CLUSTAL format seed alignment for MF_00040

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RRF_FUSNN       -MSIASDKLVKECEEKMVKTIEAVKEKFTAIRAGRANVSMLDGIKVENYGSEVPLNQIGT
RRF_LEPIN       ---MASDAIISGMKTKMDKTIDLVKKDFGTIRTGRANPSLVEDIRVDYYGNQTPINQLGN
RRF_OCEIH       ----MSASELKEMEQKMEQAVQALSKNLASVRAGRANPSILDSVFVDYYGASTPLNQLAS
RRF_STAES       -----MSDIIKDTKSRMQKSIDNLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLAS
RRF_LACLA       ----MANEIVTTAQDRMKQSLGSLQRDLGHIRAGRANASLLDRVQVVYYGAPTPLNQLAS
RRF_CALS4       -----MSDYLKDSEERMKKTLNVLKSELAAIRAGRANPALLDRITVNYYGTPTPLNRLAT
RRF_NITEU       ----MIADVKKSAEQKMQKSLDALKVDFSKVRSGRPHTGLLDHIMVDYYGTPTPIKQLAN
RRF_COXBU       ----MINDIINDSKSRMEKSLGSLKTELAKLRTCRAHPSLLEHIKVDYYNVETPLSQVAS
RRF_SHEON       ----MIADIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVAN
RRF_ECOLI       ----MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLAS
RRF_PSEPK       ----MINDIKKDAQERMGKSIEALSRNLAAIRTGRAHPSILDSVKVTAWGSEMPLNQVAA
RRF_XYLFT       ----MLNQIKQDAQDRMTKSIDALRNSLASVRTGRASPSLLDGIKIKAYGTDTPLNQVAS
RRF_BORBU       -----MEDYKAFLDEKMNKVLLSLDNEYKTLRTGRISSNIFDRICIQYHDRRTPITQVSS
RRF_THEMA       ----MVNPFIKEAKEKMKRTLEKIEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLAT
RRF_PORGI       ---MEIKELIAKATANMEKAVEYLDEQLSHVRAGKASPKLLDGIMVMYYGNATPLTQVAS
RRF_CAMJE       ----MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKVNIHILDHITVDYYGTQTPLNQVAT
RRF_CORGL       ----MIDEILFEAEERMTATVEHTREDLTTIRTGRANPAMFNGVMAEYYGVPTPITQMSG
RRF_STRCO       ----MIEETLLEAEEKMEKAVVVAKEDFAAIRTGRAHPAMFNKIVAEYYGAPTPINQLAS
RRF_BIFLO       ------MSLIDQAKEQMAKTVENTKENFSGIRTGRANPALLNGITVDYYGAPTPIKAVAS
RRF_TROW8       ----MGIMCSGDVSERMNKTIELLKEQFLSIHSGRVNSGQFEKVMVDCEGASVPLVSLAS
RRF_BRADU       -MMPTGNFDLNEVKRRMQGAVQSLKHELGGLRTGRASASMLDPVQVEAYGSHMPLNQLAT
RRF_CAUVC       -MAAAEKPVLSRYRDRMDKAVSALKEEFGSLRTGRASASLLDQVMVEAYGSTTPLNAVAS
RRF_RICPR       ---MEKDNLKKILQEKMEKAIKVLGNELKGLRTGRASINFLDSVTVEAYGSKIPLSQVAS
RRF_CHLTE       ---MTVRDVIQKIEPRMKKTIEAFQHELASIRTGKATTALLDRVKVEAYGSQMPLKQVGN
RRF_AQUAE       -MIKELEDIFKEAEKDMKKAVEYYKNEIAGLRTSRASTALVEEIKVEYYGSKVPIKQLGT
RRF_DEIRA       --MADMKSIQADTREKMNKAIEAFENNLSVLRTGRANPGILKKIVVDYYGSQMPIDQVAS
RRF_THET8       ---MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIAT
