CLUSTAL format seed alignment for MF_00041

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYC_AGRFC       --------------------------MSLRLKLHNTLTREK-SEFAPID-----------
SYC_RHIEC       ------------------------MGRTPELKLYNTLTREK-SAFKPID-----------
SYC_RHIME       ------------------------MGGMPILKLYNTLTREK-ADFRPID-----------
SYC_RHILO       -----------------------MSDASQGLRLYNTLTRAK-TDFVPID-----------
SYC_NITWN       ----------------------------MDLRLYDTLTRRK-RAFTPID-----------
SYC_BARHE       ---------------------------MRELRFYNTLTRKK-ENFIPID-----------
SYC_BARQU       ---------------------------MRKLRFYNTLTRKK-ENFTPID-----------
SYC_BRUAB       -----------------------MPDTTPQLRLYNTLTRTK-EAFAPID-----------
SYC_BRUA2       -----------------------MPDTTPQLRLYNTLTRTK-EAFAPID-----------
SYC_BRUME       -----------------------MPDTTPQLRLYNTLTRTK-EAFAPID-----------
SYC_BRUSU       -----------------------MPDTAPQLRLYNTLTRTK-EAFAPID-----------
SYC_RHOPA       ----------------------------MELRLYDTLTRDK-RPFTPID-----------
SYC_RHOP2       ----------------------------MALRLYDTLTKEK-RAFAPID-----------
SYC_RHOPB       ----------------------------MALRLYDTLTKEK-RDFAPLD-----------
SYC_BRADU       ----------------------------MELRLYDTLTKEK-RTFVPLD-----------
SYC_JANSC       ---------------------------MVEIHLKNSKSRKV-ELLQPIE-----------
SYC_RUEPO       ---------------------------MTTIKLHNTRTRTK-EEFVPID-----------
SYC_RHOS4       ---------------------------MTEIRLTNTKSRRK-EAFEPID-----------
SYC_ANAMM       ------------------------------MRLHDTLHAAK-RVFSPKN-----------
SYC_ANAPZ       ------------------------------MKLYDTFSAAK-RVFDPID-----------
SYC_EHRCJ       ------------------------------MIIYNTLTGIK-EPFIPLN-----------
SYC_EHRCR       ------------------------------MIIYNTLTGIK-EPFVPFS-----------
SYC_EHRRG       ------------------------------MIIYNTLTRSK-ELFVPLD-----------
SYC_EHRRW       ------------------------------MIIYNTLTRSK-ELFVPLD-----------
SYC_WOLPM       -----------------------------MVRLYNTLTKKK-ELFTPID-----------
SYC_WOLTR       ------------------------------------------------------------
SYC_NEOSM       ----------------------------MKLRVHNTLSGLK-EEFFPLS-----------
SYC_RICCN       --------------------------MQIQFHLYNTLSRTK-EVFNPQD-----------
SYC_RICFE       --------------------------MQIQFHLYNTLSRTK-EVFNPQD-----------
SYC_RICPR       ----------------------------MKLHLYNTLTRTK-EVFNPQD-----------
SYC_RICTY       ----------------------------MQLHLYNTLTRTK-EVFNPQD-----------
SYC_RICBR       ----------------------------MQIYLFNTLTQNK-ELFEPED-----------
SYC_PELUB       --------------------------MNKDIFLTNNLNNKK-EKFVPIN-----------
SYC_XANOR       --------------------------MPMSLRLHNNLTRRV-EPFTPLD-----------
SYC_XANOM       --------------------------MPMSLRLHNNLTRRV-EPFTPLD-----------
SYC_XANAC       --------------------------MPMSLRLHNNLTRRV-EPFAPLD-----------
SYC_XANC5       --------------------------MPMSLRLHNNLTRRV-EPFAPLD-----------
SYC_XANCP       --------------------------MPMSLRLHNNLTRRV-EPFAPLD-----------
SYC_XANC8       --------------------------MPMSLRLHNNLTRRV-EPFAPLD-----------
SYC_XYLFA       ----------------------------MSLHLYNTLHRRV-EPFEPLD-----------
SYC_XYLFT       ----------------------------MSLHLYNTLHRRV-EPFEPLD-----------
SYC_CAUVC       ----------------------------MTLKIHDTLTREK-RDFVPAD-----------
SYC_MAGSA       ----------------------------MPLVLYNTLTRTK-DVFEPLV-----------
SYC_RHORT       ----------------------------MTLHIHNTMTRTK-EVFEPLD-----------
SYC_GLUOX       ----------------------MADPASNVLRLHDTHLRDK-RPFTPLD-----------
SYC_SACD2       ----------------------------MSLTVYNTRTRKK-EPFVPVN-----------
SYC_PSYA2       -----------------MIMTTPLADAMSQLVIYDSLTGRK-QSFKPLV-----------
SYC_PSYCK       -----------------MTMTTPLADAMSQLVIYDSLTGRK-QAFKPLA-----------
SYC_ACIAD       ---------------------------MQPFVLYNSEQRKK-VEFVPRK-----------
SYC_PSEF5       -----------------------------MLTIYNTLTKSK-EVFKPLD-----------
SYC_PSEPF       -----------------------------MLTIYNTLTKSK-EVFKPLD-----------
SYC_PSE14       -----------------------------MLSIYNTLTKSK-EVFKPLD-----------
SYC_PSEU2       -----------------------------MLSIYNTLTKSK-EVFKPLD-----------
SYC_PSESM       -----------------------------MLSIYNTLTKSK-EVFKPLD-----------
SYC_PSEPK       -----------------------------MLTIYNTLSKTK-EVFKPLD-----------
SYC_PSEAE       -----------------------------MLQIYNTLSKTK-EVFTPLV-----------
SYC_HAHCH       -----------------------------MLKIYSSLSQQK-EEFKPIQ-----------
SYC_BURMA       ---------------------------MESLRIYNTLARDK-QDFVPRQ-----------
SYC_BURPS       ---------------------------MESLRIYNTLARDK-QDFVPRQ-----------
SYC_BURP1       ---------------------------MESLRIYNTLARDK-QDFVPRQ-----------
SYC_BURTA       ---------------------------MESLRIYNTLARDK-QDFVPRQ-----------
SYC2_BURL3      ---------------------------MESLRIYNTLARDK-QVFVPRQ-----------
SYC_CUPPJ       ---------------------------MQLLNIYNTLAREK-QPFVPIE-----------
SYC_RALSO       ---------------------------MESLKIYNTLAREK-QTFVPIE-----------
SYC_DECAR       -----------------------------MLKIYNSLKREK-QVFTPIE-----------
SYC_AROAE       -----------------------------MLHIHNTLTRRK-EAFVPIA-----------
SYC_THIDA       -----------------------------MLHITNSLTRTK-EEFVPLS-----------
SYC_NEIG1       -----------------------------MTAIYNTLTRQK-EPFAPID-----------
SYC_NEIMB       -----------------------------MTTIYNTLTRQK-EPFSPID-----------
SYC_CHRVO       -----------------------------MLSLYNTLTRQK-EAFKPIE-----------
SYC_NITEU       -----------------------------MLKIYDTLTRSR-REFIPLT-----------
SYC_NITMU       -----------------------------MLKIHNSLAREK-QEFIPLT-----------
SYC_BORBR       -----------------------------MLHIYNTLSRTK-EPFKPAH-----------
SYC_BORPA       -----------------------------MLHIYNTLSRTK-EPFKPAH-----------
SYC_BORPE       -----------------------------MLHIYNTLSRTK-EPFKPAH-----------
SYC_BORA1       -----------------------------MLHIYNTLSRTK-ETFKPVH-----------
SYC_RHOFT       ----------------------------MSLRIYNTLSRAI-EPLIPLQ-----------
SYC_METCA       -----------------------------MLKIYNSLTRQK-EEFRPLE-----------
SYC_NITOC       -----------------------------MLRIYNSLTRRK-EEFIPIE-----------
SYC_HYDCU       ----------------------------MALKIYNTETRQK-ETFTPIQ-----------
SYC_LEGPL       -----------------------------MLHLYNSLTRKK-EPFVSLR-----------
SYC_LEGPA       -----------------------------MLHLYNSLTRKK-EPFVSLR-----------
SYC_LEGPH       -----------------------------MLHLYNSLTRKK-EPFVSLK-----------
SYC_BLOFL       -----------------------------MLKIFNTLTKKK-EIFKSIK-----------
SYC_BLOPB       -----------------------------MLKIFNTLTKKK-EKFIPIN-----------
SYC_BUCAI       -----------------------------MLKIFNTLTSTK-EIFTPIK-----------
SYC_BUCAP       -----------------------------MLKIFNTATSKK-EIFKPIK-----------
SYC_BUCBP       -----------------------------MLKIFNSYTRLQ-EQLEVDK-----------
SYC_WIGBR       -----------------------------MMKIFNTLKNKK-EKFKPIN-----------
SYC_COLP3       -----------------------------MLQIYNTLSRQK-ETFTPIN-----------
SYC_PSET1       -----------------------------MVNIYNTLTRQK-EQFKPMV-----------
SYC_IDILO       ----------------------------MALTVFNTLTRKK-QLFEPIQ-----------
SYC_ECOL6       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SHIFL       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_ECOLI       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_ECO57       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SHISS       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SHIBS       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SHIDS       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SALCH       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SALTY       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SALPA       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_SALTI       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_PECAS       -----------------------------MLKIFNTLSRQK-EEFKPIH-----------
SYC_YERPE       -----------------------------MLKIFNTLSRQK-EEFKPIH-----------
SYC_YERPS       -----------------------------MLKIFNTLSRQK-EEFKPIH-----------
SYC_PHOLL       -----------------------------MLKIFNTLSRQK-EEFKPIH-----------
SYC_SODGM       -----------------------------MLKIFNTLTRQK-EEFKPIH-----------
SYC_VIBVU       -----------------------------MLKIYNTLTRQK-EEFKPIT-----------
SYC_VIBVY       -----------------------------MLKIYNTLTRQK-EEFKPIT-----------
SYC_VIBPA       -----------------------------MLKIYNTLTRQK-EEFKPIT-----------
SYC_VIBCH       -----------------------------MLKIYNSLTRQK-EEFKPIV-----------
SYC_ALIF1       -----------------------------MLKIYNSLTRQK-EEFKPIT-----------
SYC1_PHOPR      -----------------------------MLKIYNSLTKQK-EEFKPIQ-----------
SYC_SHEON       -----------------------------MLKIYNSITRQK-QEFKPIN-----------
SYC_HAEDU       -----------------------------MLKIYNTLKREK-EEFKPIN-----------
SYC_MANSM       -----------------------------MLKIFNTLTREK-EEFKPIN-----------
SYC_HAEIN       -----------------------------MLKIFNTLTREK-EIFKPIH-----------
SYC_HAEI8       -----------------------------MLKIFNTLTREK-EIFKPIH-----------
SYC_PASMU       -----------------------------MLKIFNTLTREK-EIFKPIH-----------
SYC_FRATH       -------------------------MDFCFMIFYNSLSGQK-EQFKPIE-----------
SYC_FRATT       -------------------------MDFCFMIFYNSLSGQK-EQFKPIE-----------
SYC_COXBU       ----------------------------MSVKIFNSLTKQK-EIFKPIE-----------
SYC_DESAG       ------------------------------MQLYNTLTRKK-EKFIPQR-----------
SYC_DESVH       ------------------------------MQIYNSLSRRK-ELFTPAV-----------
SYC_ANADE       ----------------------------MSIQVHDTLTAQK-RELVPLE-----------
SYC_GEOMG       ----------------------------MSLRVYNTLSGTK-EEFTPLV-----------
SYC_GEOSL       ----------------------------MALRVYNTLSGTK-EDFVTLE-----------
SYC_PELCD       ----------------------------MSLRVYNTMTGRK-EEFEPLQ-----------
SYC_DESPS       ----------------------------MDIRVYNTLSGKK-EPLQPIE-----------
SYC_NOSS1       ----------------------------MTLTIYNTLTRRQ-EPLETV------------
SYC_TRIV2       ----------------------------MTLTIYNTLTRRQ-EPLETV------------
SYC_SYNY3       ----------------------------MTLRLYDSLTRAK-QPLQPL------------
SYC_SYNP6       ----------------------------MTLSLYNTLTRQK-QRFEPL------------
SYC_SYNE7       ----------------------------MTLSLYNTLTRQK-QRFEPL------------
SYC_THEEB       ----------------------------MPLHLYNTLSRRL-EPFSPL------------
SYC_GLOVI       ----------------------------MALQIYNTLTRRK-EPFVPL------------
SYC_SYNJB       ------------------------------MVVYNTLTRRK-EVFQPLAAGGSQSVSVGN
SYC_SYNJA       ----------------------------MTLVVYNTLTRRK-EVFQPF--GGSESISADE
SYC_SYNS9       ----------------------------MTLRLTNTLTRRT-EPFTPLR-----------
SYC_SYNPX       ----------------------------MSLRLTNTLTRRT-EPFTPLT-----------
SYC_PROMM       ----------------------------MSLRLTNTLTRRT-EPFTPLK-----------
SYC_SYNSC       ----------------------------MSLRFTNSLTSRT-EAFEPLT-----------
SYC_PROMA       ----------------------------MPLKLTNTLTRRT-ETFSSLK-----------
SYC_PROMT       ----------------------------MSLKFTNTLSKKK-EDFISIN-----------
SYC_PROM9       -----------------------------MIKLFNTLSKRV-EVFKPID-----------
SYC_PROMP       -----------------------------MIKLFNTLSKNI-EVFKPID-----------
SYC_AQUAE       ----------------------------MSLRIYNTLSGKV-EEFVPIN-----------
SYC_THEMA       ------------------------------MRITNTLTGKK-EEFVPIQ-----------
SYC_BACAN       ----------------------------MTIHIYNTLTRQK-EEFTPLE-----------
SYC_BACHK       ----------------------------MTIHIYNTLTRQK-EEFTPLE-----------
SYC_BACCZ       ----------------------------MTIHIYNTLTRQK-EEFTPLE-----------
SYC_BACC1       ----------------------------MTIHIYNTLTRQK-EEFIPLE-----------
SYC_BACCR       ----------------------------MTIHIYNTLTRQK-EEFVPLE-----------
SYC_BACLD       ----------------------------MTLTLYNTLTRKK-EPFVPLE-----------
SYC_BACSU       ----------------------------MTITLYNTLTRQK-ETFVPLE-----------
SYC_GEOKA       ---------------------------MSSIRLYNTLTRKK-EPFEPLE-----------
SYC_OCEIH       ----------------------------MTIQIYNTLTRQK-EIFKPLE-----------
SYC_BACSK       -----------------------------MIKLFNSLTNKK-EPFVPIE-----------
SYC_BACHD       ----------------------------MAIQVFNSLTRKK-EPFVPLE-----------
SYC_LISMO       ----------------------------MSIQIFNTLKREK-QPFKPLK-----------
SYC_LISMF       ----------------------------MSIQIFNTLKREK-EPFKPLK-----------
SYC_LISIN       ----------------------------MSIQIFNTLKREK-EPFKPLK-----------
SYC_STAAC       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAA3       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAAM       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAAN       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAAS       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAAW       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAAB       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAAR       -----------------------------MITLYNTLTRQK-EVFKPIE-----------
SYC_STAES       -----------------------------MITLYNTLTRRK-ETFEPIE-----------
SYC_STAEQ       -----------------------------MITLYNTLTRRK-ETFEPIE-----------
SYC_STAHJ       -----------------------------MITLYNTLTRQK-ETFEPIE-----------
SYC_STAS1       -----------------------------MITLYNTLTRQK-ETFEPIE-----------
SYC_LACPL       -----------------------------MLSVFNTLTRQK-EPFKPIT-----------
SYC_LACSS       -----------------------------MLTVYNTLTRQK-ETFKPLE-----------
SYC_ENTFA       -----------------------------MIKIYNTLTREK-EVFTPIE-----------
SYC_LACAC       ---------------------------MLAVRIYNTLTRKK-EEFKPLV-----------
SYC_LACJO       ------------------------------MKVFNTLTRKK-EEFKPLV-----------
SYC_STRA1       -----------------------------MIKIYDTMTRSL-QDFIPLN-----------
SYC_STRA5       -----------------------------MIKIYDTMTRSL-QDFIPLN-----------
SYC_STRA3       -----------------------------MIKIYDTMTRSL-QDFIPLN-----------
SYC_STRPM       -----------------------------MIKIYDTMTRSL-RKFVPLT-----------
SYC_STRP3       -----------------------------MIKIYDTMTRSL-RKFVPLT-----------
SYC_STRP8       -----------------------------MIKIYDTMTRSL-RKFVPLT-----------
SYC_STRP6       -----------------------------MIKIYDTMTRSL-RKFVPLT-----------
SYC_STRP1       -----------------------------MIKIYDTMTRSL-RKFVPLT-----------
SYC_STRT2       -----------------------------MIKIYDTMTRSL-RDFVPLT-----------
SYC_STRT1       -----------------------------MIKIYDTMTRSL-RDFVPLT-----------
SYC_STRMU       -----------------------------MIKIYDTLTRSL-REFVPIH-----------
SYC_STRPN       -----------------------------MIKIYDTMSRDL-REFVPIE-----------
SYC_STRR6       -----------------------------MIKIYDTMSRDL-REFVPIE-----------
SYC_LACLA       ------------------------------MKIYNTYSRQL-EDFQPIE-----------
SYC_CLOPE       -----------------------------MIKVYNTLNKKK-EEFIPLT-----------
SYC_CLOTE       ------------------------------MKLYNTLTRQK-EEFIPLK-----------
SYC_CLOAB       ------------------------------MKIYNTMTRKK-EEFVPVK-----------
SYC_CALS4       ------------------------------MRLYNTMTRTK-EEFKPLK-----------
SYC_SYMTH       ----------------------------MGIRIYNDLTRKK-EDFVPLE-----------
SYC_CARHZ       ------------------------------MKIYNTLTKTK-EEFIPRE-----------
SYC_MOOTA       ------------------------------MYLYNTLTGRK-EEFTPVE-----------
SYC_FUSNN       -----------------------------MIKIYNTLTGHL-DEFKPLK-----------
SYC_DEHM1       ------------------------------MKIYNTLSGKL-EEFVPLE-----------
SYC_DEHMC       ------------------------------MKIYNTLSGKL-EKFVPLE-----------
SYC_BDEBA       -----------------------------MLKIHNSQSKQL-EDFTPLT-----------
SYC_COREF       ----------------------------MTLRIFDTATRTL-REFIPLK-----------
SYC_CORGL       ----------------------------MTLRIFDTGTRTL-RDFKPVQ-----------
SYC_CORDI       ----------------------------MTLRIFDTGTRSL-RDFEPIR-----------
SYC_CORJK       ----------------------------MTLRIYDTAARQL-RDFEPIR-----------
SYC_MYCBO       ------------------------MTDRARLRLHDTAAGVV-RDFVPLR-----------
SYC_MYCTU       ------------------------MTDRARLRLHDTAAGVV-RDFVPLR-----------
SYC_MYCPA       ------------------------MTDRPRLRLHDTAAGAV-RDFVPLR-----------
SYC_MYCLE       ------------------------MIDSGHLRLHDTVAGAV-RDFVPLR-----------
SYC_NOCFA       ----------------------------MTLRLFDTESRTM-REFAPLV-----------
SYC_STRAW       ----------------------------MTIRLYDTSARQI-RDFTPLL-----------
SYC_THEFY       ----------------------------MSLRFYDTRTRQV-RDFVPLR-----------
SYC_LEIXX       ----------------------------MTLRLFDTKAGAL-RDFVPLR-----------
SYC_CUTAK       --------------MVSDVSGYTGSLSHVTFKLYNTATHGI-ETFKPLR-----------
SYC_BIFLO       MGNSQEPQDFNISVMPSSLTPVHVAKAAEGLNLYDTASHQV-SHFVPLK-----------
SYC1_TROW8      ----------------------------MTLNLYDTLSRRI-VTLDCR------------
SYC1_TROWT      ----------------------------MTLNLYDTLSRRI-VTLDCR------------
SYC_FRACC       ----------------------------MGLHLYDTRRRRV-RPFEPLR-----------
SYC_RHOBA       -----------MTAADPTASVASPSSAQPAIRVYNTLSKTK-EPFLPLR-----------
SYC_BACFR       --------------------------MEHQLTIYNTLDRKK-ELFVPLHA----------
SYC_BACFN       --------------------------MEHQLTIYNTLDRKK-ELFVPLHA----------
SYC_BACTN       --------------------------MEHQLTIYNTLDRKK-ELFVPLHA----------
SYC_PORGI       --------------------------MEHPLEIYNTLHRKK-ERFEPIHK----------
SYC_CHLCH       ----------------------------MALAIYNSLSRTK-EIFEPLHS----------
SYC_PELLD       ----------------------------MPLVIFNSLGREK-QLFEPLHP----------
SYC_CHLTE       ---------------------------MSSLHIYNSLTRTK-EPFKPIHP----------
SYC_THET2       ----------------------------MGLVIYDTLARRK-VPFEPAVP----------
SYC_THET8       ----------------------------MGLVIYDTLARRK-VPFEPAVP----------
SYC_DEIRA       -------------MTQPTITQDTARQPNPNITLYDTMQRQK-VPFVPGTP----------
SYC_BORBU       ----------------------------MILKLYNTRTKDF-SELTNFEN----------
SYC_BORBP       ----------------------------MILKLYNTRTKDF-SELANFSD----------
SYC_TREDE       ----------------------------MSLKLHNTLGNKK-EEFIPIHE----------
SYC_TREPA       ----------------------------MALRVYNTLTRQQ-EHFQPWEH----------
SYC_NOVAD       ----------------MSVHAPAPFAPSAPLRLFNSLTRQL-EAFQPVHA----------
SYC_ZYMMO       -----------------------MAKPSAPVLFFNSLSKKI-ENFTPIDP----------
SYC1_BURL3      ----------------------------MPLALYDTWSRTV-RPFTPIRA----------
SYC_SALRD       -------------------------MPSPTFRLYNTLTHET-EPVEPIEE----------
SYC_CHLTR       ----------------------------MDLFLYNTLSREK-ERFLPVN-----------
SYC_CHLTA       ----------------------------MDLFLYNTLSREK-ERFLPVN-----------
SYC_CHLMU       ----------------------------MDLFLYNTLSREK-ERFLPSN-----------
SYC_CHLCV       --------------------MRQSSESKQKLYLYNTVSRAK-ELFCSSN-----------
SYC_CHLFF       --------------------MRQSSENSQNLYLYNTATRTK-ELFSASN-----------
SYC_CHLAB       --------------------MRQSSDNRQNLYLYNTASRTK-ELFSPSN-----------
SYC_CHLPN       ----------------------MAFSHIEGLYFYNTASQKK-ELFFPNH-----------
SYC_PARUW       --------------------MNEHALKNIPLRLYNTAERQKQELKPIKG-----------
SYC_LEPIN       ---------------------------MIEIQFYNSLSGRK-EKFSPSDP----------
SYC_LEPIC       ---------------------------MIEIQFYNSLSGRK-EKFSPSDP----------
SYC_CAMJE       ------------------------------MRLLDSVTKEK-IKLD--------------
SYC_CAMJR       ------------------------------MRLLDSVTKEK-IKLD--------------
SYC_HELPY       ------------------------------MFIYDTKLKQK-VPFEPLV-----------
SYC_HELPJ       ------------------------------MFIYDTKLKQK-VPFEPLV-----------
SYC_HELHP       -----------------------------MITLFDSAKKQK-IPFTPIQ-----------
SYC_WOLSU       ----------------------------MMIKIFDSVKREK-VEFIPLK-----------
SYC_SULDN       ------------------------------MFIFDSAKKIK-REFIPQE-----------
SYC_AYWBP       ----------------------------MLQIYNSLTRKKEFFKPDHPP-----------
SYC_ONYPE       ----------------------------MLKIYNSLTRKKEFFNPAHPP-----------
SYC_MYCCT       ------------------------------MQLYD--SLSKTKKNLNKK-----------
SYC_MYCMS       ------------------------------MQLYN--SLSKTKKTLNKK-----------
SYC_MESFL       ------------------------------MKLFD--TLTQEQKNINKE-----------
SYC_MYCGA       ------------------------------MKLYD--TLTKTNVDIDAN-----------
SYC_UREPA       ------------------------------MKLYD--SYSNQLVEINDE-----------
SYC_MYCPE       ------------------------------MKIYDFVSKTDKEVSLDKK-----------
SYC_MYCH2       ------------------------------------------MNLINKK-----------
SYC_MYCMO       ------------------------------------------------------------
SYC_MYCGE       ---------------------------------MIVDSVSQKPTTLVQK-----------
SYC_MYCPN       -------------------------MNQFEPKFTLIDTVSNQSVVLEQK-----------
                                                                            

SYC_AGRFC       -----------ADNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHVYGE----DHVT
SYC_RHIEC       -----------AENVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHVYGE----DHVT
SYC_RHIME       -----------PQNVRMYVCGPTVYDYAHIGNARPIIVFDVLFRLLRHVYGA----DHVT
SYC_RHILO       -----------ALNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHLYGQ----AHVT
SYC_NITWN       -----------PSNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHLYGD----DHVT
SYC_BARHE       -----------ATRVRLYVCGPTVYDYAHIGNARPVIVFDILFRLLRHVYGN----EHVI
SYC_BARQU       -----------ATKVRLYVCGPTIYDYAHIGNARSVIVFDVLFRLLRYVYGN----EHVI
