------------EA
SYA_FRATT       ----------------------------------------------------------KE
SYA_ZYMMO       NNA-------------------------------------------------------AP
SYA_RUEPO       --A-------------------------------------------------------ET
SYA_CAUVC       -----------------------------------------------------------P
SYA_GLUOX       --S-------------------------------------------------------AT
SYA_PELUB       NKI-------------------------------------------------------ND
SYA_RICFE       IEK-------------------------------------------------------QA
SYA_ANAMM       ----------------------------------------------------------PV
SYA_EHRRW       ----------------------------------------------------------NI
SYA_WOLTR       ----------------------------------------------------------KS
SYA_DESPS       ----------------------------------------------------------NA
SYA_GEOSL       ----------------------------------------------------------DV
SYA_DESVH       ----------------------------------------------------------EA
SYA_SYMTH       ----------------------------------------------------------RA
SYA_BDEBA       ----------------------------------------------------------KT
SYA_CHLTE       R-----------------------------------------------------------
SYA_BACFN       K-----------------------------------------------------------
SYAC_HUMAN      NPN-------------------------------------------------------QP
                                                                            

SYA_LEIXX       A-VQVVAADAGTLST----------ADDLRLLAITVRDRLG-SDPATVALAALA----GG
SYA_CUTAK       S-FDLVAAKVPGVA-----------GSDLRTLAAEIRARVK-DRPAVVTLIGGT----HD
SYA_CORJK       E-VKVLAEQLPEGVA----------AGDLRTLAMDAKNRLG-SEPAVVVFASVD----GE
SYA_THEFY       N-SRVVTHRVEDGTT----------ADDMRKLALDVRGRLGEDRPAVVAIAGVP----SD
SYA_BIFLO       APVKVAVKNVGHFGA----------VDALRKTVLDVRAQLGEDAPVVVALAGVNE---DD
SYA_TROW8       S-VRILIADLSKFLSGPLFSPFEFTAEDIRAVTLRCKKLLE--EPHVLLLAAVISGRVHA
SYA_PROMA       N-SQYLIERLDGVTG-----------DAIQSVVKTLVDELG--DNAAVVLAGMPDLNDQK
SYA_SYNP6       D-AQVLVETLTGVDA-----------AALQTAAERLQQKLG--DAGAVVLGSSPEEG---
SYA_PROMP       L-FSLIISQLDGLDG-----------NSLQSAALDLTSKLG--DKSVVILGGIPDKEN-R
SYA_DEIRA       GGFKVASLKLSGIEG-----------NELRGAADKLLDQSGAD-LVVIASD---------
SYA_THET8       GGLRWTVAELPGLDA-----------KALRQAADDLVAR-GAD-VALVLSG---------
SYA_THEMA       DGVKVFHGVFEGVEA-----------KHLGGIADNVLKKEGEG-IVILFSKFEN------