RRF_PROMP       ------MKEQE-IQSSMNKSVEATQRNFNTIRTGRANASLLDRISVEYYGAETPIKSLAS
RRF_GLOVI       ------MNVSK-TEQDMRKAIEATAGNFATIRTGRASTSLLDRINVEYYGQPTPLKTLAT
RRF_TREPA       ------MGIAECYEQKMKKSLSALQEGFNTLRTERATAHLLDQITVDYYQQPTALSQVAT
RRF_RHOBA       ---MTSDEILMDAEERMDKAVSVLQNNLSGIRTGRANPGLVDSIKVEVYGSLTPLKQLAS
RRF_BUCAP       ----MINDIYIKSNEKMKVCINNFQIQVNNVRTGRASPELLNSIYVEYFGSKVPLRQISN
RRF_BUCBP       -----MERIKNFTSSKMDHCVHMFVNQLNTLRSSRASPSILDTILIDYLGQKIQLKKLSN
RRF_WIGBR       ----MINEIYENSNSRMKKSIDFFKKNISKIRTNRVSPSLIENIYINCYGTSVPLSKLSN
RRF_BLOFL       -MSDIIDDFQKDVTINMQKCIDNFKININKIHVGRISPDILSFIKIEYYGVITPLCQLTN
RRF_MYCPU       MDISIINEVFSTLEEKSMNVVSNFEFNLSKISTGRANPQLIKNIKVSYYEELIPLEQISN
RRF_CHLTR       -------MTLASAEKEMVGVLTFFQKETRGFRTGKAHPALVETVTVEVYGTTMRLSDIAS
RRF_MYCGA       ---MEFKTYSDFFDKNANSIINWFEGELAKVRSGRANLKILDNVRAEYYGEQTPLIEMAS
RRF_MYCPE       ---MEWKIYKEEFDKKAEVKLEWLDSEFNKIKSGRPNPKILDHVMVEAYGDKSKLFEIAN
RRF_MYCPN       ---MSPEKYLNFFKETADKKFQWLKEELSKIRTGRPNPKLFDNLLVESYGDRMPMVALAQ
RRF_UREPA       ---MNFKIYETKIREEFELVLKWMHNEFIKLRTGRATPAILDGILVNYYGSMMPINQLAN
                                    .         .   :     .  :          :  :  

RRF_FUSNN       VSAPEARLLVIDPWD-KTLISKIEKAILAANIGMTPNNDGRVIRLVLPELTADRRKEYVK
RRF_LEPIN       ISVPEPRMLVISPYD-KGIMKDIEKAIQTSGLGLQPTNDGVVIRIVIPELTGERRKELAK
RRF_OCEIH       VGAPEARLLTITPYD-KSAIGDIEKAIQKADLGLSPSSDGNIIRINIPALTQERRKDLVK
RRF_STAES       INVPEARLLVISPYD-KSSVADIEKAIIAANLGVNPTSDGEVIRISVPALTEERRKELVK
RRF_LACLA       ITIPEARVLMVTPFD-KSILKDIEKALYESDLGITPANDGSVIRLVIPMLTEERRRELVK
RRF_CALS4       ITAPEPRVLVVQPWD-VSQIGEIEKAIQKSDLGINPVSDGKVLRLVLPELTEERRKELVK
RRF_NITEU       VTLADARTIGIIPWD-KKIFSAIEKAIRDSDLGLNPMTVSDMVRVPMPPLTEERRKDLTK
RRF_COXBU       IAIENPRTLSITPWE-KNMVGPIEKAIQKADLGLNPATVGMVIRVPLPPLTEERRKELAR
RRF_SHEON       VGVEDARTLSVTVFD-RSAIQAVEKAIMSSDLGLNPMSAGATLRIPLPALTEERRKDFIK
RRF_ECOLI       VTVEDSRTLKINVFD-RSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTK
RRF_PSEPK       ITVEDARTLKIVAHD-KNLSAAIEKAILTSDLGLNPSSAGTTIRVPMPALTEETRKGYTK
RRF_XYLFT       ISVSEGRSLVITVFD-KNMSKDVEKAIYASDLGLTPTVVGTLIRLNLPPLTEERRKELTK
RRF_BORBU       IRIPEARLVVIQPWD-KSILNKIEQAILNSDLSMNPSNDGSVIRIKVPNLTSERRQEIVK