SYC_BRUAB       -----------AKNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHVYGA----QHVT
SYC_BRUA2       -----------AKNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHVYGA----QHVT
SYC_BRUME       -----------AKNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHVYGA----QHVT
SYC_BRUSU       -----------AKNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHVYGA----QHVT
SYC_RHOPA       -----------PANVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHLYGE----AHVK
SYC_RHOP2       -----------PSNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHLYGE----NHVT
SYC_RHOPB       -----------PSNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHLYGP----DHVK
SYC_BRADU       -----------ANNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHLYGE----AHVK
SYC_JANSC       -----------PGRVSLYLCGPTVYDRAHLGNARSAVVFDQLFRLLRHVYGA----ENVT
SYC_RUEPO       -----------PDNVRMYVCGPTVYDRAHLGNGRPVVVFDVLYRLLRHVYGA----DHVT
SYC_RHOS4       -----------RKNVRLYVCGPTVYDRAHLGNGRPVVVFDVLFRLLRHVYGE----GHVT
SYC_ANAMM       -----------SERVGVYVCGPTVYDLAHIGNARSVVVYDVLFRLLKALYPE------VI
SYC_ANAPZ       -----------SACVKIYACGPTVYDLAHIGNARSAVVYDVLFRLLRELYPE------VI
SYC_EHRCJ       -----------VDNIKVYVCGPTVYNFVHIGNARSIVIYDVLFRLLKLLYPS------VT
SYC_EHRCR       -----------IDNVRVYVCGPTVYDFAHIGNARSVVIYDVLFRLLKLLYPK------VT
SYC_EHRRG       -----------VNNVKIYVCGPTVYDFAHIGNSRSIVIYDILFRLLNVLYPK------VT
SYC_EHRRW       -----------VNNVKIYVCGPTVYDFAHIGNSRSIVIYDILFRLLNVLYPK------VT
SYC_WOLPM       -----------KDHVKMYVCGPTVYDTAHIGNARSVVVYDVLFQLLKFCYGK------VT
SYC_WOLTR       ----------------MYVCGPTVYDTAHIGNARSIVVYDVLFQLLKFCYGK------AT
SYC_NEOSM       -----------SEVVRMYVCGPTVYDVPHIGNIRASVVYDIVYRVLLKLFPE------VI
SYC_RICCN       -----------QANVKMYVCGPTVYYNPHIGNSRSGVVYDLLYRIVIKIFGE----KAVK
SYC_RICFE       -----------QTKVKMYVCGPTVYDNPHIGNSRSVVVYDLLYRIVIKIFGE----QSVK
SYC_RICPR       -----------PANIKMYVCGPTVYDNPHIGNSRSVVVYDLLYRIIIKIFGK----KAVK
SYC_RICTY       -----------HANVKMYVCGPTVYDNPHIGNSRSVVVYDLLYRIIIKIFGK----KAVK
SYC_RICBR       -----------QTNVKMYVCGPTVYDNPHIGNSRSVVVYDLLYRILVDIFEA----KSVK
SYC_PELUB       -----------KENIGMYVCGPTVYDNPHIGNARPLVIFDILFKVLKSKYGH----DKIN
SYC_XANOR       -----------PSSPTLYVCGPTVYNYAHIGNARGPVVFDVLAALLRRRYG------ALR
SYC_XANOM       -----------PSSPTLYVCGPTVYNYAHIGNARGPVVFDVLAALLRRRYG------ALR
SYC_XANAC       -----------PSSPTLYVCGPTVYNYAHIGNARGPVVFDVLAALLRRRYG------ALR
SYC_XANC5       -----------PSSPTLYVCGPTVYNYAHIGNARGPVVFDVLAALLRRRYG------ALR
SYC_XANCP       -----------PSSPTLYVCGPTVYNYAHIGNARGPVVFDVLAALLRRRYG------ALR
SYC_XANC8       -----------PSSPTLYVCGPTVYNYAHIGNARGPVVFDVLAALLRRRYG------ALR
SYC_XYLFA       -----------PACPTMYVCGPTVYNYVHIGNARGPVVFGVLAALLRRRYG------ALR
SYC_XYLFT       -----------PACPTMYVCGPTVYNYVHIGNARGPVVFGVLAALLRRRYG------ALR
SYC_CAUVC       -----------PQRVTMYVCGPTVYNYAHIGNFRPVVVFDVLFRVLRHLYGE----DAVV
SYC_MAGSA       -----------PGHVGMYVCGPTVYDRAHIGNARPVIVFDVLYRLLKTLYP------SVR
SYC_RHORT       -----------PGHVRLYVCGPTVYDRAHIGNARPVIVFDLLARLLRRLYP------QVT
SYC_GLUOX       -----------PENVRVYFCGPTVYDRAHLGNLRAMMCADILIRLLRTMYP------RVT
SYC_SACD2       -----------PQSIKMYVCGPTVYNLVHIGNARPVVVFDVLFRVLKTLYP------EVV
SYC_PSYA2       -----------EGKVGMYVCGMTVYDYCHIGHARVMVGFDMAVRWLA--QLG----YDVN
SYC_PSYCK       -----------TGKVGMYVCGMTVYDYCHIGHARVMVGFDMAVRWLA--QLG----YDVN
SYC_ACIAD       -----------PGHIDMYVCGMTVYDYCHIGHARVMVAFDYIIRFLR--SQG----WDVR
SYC_PSEF5       -----------GNKVRMYVCGMTVYDYCHLGHGRSMVAFDLITRWLR--FSG----YDLT
SYC_PSEPF       -----------GNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLR--FSG----YDLT
SYC_PSE14       -----------GNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLR--FSG----YELT
SYC_PSEU2       -----------GNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLR--FSG----YELT
SYC_PSESM       -----------GNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLR--FSG----YDLT
SYC_PSEPK       -----------GNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLR--KSG----YELT
SYC_PSEAE       -----------GNQVRMYVCGMTVYDYCHLGHGRSMVAFDVITRWLR--HRG----YDLT
SYC_HAHCH       -----------AGKVGIYVCGMTVYDYCHLGHARVLVCFDIITRYLR--AKG----YDVN
SYC_BURMA       -----------PGEVRMYVCGITVYDYCHIGHARMVVVFDIVQRWLR--ARG----YRVT
SYC_BURPS       -----------PGEVRMYVCGITVYDYCHIGHARMVVVFDIVQRWLR--ARG----YRVT
SYC_BURP1       -----------PGEVRMYVCGITVYDYCHIGHARMVVVFDIVQRWLR--ARG----YRVT
SYC_BURTA       -----------PGEVRMYVCGITVYDYCHIGHARMVVVFDIVQRWLR--AAG----YRVT
SYC2_BURL3      -----------SGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLR--AIG----YRVT
SYC_CUPPJ       -----------PGKVRMYVCGMTVYDYCHVGHARVMVVFDMVHRWLR--AAG----YDVT
SYC_RALSO       -----------PGRVRMYVCGMTVYDYCHVGHARVMVVFDMVQRWLR--ASG----YDVT
SYC_DECAR       -----------PNKVRMYVCGMTVYDYCHLGHARVMVVFDMVYRWLK--ASG----YDVT
SYC_AROAE       -----------PGKVRMYVCGMTVYDYCHLGHARVMVVFDMVARWLR--ASG----FELT
SYC_THIDA       -----------PGRVRMYVCGMTVYDLCHLGHARVFVVFDMVTRWLR--ASG----YAVE
SYC_NEIG1       -----------PENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLR--ECG----YPLT
SYC_NEIMB       -----------PENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLR--ECG----YPLT
SYC_CHRVO       -----------PGKVSMYVCGMTVYDLCHIGHARMLAAFDVIYRWLK--ASG----YDVN
SYC_NITEU       -----------PGEVRMYVCGMTVYDYCHLGHARVLVVFDSVVRWLQ--TLG----YKVI
SYC_NITMU       -----------PGKVKVYVCGMTVYDYCHLGHARVMVVFDMVQRWFR--ANR----FDVT
SYC_BORBR       -----------AGQVRMYVCGMTVYDYCHLGHARMLVAFDVVQRWLR--ASG----LAVD
SYC_BORPA       -----------AGQVRMYVCGMTVYDYCHLGHARMLVAFDVVQRWLR--ASG----LAVD
SYC_BORPE       -----------AGQVRMYVCGMTVYDYCHLGHARMLVAFDVVQRWLR--ASG----LAVD
SYC_BORA1       -----------AGEVRIYVCGMTVYDYCHLGHARMLVAFDVVQRWLR--ASG----YAVN
SYC_RHOFT       -----------PGHVRMYVCGMTVYDLCHLGHARAMVAFDVVQRWLK--VSG----LRVT
SYC_METCA       -----------PRRVRMYVCGMTVYDYCHLGHARVMVVFDMVARYLR--HLG----LKVT
SYC_NITOC       -----------SGKVRMYVCGMTVYDLCHVGHARVMVVFDMVVRYLR--ASG----FEVI
SYC_HYDCU       -----------PNKVGLYVCGVTVYDYCHVGHARVMVVFDTVVRHLR--SLG----YDVT
SYC_LEGPL       -----------PGKIGMYVCGITVYDHCHLGHARSMVAFDVMVRYLR--SQG----FDVT
SYC_LEGPA       -----------PGKIGMYVCGITVYDHCHLGHARSMVAFDVMVRYLR--SQG----FDVT
SYC_LEGPH       -----------PGTIGMYVCGITVYDHCHLGHARSMVAFDVMVRYLR--SQG----FDVT
SYC_BLOFL       -----------CGEIKIYVCGITVYDLCHLGHARTFVIFDTILRYLK--HYG----YQVK
SYC_BLOPB       -----------AGKIKIYVCGVTVYDLCHLGHARTFIVFDSVIRYLR--HCG----YQVS
SYC_BUCAI       -----------KNRVNLYVCGVTVYDFCHIGHGRTFVVFDMIVRYLR--FSG----FQVK
SYC_BUCAP       -----------NKKINLYVCGVTVYDFCHIGHARTFVVFDMIVRYLR--LIG----FQVK
SYC_BUCBP       -----------KKTINMYVCGITAYDFCHIGHGRTFIFFDVVVRYLR--SLG----YALK
SYC_WIGBR       -----------SNIVNVYVCGITPYDLCHIGHARTLVFFDIMIKYFQ--YKG----YRTN
SYC_COLP3       -----------AGKVGLYVCGCTVYDLCHIGHGRTYISFDNIARYLR--FSG----YDVN
SYC_PSET1       -----------EGKIDMYVCGITIYDYCHIGHARTFVGFDVIVRYLR--HIG----YDLK
SYC_IDILO       -----------PGHVGIYVCGVTTYDYCHIGHARTYVAFDIVVRYLR--KLG----YSVK
SYC_ECOL6       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SHIFL       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_ECOLI       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_ECO57       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SHISS       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SHIBS       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SHIDS       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SALCH       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SALTY       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SALPA       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_SALTI       -----------AGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--FLG----YKLK
SYC_PECAS       -----------ADQVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLR--YLG----YSLK
SYC_YERPE       -----------AGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLR--YLG----YSLT
SYC_YERPS       -----------AGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLR--YLG----YSLT
SYC_PHOLL       -----------PGKVGMYVCGITIYDLCHIGHGRTFVSFDVVARYLR--YLG----YDLT
SYC_SODGM       -----------AGKVGMYVCGITVYDLCHIGHGRTFVAFDVVTRYLR--YRG----YEVN
SYC_VIBVU       -----------AGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLR--YLG----YDLT
SYC_VIBVY       -----------AGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLR--YLG----YDLT
SYC_VIBPA       -----------AGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLR--YLG----YDLT
SYC_VIBCH       -----------AGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVARYLR--YLG----YDLT
SYC_ALIF1       -----------EGKVGMYVCGVTIYDLCHIGHGRTFVSFDVISRYLR--FLG----YDLT
SYC1_PHOPR      -----------PGKIGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLR--YSG----YDLT
SYC_SHEON       -----------PGKVGMYVCGVTVYDLCHIGHGRTFVSFDMIVRYLR--YAG----YEVN
SYC_HAEDU       -----------PAQVGMYVCGVTVYDLCHFGHGRTFVSFDVIARYLR--YSG----YNLR
SYC_MANSM       -----------PNKVGMYVCGVTVYDLCHFGHGRTFVSFDVITRYLR--YLG----YDLR
SYC_HAEIN       -----------ENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLR--SLG----YDLT
SYC_HAEI8       -----------ENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLR--SLG----YDLT
SYC_PASMU       -----------ANKVGMYVCGITVYDLCHVGHGRTFVCFDVIARYLR--YLG----YDLT
SYC_FRATH       -----------ANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFK--YRG----YDVT
SYC_FRATT       -----------ANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFK--YRG----YDVT
SYC_COXBU       -----------SGKVKLYVCGMTVYDYMHIGHGRSWIIFDMVVRYLR--MRG----YEVT
SYC_DESAG       -----------EGKASVYVCGITAYDLCHLGHARSSVAFDVLVRYLR--HTG----LDVT
SYC_DESVH       -----------PGKVNMYVCGITAYDLCHIGHARSAVVFDVLVRYLR--HTG----LDVT
SYC_ANADE       -----------PGKLRLYVCGPTVYDYSHLGHARCYVVWDVVVRHLR--ARG----LEVR
SYC_GEOMG       -----------PGRVSMYVCGVTVYDHCHIGHARANVVFDMIYRYLR--HAG----YDVT
SYC_GEOSL       -----------PGRVKMYVCGVTVYDHCHIGHARANVVFDMIYRYLR--HAG----YEVT
SYC_PELCD       -----------PGKVGMYVCGVTVYDYCHIGHARANVVFDIIYRYLQ--FIG----FDVT
SYC_DESPS       -----------PNHVKLYVCGITSYDYCHIGHARSALAFDMIVRYLR--YLD----YKVT
SYC_NOSS1       ----------EPGKVKMYCCGVTVYDYCHLGHARSYIVWDTIRRYLI--WRG----FGVK
SYC_TRIV2       ----------EPGKVKMYCCGVTVYDYCHLGHARSYIVWDTIRRYLI--WRG----FEVK
SYC_SYNY3       ----------HPGLVTMYCCGITVYDYCHLGHARTCITWDLVRRYLQ--WSG----YEVR
SYC_SYNP6       ----------QAGSVSLYCCGVTVYDYCHLGHARSYIVWDTLRRYLL--WLG----YRVR
SYC_SYNE7       ----------QAGSVSLYCCGVTVYDYCHLGHARSYIVWDTLRRYLL--WLG----YRVR
SYC_THEEB       ----------HPERVTIYACGVTVYDYCHLGHARSYVAWDVLRRYLT--FLG----YTVH
SYC_GLOVI       ----------EAGTVKMYVCGVTVYDYCHLGHGRTYVVWDTVRRYLI--SRG----YAVT
SYC_SYNJB       SQGSAAPVAEEKPLVRMYVCGVTVYDLCHLGHARTYVVWDMVRRYLE--WRG----YRVK
SYC_SYNJA       AAG------GEKPLVRMYVCGVTVYDLCHLGHARTYVVWDMVRRYLE--CRG----YRVK
SYC_SYNS9       -----------PGKASIYCCGVTVYDLCHLGHARSYINWDVLRRYLI--WSG----LDVR
SYC_SYNPX       -----------PGKASIYCCGVTVYDLCHLGHARSYINWDVLRRFLI--WRG----LEVT
SYC_PROMM       -----------DGHVSIYCCGVTVYDLCHLGHARSYIAWDVLRRYLI--WRG----YTVT
SYC_SYNSC       -----------EGKASIYCCGVTVYDLCHLGHARSYINWDVLRRYLI--WRG----YDVT
SYC_PROMA       -----------PGEVSIYCCGVTVYDLCHLGHARSYIVWDVLRRYFI--AQG----YKVK
SYC_PROMT       -----------PNQVKIYCCGVTVYDLCHLGHARSYLNWDVLRRFLI--WKG----FEVK
SYC_PROM9       -----------D-VVKIYCCGVTVYDLCHLGHARSYIAWDVLRRFLI--YSD----FKVK
SYC_PROMP       -----------E-VVKIYCCGVTVYDLCHLGHARSYIAWDILRRFLI--YSD----YKVK
SYC_AQUAE       -----------PPKVLIYTCGVTVYDDSHVGHGRSLIVFDVFRRFLE--HLG----YQVK
SYC_THEMA       -----------PGVVRMYVCGPTVYDLIHVGNARPALVFDVFRRYLE--YRG----YRVI
SYC_BACAN       -----------ENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLE--YKG----YDVQ
SYC_BACHK       -----------ENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLE--YKG----YDVQ
SYC_BACCZ       -----------ENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLE--YKG----YDVQ
SYC_BACC1       -----------ENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLE--YKG----YDVQ
SYC_BACCR       -----------ENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLE--YKG----YDVQ
SYC_BACLD       -----------EGKVKMYVCGPTVYNYIHIGNARPAIVFDTVRKYLE--YKG----YEVQ
SYC_BACSU       -----------EGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLE--YKG----YDVQ
SYC_GEOKA       -----------PNKVKMYVCGPTVYNYIHIGNARAAIVFDTIRRYLE--FRG----YDVT
SYC_OCEIH       -----------EGKVKMYVCGPTVYNYIHIGNARPAIVFDTVRRYLE--YRG----FDVD
SYC_BACSK       -----------EGKVKMYCCGPTVYNYIHIGNARPPIVYDMVRRYLT--YRG----YDVT
SYC_BACHD       -----------EGKVKMYVCGPTVYNYIHIGNARPPIVYDMIRRYLK--YRG----YEVL
SYC_LISMO       -----------DGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFT--YRG----YDVK
SYC_LISMF       -----------DGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFT--YRG----YDVK
SYC_LISIN       -----------DGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFT--YRG----YDVK
SYC_STAAC       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAA3       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAAM       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAAN       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAAS       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAAW       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAAB       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAAR       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YNVE
SYC_STAES       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YKG----YEVI
SYC_STAEQ       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YKG----YEVI
SYC_STAHJ       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YKG----YEVI
SYC_STAS1       -----------PGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFE--YQG----YEVV
SYC_LACPL       -----------PGVVKMYVCGPTVYNYIHIGNARSAIAFDTIRRYFE--YCG----YHVD
SYC_LACSS       -----------EGRVKMYVCGPTVYNYIHIGNARSAIAFDTIRRYLE--YRG----YQVD
SYC_ENTFA       -----------ARKVRMYVCGPTVYNYIHIGNARSAIAFDTIRRYFE--YRG----YEVN
SYC_LACAC       -----------PGQISMYVCGPTVYNYIHIGNARSSIAFDTIRRYFE--YKG----YQVK
SYC_LACJO       -----------AGKVSMYVCGPTVYNYIHIGNARSVIAFDTIRRYFE--YRG----YDVN
SYC_STRA1       -----------EGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFE--YCG----YQVN
SYC_STRA5       -----------EGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFE--YCG----YQVN
SYC_STRA3       -----------EGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFE--YCG----YQVN
SYC_STRPM       -----------ENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFE--YTG----YQVN
SYC_STRP3       -----------ENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFE--YTG----YQVN
SYC_STRP8       -----------ENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFE--YTG----YQVN
SYC_STRP6       -----------ENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFE--YTG----YQVN
SYC_STRP1       -----------ENTVNIYVCGPTVYNYIHIGNARSAVAFDTIRRYFE--YTG----YQVN
SYC_STRT2       -----------ENTVNMYVCGPTVYNYIHIGNARSTVAFDTIRRYFE--YRG----YTVN
SYC_STRT1       -----------ENTVNMYVCGPTVYNYIHIGNARSTVAFDTIRRYFE--YRG----YTVN
SYC_STRMU       -----------ENTVNMYVCGPTVYNYIHVGNGRSAIAFDTIRRYFE--YRG----YTVN
SYC_STRPN       -----------DGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFE--YRG----YKVA
SYC_STRR6       -----------DGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFE--YRG----YKVA
SYC_LACLA       -----------PGKVKMYVCGPTVYNYIHVGNARSVVAFDLVRKYLE--FRG----FEVQ
SYC_CLOPE       -----------PGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYFE--YRG----FKVD
SYC_CLOTE       -----------TGEVNMYVCGPTVYNFFHIGNGRTFIVFDTVRRYLE--YKG----YKVK
SYC_CLOAB       -----------PNEVQMYVCGPTVYNFFHIGNARTFIVFDTVRKYFE--YRG----YKVN
SYC_CALS4       -----------DKVVNMYVCGPTVYNYIHIGNARAFIVFDTVRRYLE--YKG----YTVN
SYC_SYMTH       -----------PGKVRFYNCGPTVYDYFHIGNARNFVVFDTVRRYLE--YRG----YQVT
SYC_CARHZ       -----------PGKVYMYVCGPTTYNYIHIGNARPIVFFDTVRRYFE--YKG----FEVI
SYC_MOOTA       -----------PGRVRMYVCGPTTYNYIHLGNARPMVVFDTLRRYLE--YRN----YDVL
SYC_FUSNN       -----------ENEVSMYVCGPTVYNYIHIGNARPAIFFDTVRRYLE--YRG----YKVN
SYC_DEHM1       -----------DGKVKMYVCGITPQSEPHIGHAMSYINFDVIRRYLS--YKG----YRVK
SYC_DEHMC       -----------NGKVKMYVCGITPQSEPHIGHAMSYINFDVIRRYLT--YKG----YRVK
SYC_BDEBA       -----------PGQVKMYVCGPTVYNFLHVGNFRGPVVFNMVRNWLE--HLG----YKVT
SYC_COREF       -----------PGHASVYLCGATPQAQPHIGHVRSGVAFDILRRWLLA--KG----LDVA
SYC_CORGL       -----------PGHASVYLCGATPQSSPHIGHVRSAVAFDILRRWLMA--KG----LDVA
SYC_CORDI       -----------PGHASIYLCGATPQTQPHIGHVRSGVAFDILRRWLIA--QG----LDVA
SYC_CORJK       -----------EGHASIYLCGATVQSIPHIGHVRSGVAFDILRNWLEA--KG----LDVA
SYC_MYCBO       -----------PGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLLA--RG----YDVA
SYC_MYCTU       -----------PGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLLA--RG----YDVA
SYC_MYCPA       -----------DGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLIA--LG----YDVA
SYC_MYCLE       -----------AGHVSIYLCGATVQGQPHIGHVRSGVAFDILRRWLMA--RG----YDVA
SYC_NOCFA       -----------PGRASVYLCGATVQGEPHIGHVRSGVAFDVLRRWLQA--HD----YDVW
SYC_STRAW       -----------PGCVSIYLCGATVQAAPHIGHIRSGLNFDIMRRWFEY--RG----YDVT
SYC_THEFY       -----------EGCVSLYLCGATVQAPPHIGHIRSGVSFDILRRWLMY--RG----YRVI
SYC_LEIXX       -----------SGEVGMYVCGPTVQASPHIGHLRSALVYDQLRRWLTY--RG----LAVT
SYC_CUTAK       -----------EGQVSIYHCGMTVQSSPHLGHIRKEVVFDVLRRWLEC--SG----YRVT
SYC_BIFLO       -----------PGEVGIYVCGATVQSSPHIGHIRAAVAFDIVRRWFLK--LG----YKVT
SYC1_TROW8      ------------DRVELYVCGPTVQSPPHIGHMRSGVVYDCLRRWLEY--KG----LPVL
SYC1_TROWT      ------------DRVELYVCGPTVQSPPHIGHMRSGVVYDCLRRWLEY--KG----LPVL
SYC_FRACC       -----------PGHVGVYVCGPTVQAAPHVGHIRTALPFDLLRRWLVQ--SG----RSVT
SYC_RHOBA       -----------APRVGMYLCGPTVYAESHIGHMVGPVIFDTIKRYLTY--SG----YEVT
SYC_BACFR       ------------PHVGMYVCGPTVYGDAHLGHARPAITFDVLFRYLT--RLG----YKVR
SYC_BACFN       ------------PHVGMYVCGPTVYGDAHLGHARPAITFDVLFRYLT--RLG----YKVR
SYC_BACTN       ------------PHVGMYVCGPTVYGDAHLGHARPAITFDVLFRYLT--HLG----YKVR
SYC_PORGI       ------------PHVGLYVCGPTVYGDAHLGHARPAITFDLLYRYLR--HLG----YQVR
SYC_CHLCH       ------------GVVSIYVCGPTVYGHAHLGHAKSYISFDVVVRWFR--QSG----YKVK
SYC_PELLD       ------------GVVGIYVCGPTVYGHAHLGHAKSYVSFDVVVRWLR--ESG----YRVK
SYC_CHLTE       ------------GLATIYVCGPTVYGHAHLGHAKSYVSFDVVVRWLR--HVGEEQGYKVR
SYC_THET2       ------------GHVGIYVCGPTVYSDPHLGHARGPVVYDILRRYFL--HKG----YKVR
SYC_THET8       ------------GHVGIYVCGPTVYADPHLGHARGPVVYDVLRRYLL--HKG----YKVR
SYC_DEIRA       ------------GYVGMYLCGPTVYSDAHLGHAKKEVAFDVIRRALT--HFG----YQVR
SYC_BORBU       --------------VKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLR--FLG----YKVN
SYC_BORBP       --------------VKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLR--FLG----YKVN
SYC_TREDE       ------------GKAGVYGCGPTVYDYAHIGNLRTYVFQDILVKTLR--FLG----YDVT
SYC_TREPA       ------------GHVRLYGCGPTVYNYPHLGNLRAYVFQDTVRRTLH--FLG----YRVT
SYC_NOVAD       ------------GEARVYSCGPTVYNYPHIGNMRAYVFADLLGRTLS--FKG----LKLT
SYC_ZYMMO       ------------ERVRLYSCGPTVYNFAHLGNLRAYVFTDSLRRMLN--WKG----YPVN
SYC1_BURL3      ------------GQVGMYGCGPTVYDDAHIGNLRTYVFEDLLRRVLE--RNG----YAVR
SYC_SALRD       ------------EHLRFYSCGPTVYMYAHIGNFRSFLTADLIRRTAE--AIG----WDVT
SYC_CHLTR       ------------DPVKLYTCGPTVYDYAHIGNFRTYIFEDLLKRVLL--FLG----YSVY
SYC_CHLTA       ------------DPVKLYTCGPTVYDYAHIGNFRTYIFEDLLKRVLL--FLG----YSVY
SYC_CHLMU       ------------DPVKLYTCGPTVYDYAHIGNFRTYVFEDLLKRVLL--FLG----YSVH
SYC_CHLCV       ------------DPVKLYTCGPTVYDYAHIGNFRTYVFEDLLKRTLL--FFG----YSVR
SYC_CHLFF       ------------APVKLYTCGPTVYDYAHIGNFRTYVFEDLLKRTLL--FFG----YSVK
SYC_CHLAB       ------------DPVKLYTCGPTVYDYAHIGNFRTYIFEDLLKRILL--FFG----YSVK
SYC_CHLPN       ------------TPVRLYTCGPTVYDYAHIGNFRTYVFEDILKRTLV--FFG----YSVT
SYC_PARUW       ------------NHIQLYTCGPTVYHYAHIGNFRTYIFEDLLRRTIQ--FFG----FSIT
SYC_LEPIN       ------------NRVTVYSCGPTVYNFAHIGNLRAFLFVDVLRRSLK--LLG----YGVD
SYC_LEPIC       ------------NRVTVYSCGPTVYNFAHIGNLRAFLFVDVLRRSLK--LLG----YGVD
SYC_CAMJE       -----------KKDISIYLCGPTVYDDAHLGHARSSVCFDLLRRVLLAQG------NRVK
SYC_CAMJR       -----------KKDISIYLCGPTVYDDAHLGHARSSVCFDLLRRVLLAQG------NRVK
SYC_HELPY       -----------QNKANIYVCGPTVYDDAHLGHARSAIAFDLLRRTLELSG------YEVM
SYC_HELPJ       -----------HNKANIYVCGPTVYDDAHLGHARSAIAFDLLRRTLELSG------YEVV
SYC_HELHP       -----------DNQIRLYVCGPTVYDDAHLGHARSSIVFDLWRRLFLFLG------FEVV
SYC_WOLSU       -----------KGEVSLYVCGPTVYDDSHLGHARSAIAFDLLRRLMEFEG------YRVR
SYC_SULDN       -----------QGKVSLYVCGPTVYDDAHLGHAKSALVFDLLCRVLNANG------YEVT
SYC_AYWBP       -------------QINIYVCGPTVYNHLHLGNTRPLIFFDTVKRYLEMLK------FKVY
SYC_ONYPE       -------------QINMYVCGPTVYNHLHLGNTRPLIFFDTVKRYLEMLN------FRVY
SYC_MYCCT       -------------TINLYCCGPTVYNYIHIGNARPVILVDVLTRYLKSRN------IKIN
SYC_MYCMS       -------------TINLYCCGPTVYNYIHIGNARPILLVDVLIRYLKSRS------IKVN
SYC_MESFL       -------------VINIYSCGPTIYDYIHIGNARPIILMDTLIRFLESEG------IKVN
SYC_MYCGA       -------------EINIYVCGPTVYDHIHIGNLRPIVTFDVLRRLLEHSN------KKVN
SYC_UREPA       -------------LISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHN------IKTK
SYC_MYCPE       -------------NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELG------YNVT
SYC_MYCH2       -------------NLNIYLCGPTVYSDVHIGNLRTIIIFDAIFECLKNKG------FSIN
SYC_MYCMO       -------------MKYIYVCGPTVYNKVHIGNMKPIMTFDLFLRGANFIE------KQYL
SYC_MYCGE       -------------TINIYLCGPTVYNDLHLGNTRPLIVFDVLNRVLKKAK------YTVN
SYC_MYCPN       -------------QINIYLCGPTVYNDLHLGNTRPLIVFDVLQRVLQAAQ------YKVQ
                                .* ** *     *.*:       .                    