SYA_RHOBA       GDTLLIVAETPGANP-----------NIMRGWIDQIRKKSDTPTAVLLASSMND------
SYA_FUSNN       GGVKVLIAAFKDKST-----------EDLRTMIDTIK--DNNEKAIIVLASTQD------
SYA_LACAC       -GDLTVIAAIADVNG-------------MNDLRELADNWKSGNKSDVLVLAAEND----G
SYA_STRT2       -NGVRYIASQVEVSD-------------AGALRTFADQWKQADYSDVLVLAAHIR----E
SYA_GEOKA       -NGVPVLAAKVQAND-------------MNQLRAMADDLKQKLGTAVIVLASAQG----G
SYA_STAS1       -NGLKVLATEVDVPN-------------AKAIRETMDDFKSKLQDTVIVLISNID----G
SYA_MYCPN       -DKAYVLASFAAVDP-------------KLLSQVAQAVLNQHKNKLFVLLNQFNN----S
SYA_MYCGA       -EHKIVLLFFDKEEH-------------KALSIAHSELVNEKPDHLFFFINKSDN----K
SYA_MYCPE       -KESTKLFLLKDIDR-------------KLLFNSLVLAINEAKSTVFLVINEVDG----V
SYA_UREPA       -LTNKRVHVFKNTDN-------------KNIFNALNELINENQDTLFISFNLDDN----K
SYA_MYCHJ       -EIGKFSFYLDFNLP-------------LHNLKQIAATWREQNPRISFILGANLV----N
SYA_MYCMO       -KFKNTEIIFDMNLK-------------MASLQSLVATLREKNPKAIVILGSEIS----K
SYA_MYCPU       -NIANYKVYINLEAD-------------KNTIKAQGAQLREKFDDLLIILASVE-----K
SYA_MYCS5       -NINGNYLYLNDEIS-------------KEEIKNLSGVIREKFPNALVILISKG-----E
SYA_MYCMS       -NINEIRLETTDLNI-------------KDLKQLADDLRNKYNDLIVILLSSTNE----N
SYA_ONYPE       -ITKKMMLTIEEEKP-------------LEVLKFFMNHIFDKYHLEVLFLSYVQP----E
SYA_CLOTE       KGIKLVSGVLKDIDG--------------GALRDLADKLRDKIQEGLVVLASVGE----G
SYA_CALS4       DGVKVIASRVEDYDM--------------EALKTLGDILKDRLKSAAVILASSSK----D
SYA_LEPIN       GIGKIVSAIFEDKDP--------------NSLKGLSDNLKVREKNLLVILGSRNS----E
SYA_DEHMC       KGVKLLVSRMTSVNA--------------DTLRETADFLRDKLGSGVIVLGTVTE----D
SYA_CHLAB       --VSYFIYHLPESE--------------SHRLQQYANCLHQKIPVRLVSLWTTQKNG---
SYA_PARUW       --TSVLILETALS---------------VEELRLCVDLISDQIPSAVIILGAAFPD----
SYA_AQUAE       --FTLHYGVFEEVE--------------PEELRNLADMLRQRTKKDVVFIASRKGD----
SYA_CAMJR       --IQGVEICVKRIDNG--------------DIKAMIDDFKNKFAKAVILLIQVKDE--KI
SYA_WOLSU       -MMGETRVIVETLEAG--------------DIKNSIDEIKNRYEKVAVLLLQVKEE--KV
SYA_HELPJ       --IHGVNLVVGVVEQG--------------DIKEMIDRLKSKHEKLLAIVFKKENE--RI
SYA_BUCAP       NNIKGINLLINTFTNY-----------DQKSMKMIIDQLKKELKISIIIFINKNKN--DF
SYA_BUCBP       ILIKDVNIIIKNLKNE-----------NLLSLRNIVDKLKNRFKCSVIIISSIINN--KS
SYA_WIGBR       KKINNFEIIMDYFNEEI----------DKIILREILNKVKTNLKNGIVILASIKKD--NL
SYA_BLOFL       YYIKNVRVLVNHVKNM-----------ESSSLFKMVKLLKHYLQSGIVVLINIRKNN-IA
SYA_BLOPB       YYIKDVRILVKQVVNM-----------TSKTLFNMTDCIKHQLKSGVIVLINLNTNK-KI