RRF_THEMA       ISISEERTLVIKPWD-KSVLSLIEKAINASDLGLNPINDGNVIRLVFPSPTTEQREKWVK
RRF_PORGI       INTPDAKTIVVTPWE-RSLIKDIEKAIMDSPLGITPENNGELIRLGLPPLTEERRRQLVK
RRF_CAMJE       VLASDASTISITPWE-KPLLKTIESAIAAANIGVNPNNDGESVKLFFPPMTREQREENVK
RRF_CORGL       ITVPEPRMLLIKPYE-MSSMQVIENAIRNSDLGVNPTNDGQVLRVTIPQLTEERRKDMVK
RRF_STRCO       FSVPEPRMAVVTPFD-KTALRNIEQAIRDSDLGVNPSNDGNIIRVTFPELTEERRREYIK
RRF_BIFLO       IGVPEPRTLSVTPFD-ASQAGAVEKALRNSDLGISPNRDGNVIRLTMPELTEDRRKEYVK
RRF_TROW8       IRVLNANTIVVTPYD-SALLSQIDRALRNVPNIGTPGNDGECIKIVMPQLTEARRHEYVK
RRF_BRADU       VSVPEPRLISVQVWD-KSMVKAVEKAIVDSNLGLSPATEGQVLRLRIPELNEERRKELVK
RRF_CAUVC       VSVPEPRQINVSVWD-RGVVVSVEKAIRASGLGLNPVVEGQNLRIPIPPLTEERRRDLQK
RRF_RICPR       LSTPDARTINVQVWD-KSMVSSVEKGITIANLGLTHATDGQLIRLPIPSLTEERRKELVK
RRF_CHLTE       VGVLDAHTLTVQVWD-KSMVGATERAIRDAGLGLNPSADGQNIRISIPPLTEERRKEFVK
RRF_AQUAE       ISVPEHNQIVIQVWD-QNAVPAIEKAIREE-LNLNPTVQGNVIRVTLPPLTEERRRELVR
RRF_DEIRA       ITTPDPRTLVITPWD-RGALNPIEKAIRDSDLGLNPNNKGDTIFISLPMLTEERRKDLVK
RRF_THET8       VTAPDPRTLVVQSWD-QNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVR
RRF_PROMP       ISTIDSQTISIQPFD-ISSLQTIEKAISVSDLGITPNNDGKVIRINVPPLTEERRKEFCK
RRF_GLOVI       ITTPDASTVLIQPYD-PSSLRLIEKTILESDLGLPPSNDGKTIRLNIPPLTAERRKDLVK
RRF_TREPA       VSVPEARLIIIQPWD-KTLLADIERAILKSKLSLNPSNDGKVIRLVIPPLTQERRKELVR
RRF_RHOBA       IGTPEPQQILIRPYD-ATTIKDIEKAIVAGDLGLNPQNDGRVIRLNVPPLSGEVRKKMVS
RRF_BUCAP       VVVENYHTLKINIFD-DSSTSLIKKAILNSNLDLNPILYGKDIIVPIPGLTEERRTHLIK
RRF_BUCBP       IIVENVNTLRITLFD-PKIKNNVEKAIISSKLDLIPIFINNYFQIKIPVLTEERRLQLIK
RRF_WIGBR       ILSEKSNILKINVFD-NNIIKKIEQAILSSDLGVNPQIQENYIRIEFPKLTEARRFELIK
RRF_BLOFL       TVVEQPRTLIITVFD-SSMIKFIEKAILESNLGCTPVSTGNTIRVTFPTLTESRRYSLIK
RRF_MYCPU       ISVPEPQQLLIKPFD-HNITKEIHKSLLLANLDVAIVNEGNQIRLNFPALNTQRRKELVK
RRF_CHLTR       ISVSDMRQLLLSPYD-AGTVSAISKGILAANLNLQPIVEGATVRINVPEPTEEYRREVIK
RRF_MYCGA       LSIPEPREILIKPYE-KSSVNLIQAALLKANLNLTPVVDGDKIRIKLPLLTEENRKENVK
RRF_MYCPE       MQVVEGKQIVVKPYD-KTLLHDINSAIQKENLGLSVQVDADSLRIIFPSPTEETRKASVK
RRF_MYCPN       IAVNPPREIVIKPFDVKNNINAIYSEIQRANLGVQPVIDGDKIRINFPPMTQESRLESIK
RRF_UREPA       ISVPEPRVLAIKPYD-RSSIKDIATAINASNLGVNPQVDVDIIRLTFAAPTEEVRKNLVK
                          :   :           :               . : ..  .   *     