SYC_AGRFC       YARNITDLDDKINARAL----RDYPH------LPLNDAIHAVTKKTADQFHDDVAALGCL
SYC_RHIEC       YARNITDVDDKINARAL----RDHPG------LPLNEAIRAVTEKTETQFHADVAELGCL
SYC_RHIME       YARNITDVDDKINARAL----RDYPG------LPLNEAIRHVTEKTETQFLEDATVLGCL
SYC_RHILO       YVRNITDVDDKINARAL----RDFGSEISAGKLSLNEAIRRVTEKTADQFHRDVATLGCL
SYC_NITWN       YARNITDVDDKINDRAA----RDFPD------LPLNEAIRKVTEKTAAQFQADVAALGCL
SYC_BARHE       YARNITDVDDKINARAA----YEYPE------LALNDAIRQLTQLTYTQFQQDTMALGCL
SYC_BARQU       YVRNITDVDDKINARAA----CEHPE------LALNDAIRQLTERTYSQFQQDTMALGCL
SYC_BRUAB       YARNITDVDDKINARAA----RDYPD------LPFNEAIRKVTESTNAQFQADVTALGNL
SYC_BRUA2       YARNITDVDDKINARAA----RDYPD------LPFNEAIRKVTESTNAQFQADVTALGNL
SYC_BRUME       YARNITDVDDKINARAA----RDYPD------LPFNEAIRKVTESTNAQFQADVTALGNL
SYC_BRUSU       YARNITDVDDKINARAA----RDYPD------LPFNEAIRKVTESTNAQFQADVTALGNL
SYC_RHOPA       YVRNITDVDDKINDRAA----RDYPG------LPLNEAIRKVTEQTERQFHDDVDALGCL
SYC_RHOP2       YVRNITDVDDKINDRAA----RDYPG------LPLNEAIRKVTEQTERQFHDDVDALGCL
SYC_RHOPB       YVRNITDVDDKINDRAT----RDFPG------LPLNEAIRKVTEQTEKQFHDDVDALGCL
SYC_BRADU       YVRNITDVDDKINDRAA----RDFPG------LPLNEAIREVTEQTGKQFHADVDALGAL
SYC_JANSC       FVRNFTDVDDKINARAL----AEGRE------------IADLTAETSQWYLDDTRALGVL
SYC_RUEPO       YVRNFTDVDDKINARAA----ERGRP------------IGDITAETTQWFLDDMGALGAL
SYC_RHOS4       YVRNFTDVDDKINAAAL----ARKDAG---DPRSLEALIRERTDETIRWYHEDMDALGAL
SYC_ANAMM       YVRNITDVDDKIINATE----SENKS------------IAELTAHYTKLFHEDIEALNCL
SYC_ANAPZ       YVRNITDVDDKIINAAA----ETGQN------------IGDFTERYIRYFHEDMDALNCL
SYC_EHRCJ       YVRNITDIDDKIINVAQ----SNGQN------------ICEVTSVYIKAFHEDMKMLNCL
SYC_EHRCR       YVRNITDIDDKIINVAQ----NTNQS------------IYDVTAIYIKAFHEDMRMLNCL
SYC_EHRRG       YIRNITDIDDKIINVAQ----NNNQN------------IYDVTARYIKAFNEDMGRLNCL
SYC_EHRRW       YIRNITDIDDKIINVAQ----NNNQN------------IYDVTARYIKAFNEDMGRLNCL
SYC_WOLPM       YVRNITDIDDKIINAAS----EKNSN------------IESISTYYTKAFHEDMRSINCA
SYC_WOLTR       YVRNITDIDDKIINAAN----EKDSS------------IESISTYYTRAFHEDMRSINCV
SYC_NEOSM       YVRNITDVDDKIITAAS----VRGVK------------CDKVALHYEHIFHEHLGLLNCL
SYC_RICCN       YVRNITDVDDKIIDRAA----LLGVT------------IDELTDKVTKEFHKNMAYLGCM
SYC_RICFE       YVRNITDVDDKIIDRAE----LLSIT------------INELTDKVTQEFHTNMAYLGCL
SYC_RICPR       YVRNITDVDDKIIDRAE----LLGIT------------INDLTDKVTREFHINMEYLGCM
SYC_RICTY       YVRNITDIDDKIIDRAE----SLGIN------------INDLTNKVTREFHINMAYLGCM
SYC_RICBR       YVRNITDVDDKIIERAA----NLGIS------------INELTDKVTKEFHTNMKYLFCL
SYC_PELUB       YIRNITDVDDKIIKSAK----EKNLS------------ISELTNNVIKDFNDDCNYLNLD
SYC_XANOR       YARNITDVDDKINAAAQ----AQGVP------------ISTITDRFAAIYRQDMAALGVV
SYC_XANOM       YARNITDVDDKINAAAQ----AQGVP------------ISTITDRFAAIYRQDMAALGVV
SYC_XANAC       YARNITDVDDKINAAAQ----AQGVP------------ISTITDRFAAIYRQDMAALGVV
SYC_XANC5       YARNITDVDDKINAAAQ----AQGVP------------ISTITDRFAAIYRQDMAALGVV
SYC_XANCP       YARNITDVDDKINAAAQ----AQGVP------------ISTITDRFAAIYRQDMAALGVV
SYC_XANC8       YARNITDVDDKINAAAQ----AQGVP------------ISTITDRFAAIYRQDMAALGVV
SYC_XYLFA       YARNITDVDDKINTAAQ----EQGVP------------ISAITERFCAAYREDMKKLGVE
SYC_XYLFT       YARNITDVDDKINTAAQ----EQGVP------------ISAITERFCAAYREDMKKLGVE
SYC_CAUVC       YARNVTDVDDKINQKAA----DEGVP------------ISVITDRYLAAYHQDADALGAL
SYC_MAGSA       YVRNITDVDDKINARAK----ESGEP------------ISAITERTTAMFHEDIGALNCL
SYC_RHORT       YVRNITDVDDKINARAS----ASGRT------------IGEITEETTRLFHEDMAELGAL
SYC_GLUOX       YVRNVTDVDDKINARAK----ENGED------------ISALTERTTQAFHEDLASLFIL
SYC_SACD2       YARNITDIDDKIMKAAK----ENGES------------ISALTARFTEAYIEDMAALHNL
SYC_PSYA2       YVRNITDIDDKIIARAA----ENGEE------------IGALTQRFITAMHEDATALGCQ
SYC_PSYCK       YVRNITDIDDKIITRAA----ENGEE------------IGTLTQRFITAMHEDATALGCL
SYC_ACIAD       YIRNITDIDDKIIKRAN----ENNET------------IQQLTSRFIDAMNEDAAKLGCA
SYC_PSEF5       YVRNITDIDDKIINRAN----ENGEA------------FEALTERMIAAMHEDEARLNIK
SYC_PSEPF       YVRNITDIDDKIINRAN----ENGES------------FEALTERMIAAMHEDEARLNIK
SYC_PSE14       YVRNITDIDDKIINRAR----DNGES------------FDALTARMIDAMHEDEARLNIL
SYC_PSEU2       YVRNITDIDDKIINRAR----ENGES------------FDALTARMIEAMHEDEARLNIL
SYC_PSESM       YVRNITDIDDKIINRAR----DNGES------------FDALTARMIDAMHEDEARLNIL
SYC_PSEPK       YVRNITDIDDKIINRAN----ENGET------------FDALTARMIDAMHEDERRLNIL
SYC_PSEAE       YVRNITDIDDKIINRAN----ENGEP------------FDVLTERMIAAMHEDEARLNIL
SYC_HAHCH       YVRNITDVDDKILNRAR----DNGES------------VDALTARFIDAMHEDERALGVL
SYC_BURMA       YVRNITDIDDKIIRRAV----ENGET------------IQSLTRRFTDAMNADFDALGVE
SYC_BURPS       YVRNITDIDDKIIRRAV----ENGET------------IQSLTRRFTDAMNADFDALGVE
SYC_BURP1       YVRNITDIDDKIIRRAV----ENGET------------IQSLTRRFTDAMNADFDALGVE
SYC_BURTA       YVRNITDIDDKIIRRAL----ENGET------------IQSLTRRFIDAMNADFDALGVE
SYC2_BURL3      YVRNITDIDDKIIRRAV----ENGET------------IKSLTDRFIGAMHDDESALGIQ
SYC_CUPPJ       FVQNITDIDDKIIRRAA----ENGET------------IGQLTTRFIQYMHEDADALGIV
SYC_RALSO       YVRNITDIDDKIIKRAV----ENGET------------IGALTNRFIAAMHEDADALGVQ
SYC_DECAR       YVRNITDIDDKIIKRAI----ENGET------------IQQLTNRFIAFMHEDADALGVQ
SYC_AROAE       YVRNITDIDDKIIRRAG----EKGES------------IRTLTDRFIAAMHEDADALGVL
SYC_THIDA       YVRNITDIDDKIIKRAH----ENKET------------PAALTERFIAEMHEDERALGVL
SYC_NEIG1       YVRNITDIDDKIIARAA----ENGET------------IGELNARFIQAMHEDADALGVL
SYC_NEIMB       YVRNITDIDDKIIARAA----ENGET------------IGKLTARFIQAMHEDADALGVL
SYC_CHRVO       YVRNITDIEDKIIKRAL----ERGIT------------PEQLVEETIADMRQDAAALGLL
SYC_NITEU       YVRNITDVDDKIIRRAL----ENHEP------------FSALTARYIQAMEEDAMALGVI
SYC_NITMU       YVRNITDIDDKIIRRAQ----ENKES------------IEALTARFIQAMEEDAAALGVE
SYC_BORBR       YVRNITDIDDKIIRRAV----ETGRR------------IGEVTEYYIAAMHADERALGVQ
SYC_BORPA       YVRNITDIDDKIIRRAV----ETGRR------------IGEVTEYYIAAMHADERALGVQ
SYC_BORPE       YVRNITDIDDKIIRRAV----ETGRR------------IGEVTEYYIAAMHADERALGVQ
SYC_BORA1       YVRNITDIDDKIIRRAV----QTGRR------------MHEVTDYFIAAMHADERALAVE
SYC_RHOFT       YVRNVTDIDDKIIKRAL----ENGES------------IRALTERMVDALHQDADALGIE
SYC_METCA       YVRNVTDIDDKIIRRAV----ENGET------------IGALTARFIEAMHEDERALGVL
SYC_NITOC       YVRNITDIDDKIIHRAN----ERGES------------IHTLTARYIQALHEDEASLQIL
SYC_HYDCU       YVRNITDIDDKIIQRAL----ENKES------------IQSLTSRFIDAMHEDEKALNVL
SYC_LEGPL       YVRNITDIDDKIIARAS----ERDVS------------IDELTAQYIDAMNNDTHALNIL
SYC_LEGPA       YVRNITDIDDKIIARAS----ERGVS------------IDELTAQYIDAMNNDTHALNIL
SYC_LEGPH       YVRNITDIDDKIIARAS----ERGVS------------IDELTAQYIDAMNNDTHALNIL
SYC_BLOFL       YVRNITDIDDKIIQRAI----KNNET------------TDHLASRMIQEMYLDLDILNIL
SYC_BLOPB       YVRNITDIDDKIIKRAY----ENNET------------TQQLTNRMIQEMHLDLDALNIL
SYC_BUCAI       YVRNITDIDDKIISKST----KEKKK------------INTFTASMIKEMHKDFDLLGIS
SYC_BUCAP       YIRNITDIDDKIILKSL----KEKID------------ISAFTNIMIKEMNKDFSLLGIS
SYC_BUCBP       YVRNITDIDDKIIAASL----KNNES------------YISLSNRMISNMKDDFSALNIL
SYC_WIGBR       YIRNITDIDDKIINKAF----HKKEK------------YNLLSDFMIKEMKYDLNSLNIM
SYC_COLP3       YVRNITDVEDKIINRAN----ENNET------------TEALTERTIAAMHQDFDSLNMA
SYC_PSET1       YVRNITDVDDKIIKRAN----ENGES------------INDLTVRMTKAMHEDFDSLNML
SYC_IDILO       YVRNITDLDDKIIKRAA----ENGED------------FHQVTERFIREMHKDFDALNLV
SYC_ECOL6       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHKDFDALNIL
SYC_SHIFL       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHKDFDALNIL
SYC_ECOLI       YVRNITDIDDKIIKRAN----ENGES------------FVAMVDRMIAEMHKDFDALNIL
SYC_ECO57       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHKDFDALNIL
SYC_SHISS       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHKDFDALNIL
SYC_SHIBS       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHKDFDALNIL
SYC_SHIDS       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHKDFNALNIL
SYC_SALCH       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHQDFDALNIL
SYC_SALTY       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHQDFDALNIL
SYC_SALPA       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHQDFDALNIL
SYC_SALTI       YVRNITDIDDKIIKRAN----ENGES------------FVALVDRMIAEMHQDFDALNIL
SYC_PECAS       YVRNITDIDDKIIKRAI----ENGET------------SDQLTTRMIAEMHADFDALNIL
SYC_YERPE       YVRNVTDVDDKIIKRAI----ENNET------------CEQLTTRMLAEMHKDFDALNLE
SYC_YERPS       YVRNVTDVDDKIIKRAI----ENNET------------CEQLTTRMLAEMHKDFDALNLE
SYC_PHOLL       YVRNVTDVDDKIIKRAA----ENSES------------CDDLTGRMLAEMYKDFDALNIL
SYC_SODGM       YVRNITDIEDKIIRRAA----ENGET------------FHQLTERMISEMHSDFDQLNIL
SYC_VIBVU       FVRNITDIDDKIIKRAA----ENGET------------CDSLTERLIGEMHADFDALNMK
SYC_VIBVY       FVRNITDIDDKIIKRAA----ENGET------------CDSLTERLIGEMHADFDALNMK
SYC_VIBPA       FVRNITDIDDKIIKRAA----ENGES------------CESLTERLIGDMHADFDALNMK
SYC_VIBCH       FVRNITDIDDKIIKRAA----ENAET------------CESLTERLIQEMYADFDALNIK
SYC_ALIF1       FVRNITDIDDKIIKRAA----ENGET------------CDALTERLIADMHADFDALNMK
SYC1_PHOPR      FVRNITDIDDKIIKRAA----ENGES------------CESLTERLIGEMHKDFDALGMK
SYC_SHEON       FQRNITDIDDKIIKRAN----ENQED------------CNTLTDRLIGEMHKDFDALNMK
SYC_HAEDU       YVRNITDVDDKIIKRAL----ENNES------------CEALVERMIAEMHNDFDALNIM
SYC_MANSM       YVRNITDVDDKIIKRAL----ENNET------------CDQLVERMIAEMHKDFDALNIL
SYC_HAEIN       YVRNITDVDDKIIKRAL----ENKET------------CDQLVDRMVQEMYKDFDALNVL
SYC_HAEI8       YVRNITDVDDKIIKRAL----ENKET------------CDQLVDRMVQEMYKDFDALNVL
SYC_PASMU       YVRNITDVDDKIIKRAL----ENNET------------CNQLVEKMIAEMHKDFDALNVL
SYC_FRATH       LVRNITDIDDKIIKRAN----ENGES------------TTELVERNIKAMHDVFARLNIL
SYC_FRATT       LVRNITDIDDKIIKRAN----ENGES------------TTELVERNIKAMHDVFARLNIL
SYC_COXBU       FVRNITDIDDKIIKRAG----ENKES------------PAALAERFIQILHEDEKALRVL
SYC_DESAG       FVRNFTDVDDKIIKRAG----ETGLT------------STEVAEKYMAAFHEDMDRLGCL
SYC_DESVH       FARNFTDVDDKIIKRAN----EEGLT------------SQQVAEKYIDTFYEDMDRLNVL
SYC_ANADE       FVRNFTDVDDKIIQRAN----ERGED------------PIALASRFADAFHEDMDALGNL
SYC_GEOMG       YVRNYTDVDDKIINRAN----QEGVP------------YNAISERFIAEFDRDMAALGLD
SYC_GEOSL       YVRNYTDVDDKIINRAN----KEGVP------------FNVISERFIAEFDRDMAALGLD
SYC_PELCD       YVRNYTDVDDKIIKRAN----ERGIS------------SDTLAGEFIQAFDEDMNRLGLA
SYC_DESPS       FVRNFTDIDDKIIARAN----ETGVT------------AQALAERFIDEFHTDMDNLGTL
SYC_NOSS1       YIQNFTDIDDKILNRAK----EQGLT------------MAEVSNRFIDAYFADIRRLNVL
SYC_TRIV2       YIQNFTDIDDKILNRAK----EQGST------------MAEVSNRFIDAYFADIRRLNVL
SYC_SYNY3       YVQNFTDIDDKILKRAV----DESST------------MEAVSEKFIAAYFEDMEALGVQ
SYC_SYNP6       YVQNFTDIDDKILRRSR----QEGTT------------MQAIADRYTQAYFEDMARLNIL
SYC_SYNE7       YVQNFTDIDDKILRRSR----QEGTT------------MQAIADRYTQAYFEDMARLNIL
SYC_THEEB       YVQNFTDIDDKILRRAY----ENGET------------MATVSDRYIAAYHQDMAALNIL
SYC_GLOVI       YVQNFTDVDDKILRRAQ----QEGTT------------MEAVAEKYIAAYFEDMDRLNVL
SYC_SYNJB       YVQNFTDVDDKILKRAL----ERGES------------MQAVAERFIAEYFRDMDCLNIK
SYC_SYNJA       YVQNFTDVDDKILKRAL----ERGES------------MQAVAERFIAEYFQDMDRLNIK
SYC_SYNS9       FVQNFTDIDDKILKRAS----DENSS------------MTAVSERNIDAFHADMDSLGIL
SYC_SYNPX       FVQNFTDIDDKILKRAA----EQNSS------------MTEVSERNIDAFHQDMDALGIL
SYC_PROMM       FVQNFTDIDDKILKRAA----EKECS------------MQEISEQNIEAFHQDMDSLGIL
SYC_SYNSC       YIQNYTDIDDKILNRAN----EEGIT------------MQAVSERNIEAFEVDMGRLNIL
SYC_PROMA       FVQNFTDIDDKILARAS----KENCT------------MNEVSERNIEEFHRDMDALGIL
SYC_PROMT       FVQNFTDIDDKIINRAN----KEGCS------------TDELSERNIDEFHKDMDTLSIL
SYC_PROM9       YVQNFTDIDDKILKRAK----EESSS------------MKEVSEKNIIEFHKDMDSLGIM
SYC_PROMP       YVQNFTDIDDKILKRAK----EENSS------------MNEVSEKNITEFHKDMDALGIM
SYC_AQUAE       FVRNFTDVDDKIINRAK----QECTD------------FMTIADRYIARYYVDMENIRVR
SYC_THEMA       MVQNFTDIDDKIINKAN----QLGVD------------YKTVADTFIAEYWRDAHALGIR
SYC_BACAN       YVSNFTDVDDKLIKAAN----ELGED------------VPTIADRFVEAYFEDVTALGCK
SYC_BACHK       YVSNFTDVDDKLIKAAN----ELGED------------VPTIADRFVEAYFEDVTALGCK
SYC_BACCZ       YVSNFTDVDDKLIKAAN----ELGED------------VPTIADRFVEAYFEDVTALGCK
SYC_BACC1       YVSNFTDVDDKLIKAAN----ELGED------------VPTIADRFVEAYFEDVTALGCK
SYC_BACCR       YVSNFTDVDDKLIKAAN----ELGED------------VPTIADRFVEAYFEDVTALGCK
SYC_BACLD       YVSNFTDVDDKLIKAAN----ELGEE------------VPVIAERFIKAYFEDVGSLGCT
SYC_BACSU       YVSNFTDVDDKLIKAAN----ELGED------------VPTISERFIKAYFEDVGALGCR
SYC_GEOKA       YVSNFTDVDDKLIKAAR----ELGES------------VPAIAERFIEAYFEDIQALGCK
SYC_OCEIH       YVLNFTDVDDKIIKTAK----DVGEE------------VPVLADRFVNAYLEDVGALGVK
SYC_BACSK       FVSNFTDVDDKIIRAAN----ELGEE------------VAAVAERFIKAYYADTCALNVK
SYC_BACHD       FVSNFTDVDDKIIRVAN----ELGED------------VFAVANRFIEAYKQDTSALGVL
SYC_LISMO       FVSNFTDVDDKLIRAAN----ELKLT------------VPEVADRFIGAYFDDVDQLNVA
SYC_LISMF       FVSNFTDVDDKLIRAAN----ELKLT------------VPEVADRFIGAYFDDVDQLNVA
SYC_LISIN       FVSNFTDVDDKLIRAAN----ELKLT------------VPEVADRFIGAYFDDVDQLNVA
SYC_STAAC       YVSNFTDVDDKLIKRSQ----ELNQS------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAA3       YVSNFTDVDDKLIKRSQ----ELNQS------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAAM       YVSNFTDVDDKLIKRSQ----ELNQS------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAAN       YVSNFTDVDDKLIKRSQ----ELNQS------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAAS       YVSNFTDVDDKLIKRSQ----ELNQS------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAAW       YVSNFTDVDDKLIKRSQ----ELNQS------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAAB       YVSNFTDVDDKLIKRSQ----ELNQT------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAAR       YVSNFTDVDDKLIKRSQ----ELNQT------------VPEIAEKYIAAFHEDVGALNVR
SYC_STAES       YVSNFTDVDDKLINRSK----ELNES------------VPEIAEKYIKAFYEDVGALNVK
SYC_STAEQ       YVSNFTDVDDKLINRSK----ELNES------------VPEIAEKYIKAFYEDVGALNVK
SYC_STAHJ       YVSNFTDVDDKLINRSK----ELNES------------VPDIADRYIKAFYEDVGALNVK
SYC_STAS1       FVSNFTDVDDKLIKRSK----ELDES------------VETIADRYIDAFYEDVGALNVK
SYC_LACPL       YVSNFTDVDDKLIKRAA----EDHTT------------VPAVADRFIKAFMEDTTAVNIE
SYC_LACSS       YVSNFTDVDDKMIKAAN----AENIT------------VPELADRYITAFKEDTKALNIE
SYC_ENTFA       YVSNFTDVDDKIIKAAK----ELKIT------------APEVAERFIKAFEEDTQALNVQ
SYC_LACAC       YVSNFTDVDDKMINEAR----AEKIT------------VPELAEKFINAFLEDTTALNIE
SYC_LACJO       YVSNFTDVDDKMINEAR----KEHTT------------VEKLAERYIKAFMEDTEALNIE
SYC_STRA1       YISNFTDVDDKIIKGAA----EAGMD------------TKSFSDKFISAFMEDVAALGVK
SYC_STRA5       YISNFTDVDDKIIKGAA----EAGMD------------TKSFSDKFISAFMEDVAALGVK
SYC_STRA3       YISNFTDVDDKIIKGAA----EAGMD------------TKSFSDKFISAFMEDVAALGVK
SYC_STRPM       YISNFTDVDDKIIKAAT----QAGVS------------PKELSDRFIAAFIEDTKALGVK
SYC_STRP3       YISNFTDIDDKIIKAAT----QAGVS------------PKELSDRFIAAFIEDTKALGVK
SYC_STRP8       YISNFTDVDDKIIKAAT----QAGVS------------PKELSDRFIAAFIEDTKALGVK
SYC_STRP6       YISNFTDVDDKIIKAAT----QAGVS------------PKELSDRFIAAFIEDTKALGVK
SYC_STRP1       YISNFTDVDDKIIKAAT----QAGVS------------PKELSDRFIAAFIEDTKALGVK
SYC_STRT2       YISNFTDVDDKIIKAAN----EVGIS------------TKELSDKFITAFMEDTAQLGIK
SYC_STRT1       YISNFTDVDDKIIKAAN----EVGIS------------TKELSDKFITAFMEDTAQLGIK
SYC_STRMU       YISNFTDVDDKIIKAAA----KAGMT------------TKALSDKFIAAFKEDVAALGVK
SYC_STRPN       YISNFTDVDDKIINRAR----EEGIT------------PQEVADKYIAAFREDVTALGVK
SYC_STRR6       YISNFTDVDDKIINRAR----EEGIT------------PQEVADKYIAAFREDVTALGVK