SYA_COXBU       VDVHDIRTLAIRLEAV-----------DRETLRAIVDQLKQKLGKAAIVLATIEEG--RI
SYA_LEGPL       EEIKGINLLIKQLEGM-----------DSQTMRHTMDQLKSRIDSAVIILFTIEQN--KM
SYA_ECOLI       IDVNGVKLLVSELSGV-----------EPKMLRTMVDDLKNQLGSTIIVLATVVEG--KV
SYA_PSYA2       QTIAGIPLLISTLSGV-----------DGKSIRTLMDDIKSKLPDSVIVLIGDKDE--QL
SYA_IDILO       VDINGVKAIIAELDQA-----------DPKSLRGLVDDLKNQMGSGIVLLGTANGD--KV
SYA_XANOR       IDVAGVKVVAVRLEGF-----------DAKALRDAMDRLKQQLGDSVIVLAGASGG--KV
SYA_ACIFR       EDVGGVPVLIRRLEGM-----------DGKALRDALDRLRSQLPDGVIVLAGVERE--KV
SYA_FRATT       TNIGDIKVVVANVDGV-----------DVKTLRNKIDDYKSKNTKVIAVLTTTNAD--KV
SYA_ZYMMO       EKVGAYQFIGQVIEGL-----------DPKALRGLIDENKKIIESGVIALITVNEG--RA
SYA_RUEPO       HEVGGVPFLAQVLSGV-----------SGKDLPALIDEHKSRMGSGAVLLIADAGG--KA
SYA_CAUVC       EDVNGTALIARVLDGV-----------GGKELRGVAEEFKKQLASGVVALVGTSDG--KA
SYA_GLUOX       ESINGITLSARDLGDV-----------SPKELKGLAESISKQIASGVVALMSSADG--RG
SYA_PELUB       QTINGFKVRFQNIIDL-----------PFKDLRKLIDEGKKEIGEGLVVIYAINDN--KV
SYA_RICFE       EDIKGVKLIYRYIENL-----------DNKVLRQAAENLTKKVEDLIVVYITGNND--KL
SYA_ANAMM       NCGAGVVLHCGYFPTI-----------PVDAIMEFMKSA-RKAERGIFAIATAVDG--KA
SYA_EHRRW       EKIGNINFLHGTLSSV-----------PIDVVRKFIMK--RLVKDMIMLFSNVVNH--NK
SYA_WOLTR       IEINGMNFVSHSFTDI-----------PANIVREFTLQ--QQKPKTVIAFTAMEKN--KT
SYA_DESPS       LTVAGIKVVVAEVPLE-----------NAKALRELGDKVRDNLESGIAVIGGAV-GG-KV
SYA_GEOSL       REVNGVKVLATLAEVD-----------DPKKLRELADTLKDRLGSGVVALGCVK-EG-KA
SYA_DESVH       TDVAGVKLLAAKVEVP-----------NVKALRDLMDDVRSKLVSGIACLAAVD-GD-KV
SYA_SYMTH       QEVGGVKVVAGTAPVA-----------TMEDLRNMTDAIRAKLGSGVVVLGAVTSEG-KV
SYA_BDEBA       KAGASAKLVLADVPLD-----------DRQVLAEVTDHLKNKIQSGIVVVVGQG-DG-SH
SYA_CHLTE       --IMTERLDGVSGDE----------------LRQAAVALRERVPCAVGLLCGVADG---K
SYA_BACFN       --VIKFCLP-MPAEV----------------VKNIAFQLRGEITENLFFVAGTVDA---N
SYAC_HUMAN      LVILEMESGASAKAL----------------NEALKLFKMHSPQTSAMLFTVDNEA---G
                                                                            

SYA_LEIXX       KPVVIVATNQAARDAGVTAGALAKTAAGVLGGGGGGKADLAQG-GGTDATAIPAALAAVS
SYA_CUTAK       KPAMIVATTESARAAGAKAGALIKVGVAPIGGRGGGKDDMAQG-AGSDPTGIDAALRAVN
SYA_CORJK       KVPFVAAANDAAVDKGIKAGELVKTFGEKVAGRGGGKPAMAQG-SGSDAAGISAGIEAVK
SYA_THEFY       RPVVVVAINKEAQQAGLKAGELVGVAARALGGGGGGRPDIAQG-GGSDVTAIDTALRLVE
SYA_BIFLO       KPMVAVATNEAARKAGIKAGDLVRGAAKVLGGGGGGKPDFAQG-GGVDASKIDEALEALK