RRF_FUSNN       LAKNEAENGKIAIRNIRKDINNHLKKLEKDKENPISEDELKKEETNVQTLTDKYVKEIDD
RRF_LEPIN       VVKSKSEEKKVAIRNIRRDAMEDLKKHTEG----MSQDEIKSVQDQIQKITDSYIDKISA
RRF_OCEIH       VVGKYSEEAKVQIRNIRRDTNDQLKKMEKNGD--LTEDDLRGFQDDVQTSTNDYINKIDQ
RRF_STAES       EVKKIGEDAKVSIRNIRRDINDQLKKDEKNGD--ITEDDLRSQTDDVQKATDNSIKEIDQ
RRF_LACLA       EMGKYIESAKVAIRNIRRDAMDTAKKSEKAKE--ITEDDLKDLENNIQKVTDDAVKEADR
RRF_CALS4       LVHKKAEEARIAVRQIRRDANDLVKKMEKDGE--ISEDERKRREEEIQKLTDKYIKEIDK
RRF_NITEU       IVKTEAEAARVAMRNIRRDANAHLKELLKDKL--IAEDEDRRAQDEIQKLTDRYIAEVDK
RRF_COXBU       VVREEAEHARVAIRNIRREANNDLKELMKEKE--ISEDEERRAQTAIQKLTDAQIAEVDK
RRF_SHEON       VVRAEAEGGRVAIRNVRRDAISDVKKLEKAKE--CTEDDVRRFEDEVQKFTDAHIKKVDE
RRF_ECOLI       IVRGEAEQARVAVRNVRRDANDKVKALLKDKE--ISEDDDRRSQDDVQKLTDAAIKKIEA
RRF_PSEPK       QASGVAEDAKVAVRNVRRDALADLKKLTKDKE--ISEDEERRAADEIQKLTDKFVAEVDA
RRF_XYLFT       VVHSEGEDTKVAIRNIRRDANQQIKDMLKSKE--ITEDEVRHGEEDIQKLTDKAIKSVDE
RRF_BORBU       HAKKIAEEHKISTRNIRQDLNNKVKKQEKESE--ITEDCLKRILDDIQKSTDMYIKKIDS
RRF_THEMA       KAKEIVEEGKIAIRNIRREILKKIKEDQKEGL--IPEDDAKRLENEIQKLTDEFIEKLDE
RRF_PORGI       QTKGDAEDAKVSVRNARRDAIDAIKKSVKTDG--TPEDVAKDAEAEMQKVHDRYIKKIDE
RRF_CAMJE       QAKAMGEKAKVSIRNIRKDANDAVKKLEKDKA--ISEDEAKKAYDEVQKLTDTYTTKIDE
RRF_CORGL       LAKGKGEDGKIAIRNIRRKGMDQLKKLQKDGD--AGEDEVQAAEKELDKVTAGFVAQVDE
RRF_STRCO       VAKAKGEDAKVSIRSVRRKAKDSIDKMVKDGE--VGEDEGRRAEKELDDTTAKYVAQVDE
RRF_BIFLO       LAKGKAEDGKVAVRNIRRKTKETIDKAVKDGE--MGEDEGDRLLKDLDKVTKSVTDEIDT
RRF_TROW8       QARVKAEEARVSARNIRRKARASLDAM----G--LAKDEIVRREKELDKLTKDVISVVDD
RRF_BRADU       VAHKYAEAAKVAARHVRRDGLDVLKKLEKNHE--MSEDDQKRHADEVQKVTDGTIAEIDQ
RRF_CAUVC       IAGKYAEQQKIAVRNVRRDANDDLKKAEKDGA--IAEDERKKMETEVQKMTDDAIKRIDE
RRF_RICPR       LAHKYGEETKISLRNIRRDGIEELKKLEKDNI--IVKDEYHNLSEQIQKLTDEYSSKVDS
RRF_CHLTE       LTKKFGEDSKVSLRNHRRDLIHEVEKLEKEKL--ISEDELKRGKKDADDLLHKYEKQITE
RRF_AQUAE       LLHKITEEARVRVRNVRREAKEMIEELEG-----ISEDEKKRALERLQKLTDKYIDEINK
RRF_DEIRA       NAKNYAEDARIAVRNLRKHALDEVKKVEG-----LGEDEIKRGEADVQKITDEYVARVES
RRF_THET8       AVRQYAEEGRVAIRNIRREALDKLKKLAKELH--LSEDETKRAEAEIQKITDEFIAKADQ
RRF_PROMP       LASKYAEEGKVALRNIRRDAVDKEKKDEKEGL--ISKDVSRDNQLEIQKFTDKYISLIET
RRF_GLOVI       VLRNLAEEGRVAVRNIRRHAIDEVRKEEKDAK--VSEDEARRLQDEVQKLTDKSIQQIEK