SYC_LACLA       YISNFTDVDDKIINGAK----AANMT------------TTDFSERYIAAFYEDTDALNVK
SYC_CLOPE       FVQNFTDIDDKMIKKAN----EEGTT------------VKKIGDTYIKEYYQDADALNIE
SYC_CLOTE       FVQNFTDIDDKMIKRAN----DEGIT------------VKELGERFIGEYYKDADSLNIE
SYC_CLOAB       FIQNFTDIDDKMIAKAN----NEGVS------------VKELGDRYIKEYYEDADGLNLE
SYC_CALS4       YVQNFTDIDDKIINRAK----EENTT------------EKEIAERFIEEYFKDADALGIK
SYC_SYMTH       FVQNFTDIDDRMIKRAR----ERGIT------------VSELAEEMIQAYFADAGALGVR
SYC_CARHZ       YVQNFTDIDDKIINRAL----EEGIS------------PIELGQKYIIEYFKDADRLGVK
SYC_MOOTA       YVQNFTDIDDKVINRAR----EEHQA------------PLVIAERYIEEFFKDADALNVK
SYC_FUSNN       YVQNFTDVDDKMINKAN----IENVS------------IKEIAERYIKAYFEDTSKINLK
SYC_DEHM1       YIQNFTDIDDKIIAKAN----AQGIE------------PSTLAERNIGVFLDAMAALNIT
SYC_DEHMC       YIQNFTDIDDKIIAKAN----AQGIE------------PSTLAERNIGVFLDAMAALNIT
SYC_BDEBA       YALNFTDVDDKIINRAN----ELGMS------------PTELSEKYIAEYKKDFASLGLR
SYC_COREF       FVRNVTDIDDKILTKAA----EHGR------------PWWEWVSTYEREFTWAYNTLGVL
SYC_CORGL       FVRNVTDIDDKILTKAS----ENGR------------PWWEWVSTYEREFTWTYNTLGVL
SYC_CORDI       FVRNVTDIDDKILTKAA----ENGR------------PWWEWVSTYEREFTWAYNQLGVL
SYC_CORJK       FVRNVTDIDDKILTKAA----ENDR------------PWWEWAATHERAFNWAYDQLGVT
SYC_MYCBO       FIRNVTDIEDKILAKAA----AAGR------------PWWEWAATHERAFTAAYDALDVL
SYC_MYCTU       FIRNVTDIEDKILAKAA----AAGR------------PWWEWAATHERAFTAAYDALDVL
SYC_MYCPA       FIRNVTDIDDKILNKAA----AAGR------------PWWEWAATYERAFSAAYDALDVL
SYC_MYCLE       FIRNVTDIDDKILNKAA----AAGR------------PWWEWAATHERAFTAAYDALDVL
SYC_NOCFA       FIRNVTDIDDKILNKAA----EAGR------------PWWEWAATYERAFDRAYRLLGVQ
SYC_STRAW       FIRNVTDIDDKIIAKSA----DHGR------------PWWAIGYENERAFNDGYDVLGCL
SYC_THEFY       FCRNVTDIDDKILNVAA----SEGV------------QWWEVSERNYRAFAEAYDTLGCL
SYC_LEIXX       LVRNVTDIDDKVLANAA----AAQAEGG-------SEQWWALAYRFEREFTAASVALGVQ
SYC_CUTAK       VVANVTDIDDKILAKSA----AAGT------------PWWAHAYHYENELHAAYKALGCR
SYC_BIFLO       FVRNVTDIDDKILVKAA----AAGQ------------RWWARAYYYEREFTEAYNTLGVL
SYC1_TROW8      YVRNITDIDDKILASAR----STET----------GETWWQIAYRVSGLFNEAYKALFVK
SYC1_TROWT      YVRNITDIDDKILASAR----STET----------GETWWQIAYRVSGLFNEAYKALFVK
SYC_FRACC       FVQNVTDIDDKIIINAD----RDGT------------SVWELATRQTRAFDDAYRTLGIL
SYC_RHOBA       WVVNITDVDDKLIGKSK----ERGI------------PMSQIAVEMTADYLANLRELGVN
SYC_BACFR       YVRNITDVGHLEHDADE------GEDKIAKKARLEQLEPMEVVQYYLNRYHKAMEALNVL
SYC_BACFN       YVRNITDVGHLEHDADE------GEDKIAKKARLEQLEPMEVVQYYLNRYHKAMEALNVL
SYC_BACTN       YVRNITDVGHLEHDADE------GEDKIAKKARLEELEPMEVVQYYLNRYHKAMEALNVL
SYC_PORGI       YVRNITDVGHLEHDADE------GEDKIAKKARLEQLEPMEVVQYYLTRYRHAMEALNVL
SYC_CHLCH       YIQNITDVGHLTDDADE------GEDKIMKQARLEKTDPMEIAQFYTRSFYEDMDRLGVE
SYC_PELLD       YVQNITDVGHLSDDADE------GEDKIARQARLEKTDPMEIAQFYTRSFLDDMDRLGVL
SYC_CHLTE       YVQNITDVGHLTDDADE------GEDKIQKQARQERIEPMEVAQYYTRSFYEDMDRLGVE
SYC_THET2       FVSNITDVGHLTDDADE------GEDKIVRRAKLERLEPMEVADKYMWSYFDAMQALNVL
SYC_THET8       FVSNITDVGHLTDDADE------GEDKIVRRAKLERLEPMEVAEKYTWSYFDAMQALNVL
SYC_DEIRA       YVSNITDVGHLLNDADE------GEDKLQARARLEQLEPMEVADKYFWSFFRDMDALNVL
SYC_BORBU       YAMNITDIGHLTGDLDD---GEDKVAKTAREKGL---TVYEISEFFTEAFFNDCRKLNIV
SYC_BORBP       YAMNITDIGHLTGDLDD---GEDKVAKTAREKGL---TVYEISKFFTEAFFKDCKKLNVV
SYC_TREDE       HVMNITDVGHLTDDEDS---GEDKMVKSAEERGK---SVLEIAEFYTKAFFNDTERLNIE
SYC_TREPA       YVMNITDVGHLESDADS---GEDKLVRSAQAHGH---SVLQVAAHYRAAFFRDTALLGIE
SYC_NOVAD       HVINITDVGHLTDDADE---GEDKMEKMARAEAR---SIWDIAKHYTQAYWEDVKALNIR
SYC_ZYMMO       HVINITDVGHLTSDSDT---GDDKMEAAAHKAQK---TIWDVARFYTEAFWSDLKNLNIF
SYC1_BURL3      HVVNITDVGHLTSDADE---GEDKMEKGSRRTGE---SAWAIARRYTEAFVRDWHALNLL
SYC_SALRD       NVSNITDVGHLTQDDLVDPGGEDKMQRALEREGERFANIYDLARHYTEAFLEDWGALNLR
SYC_CHLTR       HVMNITDVDDKTLAGAR-------------KKGC---SLEKYCQPYIHAFFADLETLHIL
SYC_CHLTA       HVMNITDVDDKTLAGAR-------------KKGC---SLEKYCQPYIHAFFADLETLHIL
SYC_CHLMU       HVMNITDVDDKTLAGAR-------------KKGC---SLEKYCQPYINAFFADLETLHIL
SYC_CHLCV       HIMNITDVDDKTLAGAC-------------KKNI---SLDAYTAPYIQAFFEDVASLNIL
SYC_CHLFF       HIMNITDVDDKTLAGAC-------------RKNI---SLEEYTAPFIQAFFEDIAELNIL
SYC_CHLAB       HVMNITDVDDKTLAGAC-------------KNNI---SLDTYTAPFIQAFFKDVATLHIL
SYC_CHLPN       HVMNITDVEDKTIAGAS-------------KKNI---PLQEYTQPYTEAFFEDLDTLNIA
SYC_PARUW       QVMNLTDVDDKTIRGAI-------------AKGI---TLDEYTKPYKDAFFEDLKTLNIQ
SYC_LEPIN       MTMNITDIDDKIIRDSI-------------ASKK---SIIEFTAPWTKAFFEDLKTVSAE
SYC_LEPIC       MTMNITDIDDKIIRDSI-------------ASKK---SIIEFTAPWTKAFFEDLKTVSAE
SYC_CAMJE       FARNYTDIDDKILKKMA----QSGQT------------LEEITEFYIKSYEEDMRVLNVL
SYC_CAMJR       FARNYTDIDDKILKKMT----QSGQT------------LEEITEFYIKSYEEDMRALNVL
SYC_HELPY       LVRNFTDIDDKIINKAL----KENKS------------IQELSSIYIESYTRDLNALNVK
SYC_HELPJ       LVRNFTDIDDKIINKAF----KENKS------------IQELSSIYIESYTRDLNALNVK
SYC_HELHP       FVKNFTDIDDKIIKKSL----QNNAS------------VQEIGSHYIHSYLKDMASLGVL
SYC_WOLSU       FVKNFTDIDDKIIKKSL----ESGEE------------IGAITERYITSYLEDMQKLGIK
SYC_SULDN       YARNITDIDDKIINRAQ----EQNKT------------IKEVTDFYTDAYHKEMALLGIS
SYC_AYWBP       YVVNITDIDDKIIETSL----KNQVL------------EKDLANKYIKSFNNLLETLNIQ
SYC_ONYPE       YVVNITDIDDKIIENAL----KNQVL------------EQDLANKYIKSFNNLLKTLNIQ
SYC_MYCCT       YLQNITDIDDKIILKAL----DNNLT------------ELEISQKYTKAYLEDLESLNIN
SYC_MYCMS       YLQNITDIDDKIILKAL----ENNLN------------ELEVSQKYTSAYLEDLKSLNIN
SYC_MESFL       FLQNITDIDDKIIEKAI----QENKT------------EKEITDKYLSAFLQNLKDLKIR
SYC_MYCGA       FVHNLTDIDDKIINQAQ----RLNLS------------EEEVTKRYTSAYFEILDELNIK
SYC_UREPA       YVLNITDIDDKIINYAL----ANNLK------------ELEVSEYYFNEYLKIKKALNTL
SYC_MYCPE       FIHNITDIDDKIVNKAK----EENIG------------ELELSSYYETQYFDILKTINIH
SYC_MYCH2       FLHNITDIDDKIIEKAQ----ELGIS------------EAELTEKYTNEYFKILEIFNIK
SYC_MYCMO       FLHNLTDIDDKIIEKAS----KENKT------------ELEISELYSDFYLKMLDEYNIN
SYC_MYCGE       FVQNITDIDDKIIKIAQ----QQEVS------------ESVVTKQQITAYKSLLKKLNIL
SYC_MYCPN       FVQNITDIDDKIIKIAQ----QQEIS------------EAQLCKQQITAYKSLLKKLNIL
                   * **: .                                                  

SYC_AGRFC       Q-PTVEPRATDYI-------AEMIYLIERLIERGHAYKAGG-------------------
SYC_RHIEC       E-PSVEPRATDNI-------AEMIQIIEKLIGNGHAYVAAG-------------------
SYC_RHIME       D-PTVQPRATENI-------AGMIEIIEKLIAKGHAYEAEG-------------------
SYC_RHILO       E-PTVEPRATEFVEPRADGKADMITLIQSLIKRGHAYAAAG-------------------
SYC_NITWN       P-PTHQPRATEFVLPRTDGKTDMVTFIKQLIARGHAYEAGG-------------------
SYC_BARHE       P-PTIEPRATDHL-------EEMRSLIERLLEKGHAYKAEN-------------------
SYC_BARQU       L-PTSQPRATDHL-------EDMRSLIERLLEKGHAYKVQN-------------------
SYC_BRUAB       Q-PTVQPRATEHM-------DEMRAMIDRLVQRGVAYVAQD-------------------
SYC_BRUA2       Q-PTVQPRATEHM-------DEMRAMIDRLVQRGVAYVAQD-------------------
SYC_BRUME       Q-PTVQPRATEHM-------DEMRAMIDRLVQRGVAYVAQD-------------------
SYC_BRUSU       Q-PTVQPRATEHM-------DEMRAMIDRLVQRGVAYVAQD-------------------
SYC_RHOPA       R-PTVEPRATEHI-------GEMRSIIEKLVAGGFAYVEQD-------------------
SYC_RHOP2       R-PTVEPRATEHI-------GEMRTIIDRLVAGGFAYVAAD-------------------
SYC_RHOPB       R-PTIEPRATEHI-------GEMRSIIDRLVEGGFAYVAED-------------------
SYC_BRADU       R-PSVEPRATEHI-------GEMREIIERLVAGGFAYVAED-------------------
SYC_JANSC       D-PNHMPRATEYI-------AEMVAFIEDLIAKGFAYARDG-------------------
SYC_RUEPO       E-PDHMPRATQYI-------PQMVAMIEELVAKGHAYEAEG-------------------
SYC_RHOS4       R-PTHEPRATEWI-------GAMIAMIEDLIAKGHAYEREG-------------------
SYC_ANAMM       S-PTFEPRATEEI-------ETMLHIIGRLIQAGHAYVRGG-------------------
SYC_ANAPZ       S-PTVEPRATAEI-------DTMLQLISRLVESGHAYVKGG-------------------
SYC_EHRCJ       E-PTYEPKATDNI-------NVMINLIQKLIDHGHAYVDNA-------------------
SYC_EHRCR       E-PTYEPRATDNI-------DVIISLIQKLVDSGHAYVYNG-------------------
SYC_EHRRG       K-PTYEPRATENI-------DVMLALIEKLINYGHAYIRDN-------------------
SYC_EHRRW       K-PTYEPRATENI-------DVMLALIEKLINYGHAYICDN-------------------
SYC_WOLPM       E-PTHEPKATKNV-------DYIIKLIEHLLQSGHAYESDK-------------------
SYC_WOLTR       E-PTHEPKAAENI-------KYIIELIEYLLQSGHAYESNK-------------------
SYC_NEOSM       S-PTVEPKATQNI-------GKMISMIQALIDNGNAYSVGG-------------------
SYC_RICCN       L-PSIEPKATKHI-------DVMIAIIERLIAKDHAYIADN-------------------
SYC_RICFE       L-PSIEPKATEHI-------DVMIEIIERLIAKDHAYIADN-------------------
SYC_RICPR       L-PTIEPKATEHI-------DVMIEIIERLIAKDHAYIADN-------------------
SYC_RICTY       L-PSIEPKATEHI-------DVMIEIIERLIAQDHAYITDN-------------------
SYC_RICBR       P-PTIEPKATQHI-------DVMIEIIEKLIKSGHAYIADD-------------------
SYC_PELUB       N-PSQQPKATDHI-------DLMIKMISTLIEKDFAYVVND-------------------
SYC_XANOR       P-PDIEPEATAHI-------PQIVAMIEQLIANGHAYAAEG-------------------
SYC_XANOM       P-PDIEPEATAHI-------PQIVAMIEQLIANGHAYAAEG-------------------
SYC_XANAC       P-PDIEPEATAHI-------PQIVAMIEQLIANGHAYAAEG-------------------
SYC_XANC5       P-PDIEPEATAHI-------PQIVAMIEQLIATGHAYAAEG-------------------
SYC_XANCP       P-PDIEPEATAHI-------PQIVAMIEQLIASAHAYAAEG-------------------
SYC_XANC8       P-PDIEPEATAHI-------PQIVAMIEQLIASAHAYAAEG-------------------
SYC_XYLFA       P-PDIEPEATAHM-------PQIIAMIEQLIERQHAYVAME-------------------
SYC_XYLFT       P-PDIEPEATAHM-------PQIIAMIEQLIERQHAYVAME-------------------
SYC_CAUVC       R-PTLEPKATEHI-------GAILEMIGQLVENGSAYAAEG-------------------
SYC_MAGSA       L-PDVEPRATAHI-------TQMIAMIERLIAKGFAYAAEG-------------------
SYC_RHORT       P-PDVEPRATAHI-------ADMVAMIERLIAKGHAYEAEG-------------------
SYC_GLUOX       P-PDIEPRATHHI-------DDMLEMIGRLVENGHAYVAEG-------------------
SYC_SACD2       P-PSIAPKATAHI-------EPMIAMVAALVEKGHAYEADG-------------------
SYC_PSYA2       S-PNAEPRATDYI-------DEMQQMIETLVSNDYAYAGD--------------------
SYC_PSYCK       S-PDAEPRATDHI-------DEMQQMIETLVSNDYAYAGD--------------------
SYC_ACIAD       E-PDEAPKATEYI-------GEMQNMISTLVDKGSAYPAS--------------------
SYC_PSEF5       K-PDMEPRATDHI-------PGMHTMIQTLIDKGYAYAPG--------------------
SYC_PSEPF       K-PDMEPRATDHI-------PGMHAMIQTLIDKGYAYAPG--------------------
SYC_PSE14       K-PDMEPRATDHI-------AGMHAMIQTLIDKGYAYAPG--------------------
SYC_PSEU2       K-PDMEPRATDHI-------PGMHAMIQTLIDKGYAYAPG--------------------
SYC_PSESM       K-PDMEPRATDHI-------PGMHAMIQTLIDKGYAYAPG--------------------
SYC_PSEPK       P-PDQEPRATDHI-------AGMHAMIQTLIDKGYAYAPG--------------------
SYC_PSEAE       K-PDQEPRATDHI-------AGMHAMIQTLIDKGYAYAPG--------------------
SYC_HAHCH       S-PTSEPRATGHI-------DEIIAMIQRLMDKGYAYHAS--------------------
SYC_BURMA       R-PDLEPRATEFI-------PQMLGMIEKLEANGYAYQAK--------------------
SYC_BURPS       R-PDLEPRATEFI-------PQMLGMIEKLEANGYAYQAK--------------------
SYC_BURP1       R-PDLEPRATEFI-------PQMLGMIEKLEANGYAYQAK--------------------
SYC_BURTA       R-PDIEPRATDFI-------PQMLGMIEKLEANGYAYQAK--------------------
SYC2_BURL3      R-PDIEPRATEFI-------PQMLGMIETLETNGYAYQAT--------------------
SYC_CUPPJ       R-PDHEPRATDYV-------PQMLDLIGKLEANGLAYQAT--------------------
SYC_RALSO       R-PDREPRATEYV-------PQMLSMIGRLQDNGLAYQAA--------------------
SYC_DECAR       R-PDYEPRATEYV-------PEMLDLIGKLEANGLAYQAS--------------------
SYC_AROAE       R-PDHEPRATEYV-------MQMQSLIGRLRDKGLAYVAG--------------------
SYC_THIDA       P-PDHEPRATAYV-------AQMLALIAQLVDRGLAYAAP--------------------
SYC_NEIG1       R-PDIEPKATENI-------PQMIAMIETLIQNGKAYPAA--------------------
SYC_NEIMB       R-PDIEPKATENI-------PQMIAMIETLIQNGKAYPAA--------------------
SYC_CHRVO       P-PTHEPRATHHV-------GGMVAMIEQLIANGKAYPAA--------------------
SYC_NITEU       S-PSFEPRATEYV-------DSMIAMIESLLNRELAYVAS--------------------
SYC_NITMU       P-PSWEPRATRHV-------EDMIAMIQVLVDKKLAYPAS--------------------
SYC_BORBR       P-PDREPRATQYV-------GEMLDIIGRLESKGLAYRAE--------------------
SYC_BORPA       P-PDREPRATQYV-------GEMLDIIGRLESKGLAYRAE--------------------
SYC_BORPE       P-PDREPRATQYV-------GEMLDIIGRLESKGLAYRAE--------------------
SYC_BORA1       R-PDHEPRATAYV-------GEMIDIIGRLEKNGLAYQAD--------------------
SYC_RHOFT       R-PTHEPRATEFV-------PQMLSLIGRLEQKGLAYQAV--------------------
SYC_METCA       P-PDHEPRATESI-------DDILAMIGTLIERGHAYVGS--------------------
SYC_NITOC       P-PDREPRATESM-------EAILAMVRQLLDQGYAYQGE--------------------
SYC_HYDCU       R-PDMEPKATEYM-------DEIETMISTLIEKDFAYPAE--------------------
SYC_LEGPL       P-PDHEPRATGHI-------ETIIRLIQRLLEKGNAYVSE--------------------
SYC_LEGPA       P-PDHEPRATGHI-------ETIIRLIQRLLEKGNAYVSD--------------------
SYC_LEGPH       P-PDHEPRATGHI-------ETIIRLIQRLLEKGNAYVSE--------------------
SYC_BLOFL       R-PNYEPKVTDHI-------ELIINFIRLLIERNHAYVTS--------------------
SYC_BLOPB       R-PNYEPKVTEHI-------DIIIKFICLLISKKHAYTAP--------------------
SYC_BUCAI       V-PDEEPRVTDYI-------DNIIRIITTLIKKKHAYIHK--------------------
SYC_BUCAP       P-PDEEPRVTNYI-------IDIIKVIEKLIKNKNAYVND--------------------
SYC_BUCBP       P-PDSEPRVTENI-------SDIIKFISILLNKKHAYVAC--------------------
SYC_WIGBR       P-PNNEPRVTNHI-------SDILEMIKILLEKKHAYISK--------------------
SYC_COLP3       R-PDLEPRVTTHM-------NEIIAMIETLVTKEHAYVAGANAASTG-------------
SYC_PSET1       R-PDVEPTVTAHM-------DEIIEMVERLITKGHAYVAA--------------------
SYC_IDILO       R-PDIEPRVTSHM-------DEIILMIERLIENGNAYEAG--------------------
SYC_ECOL6       R-PDMEPRATHHI-------AEIIELTEQLIAKGHAYVAD--------------------
SYC_SHIFL       R-PDMEPRATHHI-------AEIIELTEQLIAKGHAYVAD--------------------
SYC_ECOLI       R-PDMEPRATHHI-------AEIIELTEQLIAKGHAYVAD--------------------
SYC_ECO57       R-PDMEPRATHHI-------AEIIELTEQLIAKGHAYVAD--------------------
SYC_SHISS       R-PDMEPRATHHI-------AEIIELTEQLIAKGHAYAAD--------------------
SYC_SHIBS       R-PDMEPRATHHI-------AEIIELTEQLIAKGHAYVAD--------------------
SYC_SHIDS       R-PDMEPRATHHI-------AEIIELTEQLIAKGHAYVVD--------------------
SYC_SALCH       R-PDSEPRATHHI-------QEIIELTRTLIEKGHAYVAD--------------------
SYC_SALTY       R-PDSEPRATHHI-------QEIIELTRTLIEKGHAYVAD--------------------
SYC_SALPA       R-PDSEPRATHHI-------QEIIELTRTLIEKGHAYVAD--------------------
SYC_SALTI       R-PDSEPRATHHI-------QEIIELTRTLIEKGHAYVAD--------------------
SYC_PECAS       R-PDAEPRATHHI-------ADIIEMVETLITRRHAYVAS--------------------
SYC_YERPE       R-PDLEPRATHHI-------AEIIEMTERLIARGHAYVAS--------------------
SYC_YERPS       R-PDLEPRATHHI-------AEIIEMTERLIARGHAYVAS--------------------
SYC_PHOLL       R-PDLEPRATRHI-------QEIIALTESLIKRGHAYVAD--------------------
SYC_SODGM       R-PDQEPRATHYI-------DAIIELVGQLIDRDHAYVAA--------------------
SYC_VIBVU       R-PDVEPRATQYI-------QEIIELVERLIERGFAYVAD--------------------
SYC_VIBVY       R-PDVEPRATQYI-------QEIIELVERLIERGFAYVAD--------------------
SYC_VIBPA       R-PDVEPRATQFI-------AEIIELVEKLIERGFAYVAD--------------------
SYC_VIBCH       R-PDVEPRATAYI-------EEIIALVERLIERGFAYVAD--------------------
SYC_ALIF1       R-PDVEPRATEYI-------KEIIALVERLIERGFAYVAS--------------------
SYC1_PHOPR      R-PDIEPRATEFI-------AEIIILCERLIERGFAYVAS--------------------
SYC_SHEON       R-PDFEPRATLHI-------AEIIDMVERLLARGHAYVAA--------------------
SYC_HAEDU       R-PDVEPRATEHI-------AEIIAMVEKLIMNGHAYVAA--------------------
SYC_MANSM       R-PDVEPRATKHI-------PEIIAMVETLIRRGHAYVAE--------------------