SYA_TROW8       ACSIDLSSVKLSCMDDLSANNLIKVFLKTLDGSGGGRADFAQG-AGWNAKLLDSALDNLK
SYA_PROMA       KVILVAAFGSEIIAQGLHAGQFLGPIAEICGGGGGGRPNFAQA-GGRDPTKLDDALDLAK
SYA_SYNP6       KVTLVAAFGPAIIAKGLKAGQFIGGIAKICGGGGGGRPNLAQA-GGRDASKLPEAIAAAL
SYA_PROMP       KLLFVVSFGEDLVKRGMHAGKLINDISRICSGGGGGKPNFAQA-GAKDIDKLNDALEYAR
SYA_DEIRA       -KGLVVKATKDAVAKGAHAGQLVSKLAAAGGGKGGGRPDMAQA-GITDAAGALGALDTAF
SYA_THET8       -GQAVLKLSPKAQGMGLEAGALFRALAEKAGGRGGGKGALAQG-GGLDPRKAREALPGLL
SYA_THEMA       KVSLVVKVSENLLGK-YDASSIARNIAKELGGNGGGRKNFAQA-GGRHPERIKDVLERLE
SYA_RHOBA       KVMLVGGLSRDLVDRGLKAGDWVGAAAKVVGGSGGGRPDMAQA-GGKDASKLPEALQQAR
SYA_FUSNN       KLAFAVGVTKTLTDK-IKAGDLVKKLAEITGGKGGGRPDFAQA-GGKDEGKLLDAFKEVR
SYA_LACAC       KANMIISLDQRALDKGLKAGDLIKKAAPLFGGGGGGRPNMAQA-GGKKPEGLNDAIKAVI
SYA_STRT2       KVNVLVASK----SENVHAGNLIKVLAPIVSGRGGGKPDMAMA-GGSDANSIQDLLSAVA
SYA_GEOKA       KVQLIAAVTDDLVKKGFHAGKLVKEVASRCGGGGGGRPDLAQA-GGKDPSKVGEALGYVE
SYA_STAS1       KVSLVATVPKALTDK-VKAGDIIKNMAPVVGGKGGGRPDMAQG-GGTEPKNITESLRFIK
SYA_MYCPN       PSFML---------LGQDVSKCIQLLKAHFELKGGGSNNFFRG-SFNESVDVSKLQAILD
SYA_MYCGA       INYLIGIKN---ATYKLNAKLLIDKVNAMFGAKGGGKQNFAQG-GFSTDKDVGKLKADFV
SYA_MYCPE       IQYVLCSNESFAKNNNLDFNLYAKDLNAKLGGKGGGRSYLVQG-TILK-IDEKELNKILD
SYA_UREPA       IQYLLAINEKFATTNQINLNKYIKELNTISNGKGGGKPYFVQG-GTSE-QEK--LDELLT
SYA_MYCHJ       NEFLIIVSS-----AILASNQILEKIFEIFTGSGGGNYKIAQG-KIQKKPEK-EVFIKLL
SYA_MYCMO       GKFFICVGS-----KEFSAKDISNIIFEKYKGKGGGNNILSQG-SIDKKIEKAEDLFELL
SYA_MYCPU       NSTILTIAS-----KKYDSNKIFNLLKSEYSLKGGGNAILVQG-FTSDKITKDKILKVLN
SYA_MYCS5       AQSAISFAS-----KKYNSINVLKELANHFELRGGGNAILAMG-SIKDYSQLKTFLKEKY
SYA_MYCMS       TFIVVAVSQS--LQNKYKAIDIFNNLEGY-ETKGGGNANLAQG-KFVKK-----------
SYA_ONYPE       KIVFLCKSK------TLHAGNLIKEAVSLVCGSGGGNASLAQG-GTKKTKNLEQVLNFVK
SYA_CLOTE       KIQFVAMATKEAVAKGAHCGKIIKEVASIAGGGGGGRPDMAQA-GGKNPEKAEEAIAKVE
SYA_CALS4       KALFVGMATKDAVEKGVNMGAVIKETCSIAEGNGGGRAEMAQG-TGKNISKVKEALEKAI
SYA_LEPIN       NASIVITCSSELTLKGIHCGNLIKTACELLGGKGGGRPDMAQG-GGKEKQNLESAIAGVI
SYA_DEHMC       KPFFLCMVTPDLIAKGYHAGNIVKKLSQIAGGGGGGKPNMAQG-GGRDKSKLDEALQAVK
SYA_CHLAB       KYIIFSRISDDLVKQGLKAKDLLQVLLTPCGGRWGGKDIFAQG-SADSLPQADILNNTLC
SYA_PARUW       KCQILVKISDDLVKQGINANEIIKILMPIVEGSGGGKQHTAQG-GGKKPAMLGEAFKQIR
SYA_AQUAE       KINFVIGVSKEISDK-VNAKEVIREVGKVLKGGGGGRADLAQG-GGKAPDKFPEAVKLLK
SYA_CAMJR       TLAAGVK-DVP----LKAGALVKEAAQILG-GNGGGRDDFATA-GGKDLSKINEALKQSL
SYA_WOLSU       MLAAGVKGEDR----IKAGAWIKEIAPILG-GGGGGRDDFAQA-GGKDASKADEALQSAK