RRF_TREPA       QARALAEQARVAIRNIRREGIEEAKRGHKEGL--LSEDALKAAEEAFQKATDASVADVAR
RRF_RHOBA       RIKELAEEAKVSIRNIRRDANKAAETAEKDKE--MTEDDRDKTKDQVQELTKKAETNVNE
RRF_BUCAP       VIRNNAENARIYIRNIRRDANDKIKNYLKSKI--ISEDNEHAAQNKIQTMTDDYIKKIDK
RRF_BUCBP       LAKKMAENSRICIRNIRRLSNEKIKLFLKDKI--ISSDKERRLQHEVQDITNSYMEKINV
RRF_WIGBR       LINKEAEQNIISIRNIRRDANEKIKKLIKAKT--IGKDEDKKFQEVIQNLTNSRIEDTKK
RRF_BLOFL       MVRSESEKSKVLIRNIRRVSNDKLKTFLRNKE--INKDNEHYFQNEIQNLTDIWIKKIIL
RRF_MYCPU       SLNKFTEQARVSIRLLRQESNKKIKSFKSE----ISEDDIKKYETKIQTINDSYIEQIDE
RRF_CHLTR       QLKRKSEEAKVAIRNIRRTFNDRLKKDDN-----LTEDAVKSLEKKIQELTDKFCKQIEE
RRF_MYCGA       KVKAVGEKAKQEVRFIRRDTLNKIKSDKIADK-----DLNKYFEEQVDKITKKYIDQIDS
RRF_MYCPE       KVKEFSEQVKVEIRNIRKDVHHKIKDDKELRE-----DELKWYEEDLDKLTREWNAKVDK
RRF_MYCPN       QAKKVVEQIHQELRSVRRDTLQMIKKDDHKDE-----DFEEFLKEEVEKVNKQYIAQLET
RRF_UREPA       KAKQVGEEAKIRVRHIRQEAQDLFKKDSTTIE-----DDKKFFQTELDNLTKELNKEIET
                      *      *  *:                   *         :            

RRF_FUSNN       LLAKKEKEITTI
RRF_LEPIN       LTAEKEKEITTI
RRF_OCEIH       LAKNKENEIMEV
RRF_STAES       LVADKEKDIMSV
RRF_LACLA       LASIKEKELLDI
RRF_CALS4       MVEAKEKEIMEI
RRF_NITEU       LLQTKEAELMAV
RRF_COXBU       MASQKEADLMAV
RRF_SHEON       ILAAKEIELMEV
RRF_ECOLI       ALADKEAELMQF
RRF_PSEPK       AFKAKEKDLMAV
RRF_XYLFT       VVKSKEQELMTV
RRF_BORBU       ILESKIQEIMEA
RRF_THEMA       VFEIKKEEIMEF
RRF_PORGI       LFAEKEKEIMTV
RRF_CAMJE       GVKSKESELLKV
RRF_CORGL       VVARKEKELMEV
RRF_STRCO       LLKHKEAELLEV
RRF_BIFLO       LLETKQKEIMEV
RRF_TROW8       LLRHKESELLRL
RRF_BRADU       LLAAKEKEILTV
RRF_CAUVC       ALKTKEHEIMQV
RRF_RICPR       AIKQKEQEIMTV
RRF_CHLTE       LIAQKEKEIMEV
RRF_AQUAE       LMEAKEKEIMSV
RRF_DEIRA       VFQKKEQEILG-
RRF_THET8       LAEKKEQEILG-
RRF_PROMP       KLSEKEKEILKV
RRF_GLOVI       LFEAKEKEITTV
RRF_TREPA       YLAEKEKDILEG
RRF_RHOBA       SAKAREAEVMED
RRF_BUCAP       ILSEKEKDLMKF
RRF_BUCBP       ILSKKEKDLLK-
RRF_WIGBR       ILKLKEKEIKKI
RRF_BLOFL       ITKEKELELMKF
RRF_MYCPU       ITKRKERELMEI
RRF_CHLTR       LAKQKEAELATV
RRF_MYCGA       ILAKKEKDLLSL
RRF_MYCPE       AFAEKEKELMTI
RRF_MYCPN       IQKQKEKELLVV
RRF_UREPA       VVSHKEKDIMTV
                    :  ::