SYC_HAEIN       R-PDFEPRATHHI-------PEIIEIVEKLIKRGHAYVAD--------------------
SYC_HAEI8       R-PDFEPRATHHI-------PEIIEIVEKLIKRGHAYVAD--------------------
SYC_PASMU       R-PDVEPRATHHI-------PEIIAMIEKLIARQHAYVSA--------------------
SYC_FRATH       K-PSKEPRATETI-------PEMVAMIETLIKKGYAYQGA--------------------
SYC_FRATT       K-PSKEPRATETI-------PEMVAMIETLIKKGYAYQGA--------------------
SYC_COXBU       S-PDQEPRATQYV-------PEIIKLIQKLLDNQYAYTGQ--------------------
SYC_DESAG       R-ADIEPRCTQHI-------GEMIALCEDLISKGKAYSTA--------------------
SYC_DESVH       R-ADIEPKATGHI-------LEMIALCEKLIAKGKAYATP--------------------
SYC_ANADE       R-PDVEPRVSGHI-------PEIVALIARLVERGFAYAPG--------------------
SYC_GEOMG       L-PTHQPKATEHI-------AEMIDVISRLIEKGFAYAA---------------------
SYC_GEOSL       L-PTYQPKATEHI-------AEMIQVIERLVAKGFAYAA---------------------
SYC_PELCD       E-PTIQPKATCHI-------DHIVNLVQRLIDRGIAYES---------------------
SYC_DESPS       R-PDIEPKATEHI-------QEMIDIIQELVDKDMAYPS---------------------
SYC_NOSS1       D-ADEYPRVTEHI-------PEIHQLIQILEEKGLAYAVGG-------------------
SYC_TRIV2       D-ADEYPRVTEHI-------PEIHQLIQILEEKGLAYAVGG-------------------
SYC_SYNY3       P-ADLYPRATHTL-------DGIKRLIAELEAKGYAYPSGG-------------------
SYC_SYNP6       E-ADDYPRATHTL-------DGIQRLIAELEDKGFAYAADG-------------------
SYC_SYNE7       E-ADDYPRATHTL-------DGIQRLIAELEDKGFAYAADG-------------------
SYC_THEEB       P-ASAYPRATEVI-------PEIINLIQGLLDRGYAYVAGG-------------------
SYC_GLOVI       R-ADSYPRATQTM-------PEIGALIDRLTSIGYAYPAAG-------------------
SYC_SYNJB       R-ADFYPRATQSL-------QAMFQLIQSLELKGFAYRVRDPIRHQTDQSSLLQAGHQPE
SYC_SYNJA       R-ADLYPRATRSL-------RAMFELIQSLELKGFAYRVRDPLAPQG------------E
SYC_SYNS9       R-PDSMPRATQCL-------DGIRALIGELEAKGAAYSAEG-------------------
SYC_SYNPX       R-PDRMPRATQCL-------DGIRSLIGELEAKGAAYSADG-------------------
SYC_PROMM       R-PDRMPRATQCL-------DGIRSLIGELEASGAAYSVDG-------------------
SYC_SYNSC       P-ADRMPRATGCI-------EGIQTLISELESKGAAYSSDG-------------------
SYC_PROMA       R-PDRMPRATRCL-------EEIKSMIEELEKKGAAYSAEG-------------------
SYC_PROMT       R-PTSMPRATKCL-------HQIINFIEELEQKKVAYSSNG-------------------
SYC_PROM9       R-PDSMPRATNHI-------CNICSFITILEDKGYAYSRDG-------------------
SYC_PROMP       R-PDSMPKATNHI-------CNICSFIKVLEDKGFAYIRGG-------------------
SYC_AQUAE       P-ADVEPRVTEHI-------PEIIEVIQKLVEKGYAYVVEG-------------------
SYC_THEMA       P-ANFHPRTTDFV-------EDIVEIIEKLVEKGFAYQTET-------------------
SYC_BACAN       H-ATVHPRVTENM-------DIIIEFIQELVNKGYAYESEG-------------------
SYC_BACHK       H-ATVHPRVTENM-------DIIIEFIQELVNKGYAYESEG-------------------
SYC_BACCZ       H-ATVHPRVTENM-------DIIIEFIQELVNKGYAYESEG-------------------
SYC_BACC1       H-ATVHPRVTENM-------DIIIEFIQELVNKGYAYESEG-------------------
SYC_BACCR       H-ATVHPRVTENM-------DIIIEFIQELVNKGYAYESEG-------------------
SYC_BACLD       K-ADCHPRVTENM-------DEIIDFIQTLIDKGYAYEADG-------------------
SYC_BACSU       K-ADLHPRVMENM-------DAIIEFVDQLVKKGYAYESEG-------------------
SYC_GEOKA       K-ADIHPRVTENI-------DTIIEFIQALIDKGYAYEVDG-------------------
SYC_OCEIH       K-ATKNPRVMDTM-------DDIIAFISALIEKGYAYEADG-------------------
SYC_BACSK       E-ADLHPRVTETM-------DDIIAFIADLEKKGFAYEAGG-------------------
SYC_BACHD       E-ADHHPRVTETM-------SEIISFIRVLEEKGYAYEQGG-------------------
SYC_LISMO       K-ASVNPRVTENM-------DEIIQMISTLIEKGYAYESAG-------------------
SYC_LISMF       K-ATVNPRVTENM-------DEIIQLISTLIEKGYAYESAG-------------------
SYC_LISIN       K-ATVNPRVTENM-------DEIIQLISTLIEKGYAYESAG-------------------
SYC_STAAC       K-ATSNPRVMDHM-------DDIIQFIKDLVDQGYAYESGG-------------------
SYC_STAA3       K-ATSNPRVMDHM-------DDIIQFIKDLVDQGYAYESGG-------------------
SYC_STAAM       K-ATSNPRVMDHM-------DDIIQFIKDLVDQGYAYESGG-------------------
SYC_STAAN       K-ATSNPRVMDHM-------DDIIQFIKDLVDQGYAYESGG-------------------
SYC_STAAS       K-ATSNPRVMDHM-------DDIIQFIKDLVDRGYAYESGG-------------------
SYC_STAAW       K-ATSNPRVMDHM-------DDIIQFIKDLVDRGYAYESGG-------------------
SYC_STAAB       K-ATSNPRVMDHM-------DDIIQFIKDLVDQGYAYESGG-------------------
SYC_STAAR       K-ATSNPRVMDHM-------DDIIQFIKDLVDQGYAYESGG-------------------
SYC_STAES       K-ATSNPRVMHHM-------GEIIDFIKELVDEGYAYESDG-------------------
SYC_STAEQ       K-ATSNPRVMHHM-------GEIIDFIKELVDEGYAYESDG-------------------
SYC_STAHJ       K-ATSNPRVMNHM-------DEIIDFIKELVDEGYAYESDG-------------------
SYC_STAS1       K-ATSNPRVMNHM-------DDIINFIKDLVDEGYAYESGG-------------------
SYC_LACPL       P-ATVHPRASENI-------PEIIAFVQALIEKGYAYESAG-------------------
SYC_LACSS       P-ATLNPRATDNI-------EEIVAFIQDLIAKDYAYAVDG-------------------
SYC_ENTFA       P-ATLHPRVMDHM-------PDILAFIEVLIEKGFAYEVAG-------------------
SYC_LACAC       P-ATLHPRATHEI-------KDIINFVKVLIDKGYAYEVDG-------------------
SYC_LACJO       P-ATLHPRATHEI-------KEIIDFVQDLIDKGVAYEVDG-------------------
SYC_STRA1       P-ATKNPRVIDYM-------DEIIDFVKVLVDKEFAYEANG-------------------
SYC_STRA5       P-ATKNPRVIDYM-------DEIIDFVKVLVDKEFAYEANG-------------------
SYC_STRA3       P-ATKNPRVIDYM-------DEIIDFVKVLVDKEFAYEANG-------------------
SYC_STRPM       P-ATQNPRVMDYI-------AEIISFVESLIEKDFAYEADG-------------------
SYC_STRP3       P-ATQNPRVMDYI-------AEIISFVESLIEKDFAYEADG-------------------
SYC_STRP8       P-ATQNPRVMDYI-------AEIISFVESLIEKDFAYEADG-------------------
SYC_STRP6       P-ATQNPRVMDYI-------AEIISFVESLIEKDFAYEADG-------------------
SYC_STRP1       P-ATQNPRVMDYI-------AEIISFVESLIEKDFAYEADG-------------------
SYC_STRT2       P-ATQNPRVINYM-------DEIIAFVSILIDKGFAYVSEG-------------------
SYC_STRT1       P-ATQNPRVINYM-------DEIIAFVSILIDKGFAYVSEG-------------------
SYC_STRMU       P-ATENPRVIDYM-------QDIIDFVQILVDKGFAYESSG-------------------
SYC_STRPN       P-ATRHPRVVEFM-------ADIIRFVEDLIEKGFAYESQG-------------------
SYC_STRR6       P-ATRHPRVVEFM-------ADIIRFVEDLIERGFAYESQG-------------------
SYC_LACLA       R-ASQNPKATEFI-------EAMIEFIQELVDKEFAYVSQG-------------------
SYC_CLOPE       R-ATVNPRATEFI-------GEIIKFVKGLVDKGYAYEVDG-------------------
SYC_CLOTE       R-ATVNPRATEFM-------EEIIQFVKELVDKGYAYEIDG-------------------
SYC_CLOAB       R-ATCNPRATEYI-------GKIIDFVKGLQDEGYAYEIDG-------------------
SYC_CALS4       R-ATVHPRATEHI-------DDIIEFIKILIDKGYAYVVDG-------------------
SYC_SYMTH       P-ADVHPRATALI-------DEQIAMIQQLIDKGHAYVVEGG------------------
SYC_CARHZ       R-ATVHPKVTEHI-------PEIIEMVKGLIEKGYAYEVEG-------------------
SYC_MOOTA       R-ATLYPRVSQHI-------DAIIAAIATLVERGFAYVADG-------------------
SYC_FUSNN       EEGMIRPKATENI-------NEMIEIIQSLVDKGYAYESNG-------------------
SYC_DEHM1       P-ADYYPRATQEV-------PKIIEMVSGLIEKGYAYEAGG-------------------
SYC_DEHMC       P-ADYYPRATQEV-------PKIIEMVSGLIEKGYAYAVGG-------------------
SYC_BDEBA       P-HDMNPKVTEHM-------DDIRSMVESLVSQKKAYEAQG-------------------
SYC_COREF       P-PSVEPRATGHV-------TQMVQYMQRLIDNGFAYEVN--------------------
SYC_CORGL       P-PSTEPRATGHV-------TQMIKYMQRLIDNGFAYAVD--------------------
SYC_CORDI       P-PSVEPRATGHV-------TQMVEYMQRLIDNGFAYAAE--------------------
SYC_CORJK       P-PSIEPRATGHV-------PQMIEYMQRIIDNGHGYAAD--------------------
SYC_MYCBO       P-PSAEPRATGHI-------TQMIEMIERLIQAGHAYTGG--------------------
SYC_MYCTU       P-PSAEPRATGHI-------TQMIEMIERLIQAGHAYTGG--------------------
SYC_MYCPA       P-PSAEPRATGHI-------TQMVELIERLIEKGHAYTGD--------------------
SYC_MYCLE       P-PSAEPRATGHI-------TQMIELIELLIETGHAYTGG--------------------
SYC_NOCFA       P-PSAEPRATGHI-------TQMVELMRRLIERGHAYASA--------------------
SYC_STRAW       P-PTYEPRATGHI-------TEMVEMMRTLIERGHAYEAD--------------------
SYC_THEFY       P-PTVEPRATGHI-------PEMIELMRRLIDRGHAYVAEDG------------------
SYC_LEIXX       A-PTYEPRATASI-------PQMQEIIQRLIERGHAYAAGDG------------------
SYC_CUTAK       P-PTYEPRATGHI-------PEMIELVKTLIEKGHAYPAPDG------------------
SYC_BIFLO       P-PTVEPRATGHM-------SDMIDLIQRILDNGHGYVVTDADGKP--------------
SYC1_TROW8      P-PDYEPLVTAHI-------PDIIKAIEILIQKNVAYRAMDG------------------
SYC1_TROWT      P-PDYEPLVTAHI-------PDIIKAIEILIQKNVAYRAMDG------------------
SYC_FRACC       P-PTIQPRATGHI-------PEMIALVSALVEGGYAYASG--------------------
SYC_RHOBA       Q-IDHLPRATDHM-------PQIIAFIGSLESKGFAYAID--------------------
SYC_BACFR       P-PSIEPHASGHI-------IEQIELVKKILDAGYAYE-SQG------------------
SYC_BACFN       P-PSIEPHASGHI-------IEQIELVKKILDAGYAYE-SQG------------------
SYC_BACTN       S-PSIEPHASGHI-------IEQIQLVQKILDAGYAYE-SEG------------------
SYC_PORGI       P-PSIEPMASGHI-------IEQIELVKQILKAGYAYE-SCG------------------
SYC_CHLCH       R-PNIAPTATAHI-------PEQIALVETLLRKGYAYE-VNG------------------
SYC_PELLD       R-PNISPLATGHI-------PEQIALVDKLVKRGHAYE-VNG------------------
SYC_CHLTE       R-PNIAPTATGHI-------PEQIALVERLIESGHAYE-SNG------------------
SYC_THET2       R-PSIAPRASGHI-------PEMLELTERLLARGHAYE-RKG------------------
SYC_THET8       R-PSIAPRASGHI-------PEMLELTERLLARGVAYE-RKG------------------
SYC_DEIRA       R-PSINPRATGHI-------QEQIKLIEELIEKGHAYE-SAG------------------
SYC_BORBU       Y-PDKVLVASKHI-------PIMIEVVKILEEKKITYF-SNG------------------
SYC_BORBP       Y-PDKVLIASKHI-------PNMIEVIKILEEKKFTYF-SNG------------------
SYC_TREDE       R-PGIVCKATEHI-------NEMIELIKRIEANGHTYM-AGG------------------
SYC_TREPA       E-PSIVCNASDCI-------QDMIAFIEQLLARGHAYC-AGG------------------
SYC_NOVAD       Q-PARWTIATEYV-------PQMIAFAERIA-AKHCYE-LDS------------------
SYC_ZYMMO       N-PTIWSIATDHI-------EDMIAFARKIEEAGFTYQ-LDS------------------
SYC1_BURL3      E-PTIWCRATDHI-------AEQIAFIETLDRAGYVYR-TDD------------------
SYC_SALRD       E-PEVRPRATEHV-------TDQLEAVIELVEKEHAYT-TDQ------------------
SYC_CHLTR       K-ADAYPHATHYI-------PQMIEAIQQLINQGVAYIGQDQ------------------
SYC_CHLTA       K-ADAYPHATHYI-------PQMIEAIQQLINQGVAYIGQDQ------------------
SYC_CHLMU       K-ADAYPHATHYI-------PQMIEAIQQLIDQGIAYVGQDQ------------------
SYC_CHLCV       P-ADVYPHATHYI-------PQMIEAIAKLLDEGIAYVGQDS------------------
SYC_CHLFF       P-ADVYPHATHYI-------PQMIKAIQKLLDENIAYIGQDS------------------
SYC_CHLAB       P-ADAYPRATHYI-------PQMLVAIRKLLDDGIAYIGQDH------------------
SYC_CHLPN       R-ADFYPHATHYI-------PQMIQAITKLLEQGIAYIGQDA------------------
SYC_PARUW       S-AEYYPAATDYI-------PAMIEMIKVLLDKKVAYKGGDG------------------
SYC_LEPIN       I-LEHYPKATDSI-------PEMVDIIQKLQKKGLVYK-KDE------------------
SYC_LEPIC       I-LEHYPKATDSI-------PEMVDIIQKLQKKGLVYE-KDE------------------
SYC_CAMJE       D-PDFKPRATHYI-------TAMLDLIKKLAKDGFVYTLEDG------------------
SYC_CAMJR       D-PDFKPRATHYI-------TAMLDLIKKLAKDGFVYTLEDG------------------
SYC_HELPY       K-PSLEPKASEYL-------DAMVGMIETLLEKNIAYQVSNGD-----------------
SYC_HELPJ       Q-PSLEPKASEYL-------DAMVRMIETLLEKNFAYRVSNGD-----------------
SYC_HELHP       R-ADIEPKATDNL-------PQMCEMIQTLLHKGYAYEGENSD-----------------
SYC_WOLSU       R-PDIEPRATESL-------DLMWEMIQSLLQKGIAYQTPRGD-----------------
SYC_SULDN       R-PDIEPKATESL-------DAMYALVQKLLDNKHAYTTDDGD-----------------
SYC_AYWBP       TI-NFKPQATQYI-------NSMILYIQTLLDQGFAYFTDQG------------------
SYC_ONYPE       TI-NFKPQATQYI-------NSMIVYIQTLLDQGFAYFTDQG------------------
SYC_MYCCT       QP-DKIILISEKM-------NEMVKFIKDLVDIKAAYELDGD------------------
SYC_MYCMS       QP-DKIILISQKM-------NEMIDFIKNLVDINAAYVLDGD------------------
SYC_MESFL       MP-DKLIPISEKI-------SEMNLFIDDLVKLEAAYNVDGD------------------
SYC_MYCGA       L--PKIVKVTDVM-------SGIIKYIEKIYDKQYAYELDGD------------------
SYC_UREPA       E--MINPKVSTHM-------DKIIDYIQKLIDKQAGYFIGDD------------------
SYC_MYCPE       TSNMKFPRVSDHI-------KDIENYIQKIVNNKFAYLVDGD------------------
SYC_MYCH2       KP-TKIVKVTEKI-------EKIIEYIKLLEKKGFTYYNKNND-----------------
SYC_MYCMO       KP-DYIEKVTDNI-------NMIIEYIGLLVKKGSGYIKKGS------------------
SYC_MYCGE       PI--KHIQITEKI-------DKIPDYIDQLVNQNHAYVSTQNN-----------------
SYC_MYCPN       PI--KHLQVTDKI-------DKMPGYIARLVKKGFAYVSPLGN-----------------
                            :                :      *                       

SYC_AGRFC       -------EVLFDTRS-------MADYGQLSKRP-----------------------LDEQ
SYC_RHIEC       -------EVLFDTKS-------MADYGELSKRP-----------------------LDEQ
SYC_RHIME       -------EVLFDTRS-------MDDYGQLSKRN-----------------------LDEQ
SYC_RHILO       -------EVLFDTAS-------MPDYGQLSKRN-----------------------LDEQ
SYC_NITWN       -------EVLFDVRS-------MPDYGALSGRR-----------------------LDEQ
SYC_BARHE       -------HVLFSVSSIRND----PHYGSFAKRS-----------------------LDEM
SYC_BARQU       -------HVLFSVRSIRNH----PHYGAFAKRS-----------------------LDEM
SYC_BRUAB       -------HVLFSPSAMNARKG--PRYGALARRS-----------------------LDEM
SYC_BRUA2       -------HVLFSPSAMNARKG--PRYGALARRS-----------------------LDEM
SYC_BRUME       -------HVLFSPSAMNARKG--PRYGALARRS-----------------------LDEM
SYC_BRUSU       -------HVLFSPSAMNARKG--PRYGALARRS-----------------------LDEM
SYC_RHOPA       -------HVLFSPSAMNAANGVLPRYGSLANRS-----------------------LDEM
SYC_RHOP2       -------HVLFSPAAMNAANSVLPRYGALANRS-----------------------LDEM
SYC_RHOPB       -------HVLFSPQAMNAADGILPRYGSLANRS-----------------------LDEM
SYC_BRADU       -------HVLFSPQAMNAANSTLPRYGALSNRS-----------------------LDEM
SYC_JANSC       -------HALFRVRSF-------DDYGKLSGRS-----------------------VDDM
SYC_RUEPO       -------HVLFAVDSWK------EHYGKLSGRS-----------------------VDDM
SYC_RHOS4       -------HVLFRVRSY-------RDYGALSGRS-----------------------VDDM
SYC_ANAMM       -------TVYFSVESY-------KHYGALSGRK-----------------------LGDM
SYC_ANAPZ       -------SVYFSISSH-------RHYGRLSGRK-----------------------IDEM
SYC_EHRCJ       -------TVFFNVESY-------PSYGQLSKRN-----------------------IKEL
SYC_EHRCR       -------SVFFNIESY-------SSYGQLSGRN-----------------------ISQL
SYC_EHRRG       -------TVFFDIQSY-------PAYGKLSGRN-----------------------IMEL
SYC_EHRRW       -------TVFFDIESY-------PAYGKLSGRN-----------------------IMEL
SYC_WOLPM       -------HVYFNIESY-------HEYGALSGKK-----------------------TDEL
SYC_WOLTR       -------HIYFSIESY-------PEYGALSGKK-----------------------IDEL
SYC_NEOSM       -------NVYFDVGSF-------AEYGVLSKRK-----------------------KEQL
SYC_RICCN       -------HVYFDVLSA-------PNYTELSNRN-----------------------LEEM
SYC_RICFE       -------HVYFDVLSA-------PNYTELSNRN-----------------------LEEM
SYC_RICPR       -------HVYFDVLSA-------PNYTELSNRN-----------------------LEAM
SYC_RICTY       -------HVYFDVLSA-------PNYTELSNRN-----------------------LEEM
SYC_RICBR       -------HVYFDVLLA-------PNYTELSNRK-----------------------LEDM
SYC_PELUB       -------HVYFEVSKF-------DDYGKLSNKK-----------------------LEDL
SYC_XANOR       -------HVLFSVSSF-------EDYGKLSRRD-----------------------PDEM
SYC_XANOM       -------HVLFSVSSF-------EDYGKLSRRD-----------------------PDEM
SYC_XANAC       -------HVLFSVSSF-------DGYGKLSRRD-----------------------PDEM
SYC_XANC5       -------HVLFSVSSF-------EDYGKLSRRD-----------------------PDEM
SYC_XANCP       -------HVLFAVASF-------ADYGKLSRRD-----------------------PDEM
SYC_XANC8       -------HVLFAVASF-------ADYGKLSRRD-----------------------PDEM
SYC_XYLFA       -------HVLFAVNSF-------ADYGQLSRRD-----------------------PEEM
SYC_XYLFT       -------HVLFAVNSF-------ADYGQLSRRD-----------------------TEEM