SYA_HELPJ       TLACGVK-NVP----IKANAWANEVAQILG-GKGGGRDDFASA-GGKDIENLQAALNLAK
SYA_BUCAP       TVIIRVTKNLI--NYITALKIINIFIKKAN-GKGGGKKEIAEG-GGMNIKKLPMILNYIK
SYA_BUCBP       IIIVGVTRNVT--DRISALDILNKLTKKLG-GRGGGKNNIAEG-GIKNLISLPIELKKIK
SYA_WIGBR       YIVTGVTNNLV--NIITAKEIISYFKEIKS-IKGGGNSYFAEAVGVVNLIDLKSMFKKIF
SYA_BLOFL       HIVISITKDLVECNRIYAIDLIQYIIRSVKNGKGGGRFDFAQL-NINNVKNVSELVIQIQ
SYA_BLOPB       NLVVAVTKDLIERNRINALSLVHYIIKILG-GKGGGRPDFAQA-GINNMATTSKISIEVN
SYA_COXBU       QLVAGVTKNCLE--HFNATELLAPIAEKVG-GRSGGRPDLAQG-AGERPENLEAALAAVP
SYA_LEGPL       NVIAGVSKNII-----GKTPNAAQLVRHLC-GKGGGRDDMAQG-GGDVPEDLNSKIKEIK
SYA_ECOLI       SLIAGVSKDVTD--RVKAGELIGMVAQQVG-GKGGGRPDMAQA-GGTDAAALPAALASVK
SYA_PSYA2       ALAANVAKSVTD--RIKAGDIIRYLAGELG-GKGGGKPDYAQG-GAPKSNNSAAVIAALP
SYA_IDILO       SLIAGVTTDLTS--KVKAGDIVNQAANVVG-GKGGGRPDMAQA-GGSLPEQLNEALATAT
SYA_XANOR       ALVSGVNGSPTG--KVKAGELLSNIASQIG-GKGGGRPDLAQG-GGEDGPALATALDGVP
SYA_ACIFR       ALIAGVGKGLTG--RVHAGELVNTVAQPLG-GKGGGRPELAQA-GAGNPAALDAALNAAR
SYA_FRATT       QFVIGVSNALTT--LIKAGDIAKELSSHID-GKGGGRADMAQG-GGNNSANIDQALSQVE
SYA_ZYMMO       SVAIGVSDSLKD--KISAVDLVRKAVETLGGKGGGGRPDMAQG-GGPNGNEAAQALEAVK
SYA_RUEPO       AVAAGVTEDLTA--RVSAVDLVKAAVAALGGKGGGGRPDMAQG-GGQDAGKADAAIKAAE
SYA_CAUVC       AVTVAVTADLTG--KFSAADLAKAAVIAMGGQGAGGKADFAQG-GAPDDSKAEEGLAAVK
SYA_GLUOX       SIVIAVTKDLTD--RLDAVKLVREASALMGGKGGGGRPDMAQA-GGPN-ADSDAVFAMLR
SYA_PELUB       GLAVGVTKTLEK--KFDAVKIVRAGSEVIGGKGGGGRADFAQA-GGTLPDKIEESFENIK
SYA_RICFE       SITVAVSKAITD--KYKAGIIAKELSLFLGGSGGGGQASLAQA-GGNDIGKLTNIQEKLH
SYA_ANAMM       VLIIGVGDTASK--VLGASELVKTLADLQ-GK-GGGNAGLARV-SLEVGNVQEALSTILN
SYA_EHRRW       IYVVGVGNSLHS--KVKAADFVKIIGCVVKSK-GGGNAQLAQI-STEYIAEVDVIQHIKD
SYA_WOLTR       VLIVKVSKDLVD--KISTKELVSTVTGGV----CGENAELTQT-GCDSSDIFTAIYSYLT
SYA_DESPS       ALLAIVTKDLVD--RIQAGRIVSEVSGIVG-GKGGGRPDMAQA-GGTMPDKLSEAIASVP
SYA_GEOSL       NLLVAVTKDLTG--RVKAGDLIRQLSPIIG-GSGGGKPELAQA-GGTLPDKLGEALGKVC
SYA_DESVH       QLIIAVSKDLQT--RFTAPQLIKDVAAEVG-GSGGGRPDMAQA-GGTNPAGIDAAFAKLR
SYA_SYMTH       NLVAAVTKDLAG--RVHAGNLIREVARICG-GGGGGRPDMATA-GGKNPERLGEALNAVP
SYA_BDEBA       PIIVSVSKEISG--ETKAGDLLKEVAGVMG-GKGGGRPDFAQG-AAPNRAQLNEAFSKVK
SYA_CHLTE       VSLVAFASDEAVKSLKLDAGKLVKEAAASVKGGGGGKLELATA-GGKEPAGIDKAIEVFV
SYA_BACFN       KPMLTVMISDNLVAGGLKAGNLVKEAAKLIQGGGGGQPHFATA-GGKNPDGLNAAVEKVL
SYAC_HUMAN      KITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQA-TGKNVGCLQEALQLAT