SYC_CAUVC       -------HVLFDTQSF-------ADYGQLSGRP-----------------------LDEM
SYC_MAGSA       -------HVLFAVGAM-------ADYGALSRRS-----------------------SDEM
SYC_RHORT       -------HVLFSVPSM-------GAYGSLSGRS-----------------------MDDM
SYC_GLUOX       -------HVLFAVRNF-------PSYGELSGRS-----------------------LDDM
SYC_SACD2       -------HVLFDVQSM-------KNYGKLSNRA-----------------------LEDM
SYC_PSYA2       -----NGDVYYAVDSFAD-------YGKLSKRN-----------------------LDDM
SYC_PSYCK       -----NGDVYYAVDSFAD-------YGKLSKRN-----------------------LDDM
SYC_ACIAD       -----NGDVYFEVSKFEK-------YGRLSGRK-----------------------LEDM
SYC_PSEF5       -----NGDVYYRVGKFMG-------YGKLSRKK-----------------------IEDL
SYC_PSEPF       -----NGDVYYRVGKFMG-------YGKLSRKK-----------------------IEDL
SYC_PSE14       -----NGDVYYRVGKFQG-------YGKLSRKK-----------------------IEDL
SYC_PSEU2       -----NGDVYYRVGKFQG-------YGKLSRKK-----------------------IEDL
SYC_PSESM       -----NGDVYYRVGKFQG-------YGKLSRKK-----------------------IEDL
SYC_PSEPK       -----NGDVYYRVGKFVG-------YGKLSRKR-----------------------IEDL
SYC_PSEAE       -----NGDVYYRVGKFAG-------YGKLSRRR-----------------------VEDL
SYC_HAHCH       -----NGDVYYSVEQFAD-------YGKLSKQK-----------------------LDEI
SYC_BURMA       -----DGDVNYSVRKFAN-------YGRLSGKS-----------------------LEDL
SYC_BURPS       -----DGDVNYSVRKFAN-------YGRLSGKS-----------------------LEDL
SYC_BURP1       -----DGDVNYSVRKFAN-------YGRLSGKS-----------------------LEDL
SYC_BURTA       -----DGDVNYSVRKFAN-------YGKLSGKS-----------------------LEDL
SYC2_BURL3      -----DGDVNYSVRKFAN-------YGKLSGKS-----------------------LDDL
SYC_CUPPJ       -----DGDVNYSVRKFDG-------YGKLSGKS-----------------------LEDL
SYC_RALSO       -----DGDVNYAVRKFPG-------YGKLSGKS-----------------------LEDL
SYC_DECAR       -----DGDVNYAVRKFPG-------YGKLSGKS-----------------------LDDL
SYC_AROAE       -----NRDVCYSVRKFDS-------YGRFSGKS-----------------------LDEL
SYC_THIDA       -----NADVYYSVRGFPA-------YGRLSGKS-----------------------LDEL
SYC_NEIG1       -----NGDVYYAVREFAA-------YGQLSGKS-----------------------LDDL
SYC_NEIMB       -----NGDVYYAVREFAA-------YGQLSGKS-----------------------LDDL
SYC_CHRVO       -----NGDVYYAVREFEG-------YGKLSGRT-----------------------LDKL
SYC_NITEU       -----NGDVFYDVRRFPG-------YGKLSGKS-----------------------LDDL
SYC_NITMU       -----NGDVYYAVHRFPG-------YGKLSGKS-----------------------LDEL
SYC_BORBR       -----DGDVNYAVRGFAD-------YGKLSGKS-----------------------LDDL
SYC_BORPA       -----DGDVNYAVRGFAD-------YGKLSGKS-----------------------LDDL
SYC_BORPE       -----DGDVNYAVRGFAD-------YGKLSGKS-----------------------LDDL
SYC_BORA1       -----DGDVNYAVRGFQG-------YGKLSGKS-----------------------LDDL
SYC_RHOFT       -----NGDVNYAVRKFPG-------YGKLSGKS-----------------------LDEL
SYC_METCA       -----NGDVFYAVASFPN-------YGRLSGKN-----------------------LDEL
SYC_NITOC       -----NGDIYYDVSHFEG-------YGALSGRH-----------------------LEDL
SYC_HYDCU       -----NGDVYFHVKADDD-------YGRLSGKN-----------------------IEEL
SYC_LEGPL       -----NGDVCYEVDTFPE-------YGKLSHKD-----------------------IEGL
SYC_LEGPA       -----NGDVCYEVDTFPE-------YGKLSHKD-----------------------IEGL
SYC_LEGPH       -----NGDVCYEVDTFPE-------YGKLSHKD-----------------------IEGL
SYC_BLOFL       -----DGNVMFSIQTVYN-------YGVLSCHK-----------------------KNQT
SYC_BLOPB       -----NGDIMFSVETMHN-------YGVLSNKE-----------------------NPPK
SYC_BUCAI       -----NGDVIFSIDSDPN-------YGTLSRQS-----------------------LTSL
SYC_BUCAP       -----HGDVIFSINSDKF-------YGTLSRQS-----------------------LDKL
SYC_BUCBP       -----NGDIMFSVSSYLN-------YGALSNQF-----------------------SKIL
SYC_WIGBR       -----TGDVVFDISTYRD-------YGKLSKRFEE---------------------KKQL
SYC_COLP3       -----QGDVLFDVSSYND-------YGKLSGQN-----------------------LEQL
SYC_PSET1       -----DGDVLFDVSTFEQ-------YGALSQQD-----------------------LTML
SYC_IDILO       -----NGDVLFDVSTFND-------YGKLSRQD-----------------------LEQL
SYC_ECOL6       -----NGDVMFDVPTDPT-------YGVLSRQD-----------------------LDQL
SYC_SHIFL       -----NGDVMFDVPTDPT-------YGVLSRQD-----------------------LDQL
SYC_ECOLI       -----NGDVMFDVPTDPT-------YGVLSRQD-----------------------LDQL
SYC_ECO57       -----NGDVMFDVPTDPT-------YGVLSRQD-----------------------LDQL
SYC_SHISS       -----NGDVMFDVPTDPT-------YGVLSRQD-----------------------LDQL
SYC_SHIBS       -----NGDVMFDVPTDPT-------YGVLSRQD-----------------------LDQL
SYC_SHIDS       -----NGDVMFDVPTDPT-------YGVLSRQD-----------------------LDQL
SYC_SALCH       -----NGDVMFDVPTDPT-------YGQLSRQD-----------------------LEQL
SYC_SALTY       -----NGDVMFDVPTDPT-------YGQLSRQD-----------------------LEQL
SYC_SALPA       -----NGDVMFDVPTDPT-------YGQLSRQD-----------------------LEQL
SYC_SALTI       -----NGDVMFDVPTDPT-------YGQLSRQD-----------------------LEQL
SYC_PECAS       -----NGDVMFSVDTASG-------YGVLSRQD-----------------------LDQL
SYC_YERPE       -----NGDVMFAVDSDPD-------YGVLSRQD-----------------------LDQL
SYC_YERPS       -----NGDVMFAVDSDPD-------YGVLSRQD-----------------------LDQL
SYC_PHOLL       -----NGDVMFSVESDQD-------YGLLSRQD-----------------------LSQL
SYC_SODGM       -----NGDVMFAVDSDSD-------YGLLSRQD-----------------------LEQL
SYC_VIBVU       -----NGDVMFEVNKFDE-------YGKLSKQD-----------------------LDQL
SYC_VIBVY       -----NGDVMFEVNKFDE-------YGKLSKQD-----------------------LDQL
SYC_VIBPA       -----NGDVMFEVGKFDE-------YGKLSKQD-----------------------LDQL
SYC_VIBCH       -----NGDVMFEVSQYSE-------YGKLSKQD-----------------------LDQL
SYC_ALIF1       -----NGDVMFEVKKYDE-------YGCLSRQD-----------------------LEQL
SYC1_PHOPR      -----NGDVMFEVSKFEE-------YGRLSRQD-----------------------LDQL
SYC_SHEON       -----DGDVLFSVASFPE-------YGRLSGQN-----------------------LEQL
SYC_HAEDU       -----DGDVMFDVTSFNQ-------YGALSRQN-----------------------LDQL
SYC_MANSM       -----DGDVMFDVESFQK-------YGALSRQN-----------------------LEQL
SYC_HAEIN       -----NGDVMFDVESFKE-------YGKLSRQD-----------------------LEQL
SYC_HAEI8       -----NGDVMFDVESFKE-------YGKLSRQD-----------------------LEQL
SYC_PASMU       -----NGDVMFDVESFKE-------YGKLSRQN-----------------------LEQL
SYC_FRATH       -----NGDVFYRVTKFAD-------YGKLSKQN-----------------------LEAL
SYC_FRATT       -----NSDVFYRVTKFAD-------YGKLSKQN-----------------------LEAL
SYC_COXBU       -----NGDVFFDVRRFKD-------YGKLSHRH-----------------------LDEL
SYC_DESAG       -----SGDVYFRVRSFAS-------YGKLSGRD-----------------------VDDM
SYC_DESVH       -----SGDVYFRVRSFPE-------YGKLSGRD-----------------------IDDM
SYC_ANADE       -----NGDVYYAVRKFPE-------YGRLSKRN-----------------------LDDL
SYC_GEOMG       -----DGDVYFCVEKFDP-------YLKLSKRN-----------------------LDEM
SYC_GEOSL       -----DGDVYFSVEAFDQ-------YLKLSKRN-----------------------LEEM
SYC_PELCD       -----QGDVYFSVEDFPS-------YLKLSKRN-----------------------MDEM
SYC_DESPS       -----AGDVYYVVNSFPE-------YGKLSGRN-----------------------IEDM
SYC_NOSS1       -------DVYYRVERFPS-------YGKLSGRE-----------------------LEQM
SYC_TRIV2       -------DVYYRVERFPS-------YGKLSGRE-----------------------LEQM
SYC_SYNY3       -------DVYYSVRNFDG-------YGKLSGRR-----------------------LEDL
SYC_SYNP6       -------DVYFSVRRFQD-------YGKLSGRK-----------------------LEDL
SYC_SYNE7       -------DVYFSVRRFQD-------YGKLSGRK-----------------------LEDL
SYC_THEEB       -------DVYYAVAQFPS-------YGKLSGRQ-----------------------LEQL
SYC_GLOVI       -------DVYYSVRRFAE-------YGKLSGKR-----------------------LAEL
SYC_SYNJB       TPASVQYSVYYSVRKFPD-------YGQLSGRK-----------------------LEEM
SYC_SYNJA       TPA---YDVYYAVRKFPD-------YGQLSGRK-----------------------LEEL
SYC_SYNS9       -------DVYFAVMKHAG-------YGKLSGRD-----------------------LSEQ
SYC_SYNPX       -------DVYFAVMKHAG-------YGKLSGRD-----------------------LSEQ
SYC_PROMM       -------DVYFAVMKHHG-------YGKLSGRD-----------------------LNEQ
SYC_SYNSC       -------DVYFDISKAKN-------YGKLSGRD-----------------------PDDQ
SYC_PROMA       -------DVYFAVMKHAN-------YGKLSKRD-----------------------LSEQ
SYC_PROMT       -------DVYFSVDKHKN-------YGKLSGRE-----------------------IEDQ
SYC_PROM9       -------DVYYSVFKNKN-------YGKLSNQN-----------------------IQEQ
SYC_PROMP       -------DVYYSVFKNKN-------YGKLSNQN-----------------------ILEQ
SYC_AQUAE       -------DVYFSVKKFKD-------YGKLSKRD-----------------------IEEL
SYC_THEMA       -------GVYFDVRKFEK-------YGELSKKK-----------------------IEDL
SYC_BACAN       -------DVYFRTKEFEG-------YGKLSHQP-----------------------IADL
SYC_BACHK       -------DVYFRTKEFEG-------YGKLSHQP-----------------------IADL
SYC_BACCZ       -------DVYFRTKEFEG-------YGKLSHQP-----------------------IADL
SYC_BACC1       -------DVYFRTKEFEG-------YGKLSHQP-----------------------IADL
SYC_BACCR       -------DVYFKTKEFEG-------YGKLSHQP-----------------------IADL
SYC_BACLD       -------DVYYKTRSFEG-------YGKLSHQS-----------------------VDEL
SYC_BACSU       -------DVYFKTRAFEG-------YGKLSQQS-----------------------IDEL
SYC_GEOKA       -------DVYYRTRKFRE-------YGKLSHQS-----------------------IDEL
SYC_OCEIH       -------DVYFKPRSFDT-------YGKLSHQS-----------------------IDEL
SYC_BACSK       -------DVYFRTRKFNG-------YGKLSGQA-----------------------LDDL
SYC_BACHD       -------DVYFRTRKFKE-------YGKLSAQS-----------------------IDDL
SYC_LISMO       -------DVYFQTKKFKD-------YGKLSGQE-----------------------LSEL
SYC_LISMF       -------DVYFRTKKFKD-------YGKLSGQE-----------------------LSEL
SYC_LISIN       -------DVYFRTKKFKD-------YGKLSGQE-----------------------LSEL
SYC_STAAC       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAA3       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAAM       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAAN       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAAS       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAAW       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAAB       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAAR       -------DVYFRTRKFEG-------YGKLSHQS-----------------------IDDL
SYC_STAES       -------DVYFRTRQFDG-------YGKLSHQS-----------------------LDDL
SYC_STAEQ       -------DVYFRTRQFDG-------YGKLSHQS-----------------------LDDL
SYC_STAHJ       -------DVYFRTRKFEG-------YGKLSHQS-----------------------LDDL
SYC_STAS1       -------DVYFRTRKFQD-------YGKLSHQS-----------------------LNDL
SYC_LACPL       -------DVYYRARKFKK-------YGQLSDQR-----------------------IDDL
SYC_LACSS       -------DVYYRARKFKA-------YGHLAGQD-----------------------LDQL
SYC_ENTFA       -------DVYYRTRKFPN-------YGKLSHQS-----------------------IDEL
SYC_LACAC       -------DVYYRAKKFQH-------YGELSDQN-----------------------IEQL
SYC_LACJO       -------DVYYRARKFPN-------YGQLSDQN-----------------------IAEL
SYC_STRA1       -------DVYFRVSKSHH-------YAKLANKT-----------------------LEDL
SYC_STRA5       -------DVYFRVSKSHH-------YAKLANKT-----------------------LEDL
SYC_STRA3       -------DVYFRVSKSHH-------YAKLANKT-----------------------LEDL
SYC_STRPM       -------DVYFRVEKSEH-------YAKLANKT-----------------------LSEL
SYC_STRP3       -------DVYFRVEKSEH-------YAKLANKT-----------------------LSEL
SYC_STRP8       -------DVYFRVEKSEH-------YAKLANKT-----------------------LSEL
SYC_STRP6       -------DVYFRVEKSEH-------YAKLANKT-----------------------LSEL
SYC_STRP1       -------DVYFRVEKSEH-------YAKLANKT-----------------------LSEL
SYC_STRT2       -------DVYFRVTKSNN-------YAKLANKT-----------------------LEDL
SYC_STRT1       -------DVYFRVTKSNN-------YAKLANKT-----------------------LEDL
SYC_STRMU       -------DVYFRVRKSDN-------YAALANKT-----------------------LEEL
SYC_STRPN       -------DVYFRVEKSHN-------YAKLANKT-----------------------LEDL
SYC_STRR6       -------DVYFRVEKSHN-------YAKLANKT-----------------------LEDL
SYC_LACLA       -------DVYFRVSKSKD-------YAKLANKN-----------------------LADL
SYC_CLOPE       -------DVYFSTKKFEG-------YGKLSGQN-----------------------IEDL
SYC_CLOTE       -------DVYFHTKRFNE-------YGKLSGQN-----------------------IEDL
SYC_CLOAB       -------DVYFNTNAFKE-------YGKLSGQN-----------------------LEDR
SYC_CALS4       -------NVYFETAKFKD-------YGKLSHKN-----------------------IDEL
SYC_SYMTH       -------DVYFRVTTSPD-------YGKLSHKN-----------------------LEEL
SYC_CARHZ       -------NVYFAVDSFSD-------YGKLSGRD-----------------------LEEL
SYC_MOOTA       -------DVYFEVEKFPA-------YGRLSKRT-----------------------PGEM
SYC_FUSNN       -------DVYFEVKKYRDG------YGELSKQN-----------------------IEDL
SYC_DEHM1       -------SVYLRVQKVEG-------YGKLSHRT-----------------------LEQM
SYC_DEHMC       -------SVYLRVQKVDG-------YGKLSHRT-----------------------LEQM
SYC_BDEBA       -------DVLYSIESFKD-------YGKLSGRN-----------------------TDDL
SYC_COREF       ------GSVYFDVTAWVAAEG--SDYGSLSGNR-----------------------VEDM
SYC_CORGL       ------GSVYFDVAAWSKAEG--SDYGSLSGNR-----------------------VEDM
SYC_CORDI       ------GSVYFDVAAWTAAEG--SDYGSLSGNR-----------------------VEEM
SYC_CORJK       ------GNVYAQPATI-------DNYGFLSGQK-----------------------LDEM
SYC_MYCBO       ------GDVYFDVLSY-------PEYGQLSGHK-----------------------IDDV
SYC_MYCTU       ------GDVYFDVLSY-------PEYGQLSGHK-----------------------IDDV
SYC_MYCPA       ------GDVYFDVLSY-------PEYGQLSGHR-----------------------IDDV
SYC_MYCLE       ------SDVYFDVLSY-------PDYGQLSGHK-----------------------MDYI
SYC_NOCFA       ------GNVYFDVQSY-------PEYGALSGHK-----------------------LDDV
SYC_STRAW       ------GNVYFDVRSF-------PEYLQLSNQE-----------------------LDNL
SYC_THEFY       -----SGDVYFDVTSY-------AEYGSLSNQR-----------------------LEEM
SYC_LEIXX       -----SGDVYFDVRSW-------PAYGELTRQS-----------------------ADSM
SYC_CUTAK       -----SGDVYFDVRSW-------PRYGELSGIR-----------------------VDEM
SYC_BIFLO       -----TGNVYFDVASW-------PHYGELTHQKQTSEVDEAAAVADRMGPSVDATGADKY
SYC1_TROW8      -----SGNVFFSIDKH-------PSYGELTDQK-------------------------DL
SYC1_TROWT      -----SGNVFFSIDKH-------PSYGELTDQK-------------------------DL
SYC_FRACC       ------GSVWFRVGAF-------ADYGALSHQR-----------------------PDAM
SYC_RHOBA       ------GDVFFDVTKD-------PGYGQLSNRS------------------------VED
SYC_BACFR       -------SVYFDVAKYNKDHH----YGKLSGRN-----------------------LDDV
SYC_BACFN       -------SVYFDVAKYNKDYH----YGKLSGRN-----------------------LDDV
SYC_BACTN       -------SVYFDVAKYNKDYH----YGKLSGRN-----------------------LDDV
SYC_PORGI       -------SVYFDVEKYNQDHR----YGVLSGRN-----------------------IEEM
SYC_CHLCH       -------NVYFSVNSFAG-------YGKLSGRT-----------------------DQEA
SYC_PELLD       -------NVYFSVESFPG-------YGKLSGRT-----------------------DLDA
SYC_CHLTE       -------NVYFDVNSFEG-------YGKLSGRT-----------------------DQEA
SYC_THET2       -------SVYFRVRSFPE-------YGKLSGKR-----------------------LEE-
SYC_THET8       -------SVYFRVRSFPE-------YGKLSGKR-----------------------LEE-
SYC_DEIRA       -------SVYFDVRSWPE-------YGKLSGRK-----------------------LDD-
SYC_BORBU       -------NVYFDTSCFKS-------YGEMAGID-----------------------LIDK
SYC_BORBP       -------NVYFDTSCFKS-------YGEMAGID-----------------------LIDK
SYC_TREDE       -------NLYYDISTFPK-------YGELANIN-----------------------LEDL
SYC_TREPA       -------NVYFDVRSFPS-------YESFGSAA-----------------------VEDV
SYC_NOVAD       -------GLYFDVSTVAD-------YGRLARAQ-----------------------TEE-
SYC_ZYMMO       -------GLYFDTSRLKE-------YGLLAGHR-----------------------EAE-
SYC1_BURL3      -------GLYFDTSRQDD-------YGYLARLD-----------------------RAGL
SYC_SALRD       -------GVYFSVESVED-------YGHLSGNT-----------------------EAQQ
SYC_CHLTR       -------SVYFSISQFPN-------YGALSHLN-----------------------LEEL
SYC_CHLTA       -------SVYFSISQFPN-------YGALSHLN-----------------------LEEL
SYC_CHLMU       -------SVYFSISRFPN-------YGSLSHLN-----------------------LEEL
SYC_CHLCV       -------SVYFSIEKFPT-------YGKLSQLK-----------------------LQDL
SYC_CHLFF       -------SVYFSIKKFPT-------YGKLSQLK-----------------------LQDL
SYC_CHLAB       -------SVYFSIKEFPS-------YGKLSQLQ-----------------------LQNL
SYC_CHLPN       -------SVYFSLNRFPN-------YGKLSHLD-----------------------LSSL
SYC_PARUW       -------SIYYAINQFPR-------YGCLSHLH-----------------------LEDL
SYC_LEPIN       -------SLYFSIQKFQN-------YGKLSKID-----------------------TSGM
SYC_LEPIC       -------SLYFSIQKFQN-------YGKLSKID-----------------------TSGM
SYC_CAMJE       --------IYFDTSKDEK-------YLSLSNR-------------------------NLE
SYC_CAMJR       --------IYFDTSKDEK-------YLSLSNR-------------------------NLE
SYC_HELPY       --------IYLDTSKDKD-------YGSLSVH-------------------------NSS
SYC_HELPJ       --------IYLDTSKDKD-------YGSLSMH-------------------------NSS
SYC_HELHP       --------IYLRIHKDKN-------YGALSQRL------------------------EQS
SYC_WOLSU       --------IYLDVKQDPS-------YGKLSGRG------------------------EDL
SYC_SULDN       --------VYFDTSSDSK-------YLTLSNRVQ-----------------------DES
SYC_AYWBP       --------IYFRVSK-------ITDYGKLKKQD-----------------------LSQL
SYC_ONYPE       --------IYFRVSK-------IDDYGKLKKQD-----------------------LSQL
SYC_MYCCT       --------VYFDIKKY------QNEYCKLSGYK-----------------------LDEL
SYC_MYCMS       --------VYFDIKKY------ENEYCKLSGYK-----------------------LDEL
SYC_MESFL       --------VYFDIQKF------SDEYGKLSNKK-----------------------INDL
SYC_MYCGA       --------IYFDTTR-------IADYGVLSKRK-----------------------LDEQ
SYC_UREPA       --------VYFDTKK-------ALNYGQLSKRD-----------------------LEND
SYC_MYCPE       --------VYFDTTK-------SNQYGKISNKK-----------------------LDEL
SYC_MYCH2       --------LVFDILK-------IPNYGIISGQK-----------------------IESL
SYC_MYCMO       --------VYFDTTK-------YPEYGSISNLN-----------------------LNKT
SYC_MYCGE       --------VYFAVNS-------LKQYGYLANRM-----------------------VH--
SYC_MYCPN       --------TYFSVSQ-------LPQYGILANRV-----------------------VET-
                                         *  :                               

SYC_AGRFC       QAGA-----RVAVEAH-------KKNPGDFVLWKLSSE-----SEPGWESPWG---LGRP
SYC_RHIEC       QAGA-----RVAVDAH-------KKNPGDFVLWKLSSH-----NEPGWESPWG---RGRP
SYC_RHIME       QAGA-----RVAVEAH-------KKNPGDFVLWKLSAE-----HEPGWDSPWG---RGRP
SYC_RHILO       QAGA-----RVAVDAH-------KKNPGDFVLWKLSSP-----EEPGWQSPWG---RGRP
SYC_NITWN       KAGA-----RVAVDAH-------KRNPADFVLWKLSSE-----NEPGWDSPWG---RGRP
SYC_BARHE       RAGA-----RVDVASY-------KREEMDFVLWKPSAE-----GEPGWTSPAGIPVLGRP
SYC_BARQU       RAGA-----RVDVAAY-------KREEMDFVLWKPSAV-----GEPGWASPAGIPVLGRP
SYC_BRUAB       LAGA-----RVDVASY-------KRDEMDFVLWKPSKK-----GEPGWPSPAGIETLGRP
SYC_BRUA2       LAGA-----RVDVASY-------KRDEMDFVLWKPSKK-----GEPGWPSPAGIETLGRP
SYC_BRUME       LAGA-----RVDVASY-------KRDEMDFVLWKPSKK-----GEPGWPSPAGIETLGRP
SYC_BRUSU       LAGA-----RVDVASY-------KRDEMDFVLWKPSKK-----GEPGWPSPAGIETLGRP
SYC_RHOPA       IAGA-----RVDVAPY-------KRDATDFVLWKPSKP-----GEPSWPSPAGIATPGRP
SYC_RHOP2       IAGA-----RVDVAPY-------KRDATDFVLWKPSKP-----GEPSWPSPAGITMEGRP
SYC_RHOPB       IAGA-----RVDVAPY-------KRDVTDFVLWKPSKP-----GEPSWPSPAGIATQGRP
SYC_BRADU       VAGA-----RVDVAPY-------KKGSTDFVLWKPSKP-----GEPSWPSPAGIAAQGRP
SYC_JANSC       IAGA-----RVEVAPY-------KEDPMDFVLWKPSSD-----DIPGWDSPWG---RGRP
SYC_RUEPO       IAGA-----RVEVAPY-------KKNPMDFVLWKPSTP-----DLPGWDSPWG---RGRP
SYC_RHOS4       IAGA-----RVEVAPF-------KEDPMDFVLWKPSDD-----ELPGWDSPWG---RGRP
SYC_ANAMM       ISGS-----RVEVVAE-------KLHPGDFVLWKPATDLDMK-LGACWPSPWG---VGRP
SYC_ANAPZ       ISGN-----RVSIDAE-------KLHPGDFVLWKPATEQDIK-LGAAWESPWG---GGRP
SYC_EHRCJ       IYGS-----RVDIELG-------KKHPGDFVLWKPATEVDNK-LMSCWPSPWG---LGRP
SYC_EHRCR       IYGS-----RIDIEVG-------KKHPGDFVLWKPATEIDNQ-LMSCWSSPWG---LGRP
SYC_EHRRG       IYGS-----RIDIEVG-------KKHPGDFVLWKPATDIDSK-LMSCWPSPWG---VGRP
SYC_EHRRW       IYGS-----RIDIEVG-------KKHPGDFVLWKPATDIDNK-LMSCWPSPWG---VGRP
SYC_WOLPM       VPGS-----RVEVNEN-------KKHPGDFVLWKPANDIDYK-LSSYWNSPWG---EGRP
SYC_WOLTR       EHGS-----RVEVGEN-------KKHPGDFVLWKPANDTDYK-LSSYWNSPWG---EGRP
SYC_NEOSM       VYGV-----RVEKDVD-------KKHPGDFILWKSDD-------HVYWPSPWG---NGRP
SYC_RICCN       FEGV-----HVENSKT-------KKNPQDFVLWKPAKQ-NES-ANMNFESPWG---LGRP
SYC_RICFE       FEGV-----RIENSKT-------KKHPQDFVLWKPAKP-NES-ANMNFKSPWG---FGRP
SYC_RICPR       FEGV-----RIENSKT-------KKNPQDFVLWKPAKK-NEP-ENINFTSPWG---LGRP
SYC_RICTY       FEGV-----RIENSKT-------KKNPQDFVLWKPAKQ-NEP-KNVNFSSPWG---LGRP
SYC_RICBR       FESV-----RVENSKT-------KKHPQDFVLWKPAKP-DED-VHMNFKSPWG---LGRP
SYC_PELUB       IAGS-----RVEVSDN-------KKKSEDFVLWKPSKD-DEP----SWDSPWG---KGRP
SYC_XANOR       LAGA-----RVDVAPY-------KRDPGDFVLWKPSSD-----ELPGWESPWG---RGRP
SYC_XANOM       LAGA-----RVDVAPY-------KRDPGDFVLWKPSSD-----ELPGWESPWG---RGRP
SYC_XANAC       LAGA-----RVDVAPY-------KRDPGDFVLWKPSSA-----DLPGWESPWG---RGRP
SYC_XANC5       LAGA-----RVDVAPY-------KRDPGDFVLWKPSSD-----DLPGWPSPWG---RGRP
SYC_XANCP       LAGA-----RVDVAPY-------KRDPGDFVLWKPSSD-----DLPGWDSPWG---RGRP
SYC_XANC8       LAGA-----RVDVAPY-------KRDPGDFVLWKPSSD-----DLPGWDSPWG---RGRP
SYC_XYLFA       LAGA-----RVEIAPY-------KRDPSDFVLWKPSSD-----QLPGWDSPWG---RGRP
SYC_XYLFT       LAGA-----RVEIAPY-------KRDPSDFVLWKPSSD-----QLPGWDSPWG---RGRP
SYC_CAUVC       IAGA-----RVEVAPY-------KRHPADFVLWKPSKE-----NEPEWESPWG---AGRP
SYC_MAGSA       IAGA-----RVEVAPY-------KKDPGDFVLWKPSSD-----DLPGWDSPWG---RGRP
SYC_RHORT       IAGA-----RVEVAPY-------KRDPADFVLWKPSDA-----SLPGWDSPWG---RGRP
SYC_GLUOX       IAGA-----RVEVAPY-------KRDPGDFVLWKPSEP-----DLPGWDSPYG---RGRP
SYC_SACD2       LDGA-----RVEVADY-------KRYAGDFVLWKPSAD-----DEPGWASPWG---RGRP
SYC_PSYA2       QAGS-----RVEVEND-------KRNPFDFVLWKAAK-PDEP----QWVSSWG---QGRP
SYC_PSYCK       QAGS-----RVEVEND-------KRNPFDFVLWKAAK-PDEP----QWASAWG---QGRP
SYC_ACIAD       QAGAS---ERVDIEVE-------KKHPFDFVLWKGAK-PNEP----SWVSPWG---NGRP
SYC_PSEF5       RIGA-----RIEVDES-------KQDPLDFVLWKAAK-PGEP----SWPSPWG---DGRP
SYC_PSEPF       RIGA-----RIEVDEA-------KEDPLDFVLWKGVK-PGEP----SWESPWG---AGRP
SYC_PSE14       RIGA-----RIEVDES-------KEDPLDFVLWKGVK-PGEP----SWESPWG---AGRP
SYC_PSEU2       RIGA-----RIEVDES-------KEDPLDFVLWKGVK-PGEP----SWESPWG---AGRP
SYC_PSESM       RIGA-----RIEVDES-------KQDPLDFVLWKGVK-PGEP----SWESPWG---AGRP
SYC_PSEPK       RIGA-----RIEVDEA-------KQDPLDFVLWKGVK-PGEP----SWESPWG---PGRP
SYC_PSEAE       RIGA-----RIEPGEA-------KEDPLDFVLWKGAK-PGEP----SWSSPWG---EGRP
SYC_HAHCH       RAGA-----RIEVDAE-------KRSPADFVLWKAAK-PGEL----SWDSPWG---EGRP
SYC_BURMA       RAGE-----RVAANDA-------KEDPLDFVLWKRAK-PQEPA-GASWESKYG---AGRP
SYC_BURPS       RAGE-----RVAANDA-------KEDPLDFVLWKRAK-PQEPA-GASWESKYG---AGRP
SYC_BURP1       RAGE-----RVAANDA-------KEDPLDFVLWKRAK-PQEPA-GASWESKYG---AGRP
SYC_BURTA       RAGE-----RVAAKDA-------KDDPLDFVLWKRAK-PEEPA-GASWESKYG---AGRP
SYC2_BURL3      RAGE-----RVAANDA-------KEDPLDFVLWKRAK-PEDPE-GTSWASKYG---MGRP
SYC_CUPPJ       RAGE-----RVTANDA-------KQDPLDFVLWKSAK-ESEPP-ESKWNSKWG---MGRP
SYC_RALSO       RAGE-----RVAANDA-------KQDPLDFVLWKSAK-ADEPA-ESRWASPWG---EGRP
SYC_DECAR       RAGE-----RVEVDSA-------KQDPLDFVLWKHAK-PGEP----AWQSPWG---DGRP
SYC_AROAE       RAGE-----RVEVAGD-------KQDPLDFVLWKHAR-TDEPD-EVKWASPWG---AGRP
SYC_THIDA       RAGE-----RVEVDPN-------KRDPMDFVLWKAAK-PGEP----AWESPWG---QGRP
SYC_NEIG1       RAGE-----RVEVDGF-------KRDPLDFVLWKAAK-AGEP----AWESPWG---NGRP
SYC_NEIMB       RAGE-----RVEVDGF-------KRDPLDFVLWKAAK-AGEP----AWESPWG---NGRP
SYC_CHRVO       RAGE-----RVEVDPN-------KRDPLDFVLWKAAK-PGEP----SWDSPWG---KGRP
SYC_NITEU       RAGE-----RVEIDTN-------KRDPLDFVLWKAAK-PDEP----SWDSPWG---KGRP
SYC_NITMU       RAGE-----RVIVDPH-------KNDPLDFVLWKAAK-PGEP----QWDSPWG---PGRP
SYC_BORBR       RAGE-----RVAVGSA-------KRDPLDFVLWKSAK-PQEPD-DTKWESPYG---LGRP
SYC_BORPA       RAGE-----RVAVGSA-------KRDPLDFVLWKSAK-PQEPD-DTKWESPYG---LGRP
SYC_BORPE       RAGE-----RVAVGSA-------KRDPLDFVLWKSAK-PQEPD-DTKWESPYG---LGRP
SYC_BORA1       RAGE-----RVAVGSS-------KRDPLDFVLWKSAK-EEEPP-ETKWDSPYG---FGRP
SYC_RHOFT       RAGE-----RVAVADG-------KDDPLDFVLWKTAK-PNEPL-DAKWDSVYG---QGRP
SYC_METCA       RAGE-----RIEVDEA-------KRDPLDFVLWKSAK-PGEP----FWASPWG---PGRP
SYC_NITOC       RAGE-----RVQVNEA-------KTDPLDFVLWKAAK-SGEP----AWESPWG---PGRP
SYC_HYDCU       DSGS-----RVEINSV-------KKDPLDFVLWKASK-ENEP----AWQSPWG---DGRP
SYC_LEGPL       VSGS-----RVEIVKE-------KRSPLDFVLWKKAK-PGEP----SWPSPWG---EGRP
SYC_LEGPA       VSGS-----RVEIVKE-------KRSPLDFVLWKKAK-PGEP----SWPSPWG---EGRP
SYC_LEGPH       VSGS-----RVEIVKE-------KRSPLDFVLWKKAK-PGEP----SWPSPWG---EGRP
SYC_BLOFL       FTQR-----NIRNKMI-------KKDPVDFVLWKTAK-S----GEPYWISPWG---KGRP
SYC_BLOPB       IHDN-----ILKIPNI-------KKNPMDFVLWKKTT-YNNKLGEPCWSSPWG---LGRP
SYC_BUCAI       ESGS-----RIPLNNM-------KKNPLDFILWKSSN-KEE----YSWDSPWG---KGRP
SYC_BUCAP       ISGT-----RISIDKE-------KKNSSDFILWKKSK-KEEK---FSWNSPWG---KGRP
SYC_BUCBP       NKEI-----NISHYST-------KKNIADFALWKTSK-SSIF---VGWNSPWG---NGRP
SYC_WIGBR       LNNK-----KNKINFK-------TKKEKDFVLWKMSK-PNE----PSWKSPWG---HGRP
SYC_COLP3       QSGS-----RVEVDQN-------KNNPLDFVLWKSAK-PGE----PSWSSPWG---EGRP
SYC_PSET1       QSGS-----RVEVAQD-------KDDPLDFVLWKKAK-AGE----PSWSSPWG---EGRP
SYC_IDILO       QAGS-----RVDVDAA-------KQDPLDFVLWKSAK-PGE----PSWSSPWG---EGRP
SYC_ECOL6       QAGA-----RVDVVDD-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---AGRP
SYC_SHIFL       QAGA-----RVDVVDD-------KRNRMDFVLWKMSK-EGE----PSWPSPWG---AGRP
SYC_ECOLI       QAGA-----RVDVVDD-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---AGRP
SYC_ECO57       QAGA-----RVDVVDD-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---AGRP
SYC_SHISS       QAGA-----RVDVVDD-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---AGRP
SYC_SHIBS       QAGA-----RVDVVDD-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---AGRP
SYC_SHIDS       LAGA-----RVDVVDD-------KRNTMDFVLWKMSK-EGE----PSWPSPWG---AGRP
SYC_SALCH       QAGA-----RVDVVDV-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---EGRP
SYC_SALTY       QAGA-----RVDVVDV-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---EGRP
SYC_SALPA       QAGA-----RVDVVDV-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---EGRP
SYC_SALTI       QAGA-----RVDVVDV-------KRNPMDFVLWKMSK-EGE----PSWPSPWG---EGRP
SYC_PECAS       RAGA-----RVEITEV-------KRNPMDFVLWKMSK-PGE----PHWSSPWG---EGRP
SYC_YERPE       QAGA-----RVEVADV-------KRNPMDFVLWKMSK-PGE----PRWESPWG---PGRP
SYC_YERPS       QAGA-----RVEVADV-------KRNPMDFVLWKMSK-PGE----PRWESPWG---PGRP
SYC_PHOLL       QAGA-----RVEVADV-------KRNPMDFVLWKMSK-PGE----PSWESPWG---AGRP
SYC_SODGM       QAGA-----RVEVADV-------KRNPMDFVLWKMSK-PGE----PSWPSPWG---DGRP
SYC_VIBVU       QAGA-----RVDVETA-------KRCPLDFVLWKMSK-PGE----PTWESPWG---PGRP
SYC_VIBVY       QAGA-----RVDVETA-------KRCPLDFVLWKMSK-PGE----PTWESPWG---PGRP
SYC_VIBPA       QAGA-----RVDIETA-------KRSPLDFVLWKMSK-PGE----PTWESPWG---PGRP
SYC_VIBCH       QAGA-----RVDIEAA-------KRSPLDFVLWKMSK-PGE----PTWESPWG---SGRP
SYC_ALIF1       QAGS-----RVTLEEA-----SVKRSGMDFVLWKMSK-PGE----PTWESPWG---PGRP
SYC1_PHOPR      QAGA-----RVDIDMA-------KRSPLDFVLWKMSK-PGE----PTWESPWG---AGRP
SYC_SHEON       QAGA-----RVEVDDN-------KQNPMDFVLWKMSK-PGE----PTWESPWG---PGRP
SYC_HAEDU       QAGA-----RVEIKSA-------KKNPMDFVLWKRSK-ENE----PSWLSPWG---NGRP
SYC_MANSM       QAGA-----RVEIKSV-------KKNPMDFVLWKMSK-PNE----PSWDSPWG---KGRP
SYC_HAEIN       QAGA-----RIEINEI-------KKNPMDFVLWKMSK-ENE----PSWASPWG---AGRP
SYC_HAEI8       QAGA-----RIEINEI-------KKNPMDFVLWKMSK-ENE----PSWASPWG---AGRP
SYC_PASMU       QAGA-----RVEIVNV-------KKNPMDFVLWKMSK-PGE----PSWPSPWG---EGRP
SYC_FRATH       QQGS-----RVDVVEE-------KENPMDFVLWKMAK-EGE----PAWDSPWG---AGRP
SYC_FRATT       QQGS-----RVDVVEE-------KENPMDFVLWKMAK-EGE----PAWDSPWG---AGRP
SYC_COXBU       QAGA-----RVEVSDS-------KRDPLDFVLWKKAK-PGE----PKWDSPWG---EGRP
SYC_DESAG       RSGA-----RVAPGEE-------KEDPLDFALWKSAK-PGEP----YWESPWG---NGRP
SYC_DESVH       RSGA-----RVAPGEE-------KEDPLDFALWKAAK-PGEP----SWTSPWG---EGRP
SYC_ANADE       IAGA-----RVEPGEA-------KRDPLDFALWKAAK-PGEP----AWDSPWG---KGRP
SYC_GEOMG       QAGA-----RIEVGEK-------KRHPMDFALWKGSK-PGEP----FWESPWG---QGRP
SYC_GEOSL       QAGA-----RIEVGEK-------KRHPMDFALWKGSK-PGEP----YWDSPWG---QGRP
SYC_PELCD       RSGA-----RITPGEQ-------KRNPMDFALWKAAK-PGEP----SWESPWG---PGRP
SYC_DESPS       QAGA-----RISINEQ-------KRNPMDFALWKASK-PGEP----SWESPWG---PGRP
SYC_NOSS1       QAGA-----SGRVDAEDSE-P-KKQHPFDFALWKAAK-PGE----PAWDSPWG---AGRP
SYC_TRIV2       QAGA-----SGRVDVEDSE-P-KKQHPFDFALWKAAK-PGE----PAWDSPWG---QGRP
SYC_SYNY3       QAGA-----SGRVTVADPDGA-QKQDPFDFALWKSAK-PGE----PAWESPWG---KGRP
SYC_SYNP6       KAGA-----SGRVESAEES---LKHDPFDFALWKAAK-PEE----PAWDSPWG---PGRP
SYC_SYNE7       KAGA-----SGRVESAEES---LKHDPFDFALWKAAK-PEE----PAWDSPWG---PGRP
SYC_THEEB       MAGA-----SGRIEEEEEQ---RKRHPLDFALWKAAK-PEEMSVYHPWEAPWG---KGRP
SYC_GLOVI       EAGA-----SERLQDEELA---RKKDPFDFALWKGAK-PGE----PAWDSPWG---AGRP
SYC_SYNJB       EAGA-----SGRVGEEGAE----KQDPFDFALWKAAP-PSE----PGFASPWG---WGRP
SYC_SYNJA       EAGA-----SGRVGEEGAG----KRDPFDFALWKAAP-PSE----PGFESPWG---WGRP
SYC_SYNS9       QENA-----GGRVADAEGA---RKQHPFDFALWKAAK-EGE----PSFPSPWG---AGRP
SYC_SYNPX       QDNA-----AGRVADAEEA---RKQHPFDFALWKGAK-PGE----PSFPSPWG---EGRP
SYC_PROMM       QQNA-----DGRVADAEEA---RKQHSFDFALWKGAK-SGE----PSFPSPWG---AGRP
SYC_SYNSC       QQGA-----SGRTADGEES---RKRHPFDFALWKGAK-AGE----PSWESPWG---PGRP
SYC_PROMA       QLNA-----DGRVTDKEEA---RKQNPFDFALWKAAK-EGE----QSFPSPWG---AGRP
SYC_PROMT       IDNA-----AGRLKTNQKE---SKKNSLDFALWKKSN-SGE----VSYSSPWG---NGRP
SYC_PROM9       NINK-----QGRMANEENN---KKQNPQDFALWKKAK-NDE----PFFDSPWG---RGRP
SYC_PROMP       NINQ-----QGRITTDESN---KKENPQDFALWKKAK-DNE----PSFDSPWG---KGRP
SYC_AQUAE       IAGA-----RVEPS------E-KKRDPLDFALWKASK-AGE----PAWDSPWG---KGRP
SYC_THEMA       IAGA-----RVEVD------E-TKKSPLDFSLWKKAK-PGE----PCWKSPWG---EGRP
SYC_BACAN       RHGA-----RIEVG------E-KKQDPLDFALWKAAK-EGE----IFWESPWG---QGRP
SYC_BACHK       RHGA-----RIEVG------E-KKQDPLDFALWKAAK-EGE----IFWESPWG---QGRP
SYC_BACCZ       RHGA-----RIEVG------E-KKQDPLDFALWKAAK-EGE----IFWESPWG---QGRP
SYC_BACC1       RHGA-----RIEVG------E-KKQDPLDFALWKAAK-EGE----IFWESPWG---QGRP
SYC_BACCR       RHGA-----RIEVG------E-KKQDPLDFALWKAAK-EGE----IFWESPWG---QGRP
SYC_BACLD       RSGA-----RIQVG------E-KKEDALDFTLWKAAK-DNE----ISWDSPWG---KGRP
SYC_BACSU       RSGA-----RIRVG------E-KKEDALDFALWKAAK-EGE----ISWDSPWG---KGRP
SYC_GEOKA       QAGA-----RIEIG------E-KKDDPLDFALWKAAK-EGE----ICWDSPWG---KGRP
SYC_OCEIH       RSGA-----RIQVG------E-KKEDPLDFALWKQAK-DDE----IAWKSPWG---EGRP
SYC_BACSK       QSGA-----RIEVD------E-RKEDPLDFVLWKAAK-PNE----ISWSSPWG---EGRP