                                                  *                         

SYA_LEIXX       TAIG-------------
SYA_CUTAK       TELTAL-----------
SYA_CORJK       SALRG------------
SYA_THEFY       QRVAGS-----------
SYA_BIFLO       HEAQKA-----------
SYA_TROW8       ACVIGKLSGV-------
SYA_PROMA       ERIIQSLD---------
SYA_SYNP6       DQLKTAIAS--------
SYA_PROMP       KDLRTKLHSYSDK----
SYA_DEIRA       -----------------
SYA_THET8       P----------------
SYA_THEMA       EFLR-------------
SYA_RHOBA       ETMTEKLG---------
SYA_FUSNN       EIIEAKLV---------
SYA_LACAC       DEISNN-----------
SYA_STRT2       EQF--------------
SYA_GEOKA       TWVKSVS----------
SYA_STAS1       DYIKSL-----------
SYA_MYCPN       TLQ--------------
SYA_MYCGA       NICIT------------
SYA_MYCPE       TINAKLK----------
SYA_UREPA       VVDKWVINA--------
SYA_MYCHJ       WENITEF----------
SYA_MYCMO       KEKGII-----------
SYA_MYCPU       G----------------
SYA_MYCS5       KWEN-------------
SYA_MYCMS       -----------------
SYA_ONYPE       TKLEIN-----------
SYA_CLOTE       DILSSLVK---------
SYA_CALS4       EIVKGQLKA--------
SYA_LEPIN       NEAKQILTGERV-----
SYA_DEHMC       GMI--------------
SYA_CHLAB       QWISTQLI---------
SYA_PARUW       IYLKEKMNVK-------
SYA_AQUAE       EILSG------------
SYA_CAMJR       ETIEKAL----------
SYA_WOLSU       NYALERLA---------
SYA_HELPJ       NTALKALEG--------
SYA_BUCAP       SWITIQLENIKTKNFNN
SYA_BUCBP       TWISSRL----------
SYA_WIGBR       MILSKNLK---------
SYA_BLOFL       SLLNDIICNIKSIK---
SYA_BLOPB       SLLHNIL----------
SYA_COXBU       KWIEKKLKE--------
SYA_LEGPL       EMIEKN-----------
SYA_ECOLI       GWVSAKLQ---------
SYA_PSYA2       AWVAAQLS---------
SYA_IDILO       TWLQQQL----------
SYA_XANOR       LWVKQHLG---------
SYA_ACIFR       DWVKGKLG---------
SYA_FRATT       KFILNNIKE--------
SYA_ZYMMO       ALLEKA-----------
SYA_RUEPO       QVLGG------------
SYA_CAUVC       ALLAG------------
SYA_GLUOX       KTLEAA-----------
SYA_PELUB       KLIN-------------
SYA_RICFE       GLLTVS-----------
SYA_ANAMM       KVTAAFPT---------
SYA_EHRRW       ELVSIFNA---------
SYA_WOLTR       R----------------
SYA_DESPS       AIIEAML----------
SYA_GEOSL       ELVP-------------
SYA_DESVH       SLIGG------------
SYA_SYMTH       GLVGSQLGL--------
SYA_BDEBA       SMLGL------------
SYA_CHLTE       ASVKSALQ---------
SYA_BACFN       ELAGI------------
SYAC_HUMAN      SFAQLRLGDVKN-----