SYC_BACHD       LSGA-----RIEVD------E-RKEDPLDFVLWKAAK-EGE----VSWDSPWG---KGRP
SYC_LISMO       QHGA-----RVEYN------E-RKQDELDFTLWKAAK-PGE----IFWESPFG---NGRP
SYC_LISMF       QHGA-----RVEYN------E-RKQDELDFTLWKAAK-PGE----IFWESPFG---NGRP
SYC_LISIN       QHGA-----RVEYN------E-RKQDELDFTLWKAAK-PGE----IFWESPFG---NGRP
SYC_STAAC       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWDSPFG---EGRP
SYC_STAA3       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWDSPFG---EGRP
SYC_STAAM       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWNSPFG---EGRP
SYC_STAAN       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWNSPFG---EGRP
SYC_STAAS       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWDSPFG---EGRP
SYC_STAAW       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWDSPFG---EGRP
SYC_STAAB       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWDSPFG---EGRP
SYC_STAAR       KVGA-----RIDAG------E-HKEDALDFTLWKKAK-PGE----ISWDSPFG---EGRP
SYC_STAES       KVGA-----RIEAG------E-QKEDALDFTLWKKAK-PGE----ISWNSPFG---KGRP
SYC_STAEQ       KVGA-----RIEAG------E-QKEDALDFTLWKKAK-PGE----ISWNSPFG---KGRP
SYC_STAHJ       KVGA-----RIEAG------E-QKEDALDFTLWKKAK-PGE----ISWESPFG---EGRP
SYC_STAS1       KVGA-----RIEQG------E-QKEDALDFTLWKQAK-PGE----ISWESPFG---EGRP
SYC_LACPL       EVGA-----SQHTAD--EETD-RKEDPIDFALWKAAK-PGE----ISWESPWG---AGRP
SYC_LACSS       EQGA-----SEHTAT--EETL-RKEDPIDFALWKAEK-GNE----IAWESPWG---KGRP
SYC_ENTFA       EVGA-----SQRTGV--EQQL-K-EDPLDFALWKSAK-EDE----ISWDSPWG---KGRP
SYC_LACAC       EEGA-----SEHIND--EEQN-RKEDPIDFALWKAQKGPDE----IAWDSPWG---KGRP
SYC_LACJO       EEGA-----SEHINE--EEQS-KKEDPIDFALWKAQKEEDE----IAWDSPWG---KGRP
SYC_STRA1       EIGA-----SGRVD---GEGE-IKENPLDFALWKSAK-SGE----VSWESPWG---KGRP
SYC_STRA5       EIGA-----SGRVD---GEGE-IKENPLDFALWKSAK-SGE----VSWESPWG---KGRP
SYC_STRA3       EIGA-----SGRVD---GEGE-IKENPLDFALWKSAK-SGE----VSWESPWG---KGRP
SYC_STRPM       EVGA-----SGRTD---AETA-LKENPLDFALWKSAK-AGE----VSWDSPWG---FGRP
SYC_STRP3       EVGA-----SGRTD---AETA-LKENPLDFALWKSAK-AGE----VSWDSPWG---FGRP
SYC_STRP8       EVGA-----SGRTD---AETA-LKENPLDFALWKSAK-AGE----VSWDSPWG---FGRP
SYC_STRP6       EVGA-----SGRTD---AETA-LKENPLDFALWKSAK-AGE----VSWDSPWG---FGRP
SYC_STRP1       EVGA-----SGRTD---AETA-LKENPLDFALWKSAK-AGE----VSWDSPWG---FGRP
SYC_STRT2       EIGA-----SGRTD---AETD-RKEDPLDFALWKAAK-EGE----ISWESPWG---PGRP
SYC_STRT1       EIGA-----SGRTD---AETD-RKEDPLDFALWKAAK-EGE----ISWESPWG---PGRP
SYC_STRMU       EIGA-----SGRVD---AESD-CKEDPLDFALWKAAK-EGE----IAWDSPWG---AGRP
SYC_STRPN       ELGA-----SGRTD---EETA-RKENPVDFALWKSSK-PGE----ISWDSPWG---PGRP
SYC_STRR6       ELGA-----SGRTD---EETA-RKENPVDFALWKSSK-PGE----ISWDSPWG---PGRP
SYC_LACLA       LAGA-----SGRTD---EETK-LKESPADFALWKSAK-ADE----VSWQAPWG---AGRP
SYC_CLOPE       QSGA-----RISVD------E-RKKDPMDFAIWKAQK-PGE----PAWNSPWG---MGRP
SYC_CLOTE       QAGA-----RINVD------E-RKKDAMDFAIWKKQK-PGE----PAWESPWG---MGRP
SYC_CLOAB       MAGA-----TIAVD------D-RKKSPADFALWKSEK-PGE----PSWESPWG---KGRP
SYC_CALS4       MAGA-----RVEID------E-KKKNPLDFALWKAQK-PGE----PAWDSPWG---KGRP
SYC_SYMTH       VAGA-----SERVDP--D--D-RKEHPFDFALWKGQK-PGE----PAWPAPWG---PGRP
SYC_CARHZ       KAGA-----RVEVD------E-KKKNPLDFALWKKAK-PGE----PYWESPWG---PGRP
SYC_MOOTA       RAGA-----RVEVN------T-SKRNPLDFALWKAAC-PGE----PSWESPWG---PGRP
SYC_FUSNN       ESGA-----RIDVN------E-IKRDALDFALWKASK-PNE----PSWDSPWG---KGRP
SYC_DEHM1       MAGA-----RIEPG------E-EKEYPMDFALWKATK-PGE----PSWESPWG---LGRP
SYC_DEHMC       MAGA-----RVEID------E-EKEYPMDFALWKATK-PGE----PSWESPWG---LGRP
SYC_BDEBA       LAGA-----RVEVD------E-KKRNPMDFALWKAAK-PGE----VSWPSPWG---PGRP
SYC_COREF       EQGE-------TDN-------FGKRGPQDFALWKAAKPGEP-----SWPTPWG---EGRP
SYC_CORGL       EQGE-------PDN-------FGKRGPQDFALWKAAKPGEP-----SWPTPWG---DGRP
SYC_CORDI       EQGE-------TEI-------TGKRGAHDFALWKAAKPGEP-----SWPTPWG---DGRP
SYC_CORJK       DQGE-------SAG-------TGKRDPRDFTMWKAAKPGEP-----AWDTPWG---RGRP
SYC_MYCBO       HQGE-------GVA-------AGKRDQRDFTLWKGEKPGEP-----SWPTPWG---RGRP
SYC_MYCTU       HQGE-------GVA-------AGKRDQRDFTLWKGEKPGEP-----SWPTPWG---RGRP
SYC_MYCPA       HQGE-------GVA-------SGKRDQRDFTLWKGAKPGEP-----SWPTPWG---RGRP
SYC_MYCLE       HQGE-------GVT-------TGKRDQRDFTLWKGAKSGEP-----SWPTPWG---RGRP
SYC_NOCFA       HQGE-------SAG-------EGKRDPRDFTLWKAAKPGEP-----SWPSPWG---PGRP
SYC_STRAW       LQPS-------GEGE------TGKRDPRDFAMWKAAKPGEP-----TWETPWG---RGRP
SYC_THEFY       RAAE-------DGDA------RAKRDPRDFALWKGARPGEP-----SWPTPWG---PGRP
SYC_LEIXX       EAAA-------DADP------RAKRDGRDFALWKGRKADEPD--SAAFPSPWG---EGRP
SYC_CUTAK       SPAE-------DSDP------RGKRDPRDFALWKGHKEDEPE--TASWVSPWG---RGRP
SYC_BIFLO       NPVD-------PADAS-----PDKHDPRDFALWKAPKDTDPE--DARWSTPFG---VGRP
SYC1_TROW8      LIDD-------CITP-------GKRDPRDFTLWKEKKDTDPD--LAFWESPWG---PGRP
SYC1_TROWT      LIDD-------CITP-------GKRDPRDFTLWKEKKDTDPD--LAFWESPWG---PGRP
SYC_FRACC       QPSV-------EAEP-------GKADPRDFALWKAARPGEP-----FWSSPWG---DGRP
SYC_RHOBA       QQGE-------GGGAA-----AKKRNPGDFALWKSARPGEP-----FWDSPWG---EGRP
SYC_BACFR       LNTTR----ELDGQEE-------KHNPADFALWKRAQ--P--EHIMRWPSPWG---DGFP
SYC_BACFN       LNTTR----ELDGQEE-------KHNPADFALWKRAQ--P--EHIMRWPSPWG---DGFP
SYC_BACTN       LNTTR----DLDGQSE-------KRNPADFALWKKAQ--P--EHIMRWPSPWS---DGFP
SYC_PORGI       INNTR----RLDGQDE-------KRNGVDFALWKAAQ--P--EHIMRWPSPWG---MGFP
SYC_CHLCH       LQSGS----RVGIRSE-------KRDASDFALWKKAE--E--GHIMKWQSPWS---VGYP
SYC_PELLD       VQSGA----RVGVRSE-------KHNPSDFALWKKAE--E--GHLMQWDSPWG---MGYP
SYC_CHLTE       LQSGG----RVAERSD-------KRNPSDFALWKKAE--P--GHIMKWQSPWG---EGYP
SYC_THET2       LRAGA----RVEVREE-------KEDPLDFALWKAAE--P--GHIMRWKSPWG---EGYP
SYC_THET8       LRAGA----RVEVREE-------KEDPLDFALWKAAE--P--GHIMRWKSPWG---EGYP
SYC_DEIRA       QEEGT----REAVRDE-------KRDPRDFALWKKAE--P--EHLMRWDSPWS---VGFP
SYC_BORBU       DMT----LPRVDVDKF-------KRNKTDFVLWFTNS--KFKDQEMKWDSPWG---FGYP
SYC_BORBP       DMA----FSRVDIDKF-------KRNKTDFVLWFTNS--KFKDQEMKWDSPWG---FGYP
SYC_TREDE       KAG-----ARIEIDKN-------KRNPHDFVLWFTKS--KFENQALVWDSPWG---RGYP
SYC_TREPA       QEGEDAARARVAHDTH-------KRDARDFVLWFTRS--KFVRHALTWDSPWG---RGYP
SYC_NOVAD       GEG------RIEAVEG-------KRNGADFAIWRKTP--PGEKRQMEWDSPWG---RGAP
SYC_ZYMMO       GVG------RIETVAG-------KKHPADFALWRRSS--PDEKRQMEWISPWG---PGAP
SYC1_BURL3      QAG------KRVALGG-------KRSITDFALWKFSP--ADVQRQMEWDSPWG---RGFP
SYC_SALRD       LQA---TERDVVEDPD-------KRDPRDFALWKHDP-----QHLMHWHSPWG---WGYP
SYC_CHLTR       RN----SARIDADEYD-------KDNLCDFVLWKAYD--PDRDGEIFWESPFG---KGRP
SYC_CHLTA       RN----SARIDADEYD-------KDNLCDFVLWKAYD--PDRDGEIFWESPFG---KGRP
SYC_CHLMU       RQ----SSRIDADEYD-------KDNLCDFVLWKAYD--PNRDGEIFWESPFG---KGRP
SYC_CHLCV       QC----CSRVSSDEYD-------KENLSDFVLWKAYE--EKRDGHIYWESPFG---KGRP
SYC_CHLFF       QC----CSRVTSDEYD-------KENLSDFVLWKAYD--EQRDGHIYWESPFG---KGRP
SYC_CHLAB       QC----CSRIASDEYD-------KENLSDFVLWKAYD--KHRDGHIYWESPFG---KGRP
SYC_CHLPN       RC----CSRISADEYD-------KENPSDFVLWKAYN--PERDGVIYWESPFG---KGRP
SYC_PARUW       QAG--ASERVAADEYE-------KEHVADFVLWKSYD--SERDGQIYWESPFG---LGRP
SYC_LEPIN       KT----GTRYDTDEYE-------KEDVRDFVLWKS----PKLEGETSWDTLVG---TGRP
SYC_LEPIC       KT----GTRYDTDEYE-------KEDVRDFVLWKS----PKLEGETSWYTLVG---TGRP
SYC_CAMJE       ENIS-----RLSNEVQ-------KRNESDFVLWKFD----E----NFYESEFG---KGRP
SYC_CAMJR       ENIS-----RLSNEVQ-------KRNESDFVLWKFD----E----NFYENEFG---KGRP
SYC_HELPY       IEFG-----RIGLVQE-------KRLEQDFVLWKSYKGDND----VGFDSPLG---KGRP
SYC_HELPJ       VEFS-----RIGLVQE-------KRLEQDFVLWKSYKGDND----VGFDSPLG---KGRP
SYC_HELHP       HTQS-----RIQNAQD-------KLEHNDFALWKGYKGEND----IAYDSPFG---KGRP
SYC_WOLSU       EQVS-----RIESSEE-------KRDPRDFALWKSYKGQSD----VGYESPFG---RGRP
SYC_SULDN       EKLQ-----RVQSSSQ-------KRNPADFALWKSIHDES-----VTFGSPFG---KGRP
SYC_AYWBP       KQNV-----RKQLDPQ-------KEFPGDFILWKKTS------QGITYPSPWF---AGRP
SYC_ONYPE       KQNA-----RKQLDPQ-------KEFPGDFILWKKTS------QGITYPSPWF---AGRP
SYC_MYCCT       ISGK-----RIEIDSK-------KKYSLDFSLWKKTQ------IGIKWDSFFG---LGRP
SYC_MYCMS       ISGK-----RVEIDSK-------KHYSLDFSLWKKTD------IGIKWDSVFG---LGRP
SYC_MESFL       ISGN-----RVEIEDK-------KNNPLDFSVWKKTE------KGITFDSNFG---KGRP
SYC_MYCGA       ISGI-----RVKSNEN-------KTSPNDFVLWKKTV------EGIKWNSRFG---LGRP
SYC_UREPA       IVGM-----RIESAAN-------KHNPNDFILWKKTN------KGIMWNTPWG---IGRP
SYC_MYCPE       LVGD-----KSEDNLK-------KNNPQDFALWKQTT------IGLNWDLKFS---TGRP
SYC_MYCH2       LDKN-----T-KKTKS-------KN---DFVLWKKTQ------KGLFFKSFFG---LGRP
SYC_MYCMO       LDGD-----D-DFKNE-------KNNPHDFVLWKKTK------VGITWKSPWS---EGRP
SYC_MYCGE       ---------LEETDTD-------KKNKLDFVLWKITT------AGIKWNSKWG---LGRP
SYC_MYCPN       ---------IEDEATD-------KRNKLDFVLWKQTT------AGVKWNSPWG---WGRP
                                            ** :*              :         * *

SYC_AGRFC       GWHIECSAMAGRYL--------------GEVFDIHGGGLDLIFPHHENEIAQSRCAHGTH
SYC_RHIEC       GWHIECSAMSRRYL--------------GDIFDIHGGGLDLIFPHHENEIAQSRCAHGTE
SYC_RHIME       GWHIECSAMSGRYL--------------GDVFDIHGGGIDLIFPHHENEIAQSRCAHGTE
SYC_RHILO       GWHIECSAMSAAYL--------------GEVFDIHGGGLDLIFPHHENEIAQSRCAHGTS
SYC_NITWN       GWHIECSAMSTAYL--------------GDVFDIHGGGLDLIFPHHENEIAQSRCAHGTH
SYC_BARHE       GWHIECSAMSMAKLLAPYGGGLTCDDPTENVFDIHGGGLDLIFPHHENEIAQSCSAFGTE
SYC_BARQU       GWHIECSAMSMAKLLAPYGGGLTCDDPTANVFDIHGGGIDLIFPHHENEIAQSCSAFGTE
SYC_BRUAB       GWHIECSAMSMAKLLEPFGGGLKCDDPERNQFDIHGGGIDLVFPHHENEIAQSCCALGTE
SYC_BRUA2       GWHIECSAMSMAKLLEPFGGGLKCDDPERNQFDIHGGGIDLVFPHHENEIAQSCCALGTE
SYC_BRUME       GWHIECSAMSMAKLLEPFGGGLKCDDPERNQFDIHGGGIDLVFPHHENEIAQSCCALGTE
SYC_BRUSU       GWHIECSAMSMAKLLEPFGGGLKCDDPERNQFDIHGGGIDLVFPHHENEIAQSCCALGTE
SYC_RHOPA       GWHIECSAMSWKHL--------------GETFDIHGGGIDLVFPHHENEVAQSCCAFHTE
SYC_RHOP2       GWHIECSAMSWKHL--------------GETFDIHGGGIDLVFPHHENEVAQSCCAFQTD
SYC_RHOPB       GWHIECSAMAWKHL--------------GEKFDIHGGGIDLVFPHHENEVAQSCCAFHTD
SYC_BRADU       GWHIECSAMAWKHL--------------GEYFDIHGGGIDLVFPHHENEVAQTCCAFHRE
SYC_JANSC       GWHIECSAMAHALL--------------GEQFDIHGGGADLMFPHHENEVAQSCAAGHG-
SYC_RUEPO       GWHIECSAMSYELL--------------GESFDIHGGGNDLMFPHHENEIAQSCCAHPEG
SYC_RHOS4       GWHIECSAMSYELL--------------GATFDIHAGGIDLQFPHHENEIAQSCCAHPEG
SYC_ANAMM       GWHVECSAMSYRYL--------------GDSFDIHGGGADLMFPHHENEISQSCCAFPGS
SYC_ANAPZ       GWHIECSAMSYRYL--------------GESFDIHGGGADLMFPHHENELAQNMCAFSGS
SYC_EHRCJ       GWHIECSAMSYCYL--------------SENFDIHGGGADLQFPHHENEIAQSCCAFPGS
SYC_EHRCR       GWHIECSAMSYRYL--------------KENFDIHGGGADLQFPHHENEIAQSCCAFPDS
SYC_EHRRG       GWHIECSAMSYNYL--------------GENFDIHGGGADLQFPHHENELAQSCCAFPNS
SYC_EHRRW       GWHIECSAMSYNYL--------------GENFDIHGGGADLQFPHHENELAQSCCAFPNS
SYC_WOLPM       GWHIECSAMSYAYL--------------GKDFDIHGGGIDLQFPHHENEIAQSKSAFAGS
SYC_WOLTR       GWHIECSAMSYAYL--------------GKDFDIHGGGIDLQFPHHENEIAQNKSAFAGS
SYC_NEOSM       GWHIECSAMTLATL--------------GADFDIHGGGADLKFPHHENERAQSMCANPGS
SYC_RICCN       GWHIECSAMSYKYL--------------GENFDIHGGGADLIFPHHTNEIAQSRCAFPSS
SYC_RICFE       GWHIECSAMSYKYL--------------GENFDIHGGGADLIFPHHTNEIAQSRCAFPDS
SYC_RICPR       GWHIECSAMSYKYL--------------GQNFDIHGGGADLIFPHHTNEIAQSRCAFPSS
SYC_RICTY       GWHIECSAMSYKYL--------------GENFDIHGGGADLIFPHHTNEIAQSRCAFPSS
SYC_RICBR       GWHIECSAMSYKYL--------------GKNFDIHGGGADLIFPHHTNEIAQSKCAFSNS
SYC_PELUB       GWHLECSAMSKKYL--------------GNVFDIHGGGIDLIFPHHENEIAQSRCANDSK
SYC_XANOR       GWHIECSAMAAAHL--------------GPTIDIHAGGVDLQFPHHENEIAQSECAHGGA
SYC_XANOM       GWHIECSAMAAAHL--------------GPTIDIHAGGVDLQFPHHENEIAQSECAHGGA
SYC_XANAC       GWHIECSAMAAAHL--------------GPTIDIHAGGVDLQFPHHENEIAQSECAHGGA
SYC_XANC5       GWHIECSAMAAAHL--------------GPTIDIHAGGVDLQFPHHENEIAQSECAHGGA
SYC_XANCP       GWHIECSAMAATHL--------------GPTIDIHAGGVDLQFPHHENEIAQSECAHGGA
SYC_XANC8       GWHIECSAMAATHL--------------GPTIDIHAGGVDLQFPHHENEIAQSECAHGGA
SYC_XYLFA       GWHIECSAMAAAHL--------------GETIDIHAGGIDLQFPHHENEIAQSRCAHGSS
SYC_XYLFT       GWHIECSAMAAAHL--------------GETIDIHAGGIDLQFPHHENEIAQSRCAHGSS
SYC_CAUVC       GWHIECSAMIDKAL--------------GQTIDIHAGGIDLTFPHHENEVAQSRCAHKTS
SYC_MAGSA       GWHIECSAMSLQHL--------------GETFDIHGGGQDLVFPHHENEIAQSTCANGK-
SYC_RHORT       GWHIECSAMSSRYL--------------GPSFDIHGGGLDLIFPHHENEIAQSVCCNGPG
SYC_GLUOX       GWHIECSAMSHRYL--------------GESFDIHGGGDDLLFPHHENERAQSMCCYPHG
SYC_SACD2       GWHLECSAMIETHL--------------GNTIDIHGGGRDLIFPHHENELAQSECAHGGE
SYC_PSYA2       GWHIECSAMSTKCL--------------GNTFDIHGGGHDLQFPHHENEIAQSEAATGC-
SYC_PSYCK       GWHIECSAMSTKCL--------------GNTFDIHGGGHDLQFPHHENEIAQSEAATGC-
SYC_ACIAD       GWHIECSAMSTCCL--------------GNHFDIHGGGSDLTFPHHENEIAQSEASTGE-
SYC_PSEF5       GWHIECSVMSTCCL--------------GETFDIHGGGSDLEFPHHENEIAQSEAATGK-
SYC_PSEPF       GWHIECSVMSTCCL--------------GETFDIHGGGSDLEFPHHENEIAQSEAATGK-
SYC_PSE14       GWHIECSVMSTCCL--------------GDTFDIHGGGSDLEFPHHENEIAQSEAATGK-
SYC_PSEU2       GWHIECSVMSTCCL--------------GETFDIHGGGSDLEFPHHENEIAQSEAATGK-
SYC_PSESM       GWHIECSVMSTCCL--------------GDTFDIHGGGSDLEFPHHENEIAQSEAATGK-
SYC_PSEPK       GWHIECSVMSTCCL--------------GESFDIHGGGSDLEFPHHENEIAQSEAATGK-
SYC_PSEAE       GWHIECSVMSTCCL--------------GDSFDIHGGGNDLEFPHHENEIAQSEAATGK-
SYC_HAHCH       GWHIECSAMSTRCL--------------GDTFDIHGGGPDLKFPHHENEIAQSEAATGC-
SYC_BURMA       GWHIECSAMGCTLL--------------GAHFDIHGGGQDLQFPHHENEIAQSEGATGQ-
SYC_BURPS       GWHIECSAMGCTLL--------------GAHFDIHGGGQDLQFPHHENEIAQSEGATGQ-
SYC_BURP1       GWHIECSAMGCTLL--------------GAHFDIHGGGQDLQFPHHENEIAQSEGATGQ-
SYC_BURTA       GWHIECSAMGCTLL--------------GEHFDIHGGGQDLQFPHHENEIAQSEGATGQ-
SYC2_BURL3      GWHIECSAMGCTLL--------------GEHFDIHGGGQDLQFPHHENEIAQSEGATGQ-
SYC_CUPPJ       GWHIECSAMSCTLL--------------GEHFDIHGGGADLQFPHHENEIAQSEGASGK-
SYC_RALSO       GWHIECSAMSCDLL--------------GTHFDLHGGGADLQFPHHENEIAQSEGASGS-
SYC_DECAR       GWHIECSAMSSKLL--------------GQHFDIHGGGQDLQFPHHENEIAQSEGANCC-
SYC_AROAE       GWHIECSAMSSDLL--------------GEQFDIHGGGQDLQFPHHENEIAQSEGAHGH-
SYC_THIDA       GWHIECSAMSAELL--------------GQHFDIHGGGQDLQFPHHENEIAQSEGAHGC-
SYC_NEIG1       GWHIECSAMSENLF--------------GDTFDIHGGGADLQFPHHENEIAQSVGASGHT
SYC_NEIMB       GWHIECSAMSENLF--------------GDTFDIHGGGADLQFPHHENEIAQSVGATGHT
SYC_CHRVO       GWHIECSVMSCHHL--------------GEHFDIHGGGEDLQFPHHENEIAQSEGAHGH-
SYC_NITEU       GWHIECSAMSEHYL--------------GDQFDIHGGGQDLQFPHHENEIAQSEGVHGH-
SYC_NITMU       GWHIECSAMGEHYL--------------GEHFDIHGGGQDLQFPHHENEIAQSEGAHGH-
SYC_BORBR       GWHIECSAMSKTLL--------------GLPLDIHGGGPDLKFPHHENEIAQTEGAFGG-
SYC_BORPA       GWHIECSAMSKTLL--------------GLPLDIHGGGPDLKFPHHENEIAQTEGAFGG-
SYC_BORPE       GWHIECSAMSKTLL--------------GLPLDIHGGGPDLKFPHHENEIAQTEGAFGG-
SYC_BORA1       GWHIECSAMSKSLL--------------GLPLDIHGGGPDLKFPHHENEIAQTEGAFGG-
SYC_RHOFT       GWHIECSAMCGQML--------------GETVDIHGGGADLQFPHHENEIAQSEGATGK-
SYC_METCA       GWHIECSAMSTRCL--------------GAHFDIHGGGMDLQFPHHENEIAQSEGATGE-
SYC_NITOC       GWHIECSAMSIQEL--------------GTHFDIHGGGQDLQFPHHENEIAQSEAATGG-
SYC_HYDCU       GWHIECSAMSTKCL--------------GNHFDIHGGGLDLSFPHHENEIAQSECATGE-
SYC_LEGPL       GWHIECSAMAMHEL--------------GEQFDIHGGGLDLQFPHHENEIAQSEAATGK-
SYC_LEGPA       GWHIECSAMAMHEL--------------GEQFDIHGGGLDLQFPHHENEIAQSEAATGK-
SYC_LEGPH       GWHIECSAMAMHEL--------------GEQFDIHGGGLDLQFPHHENEIAQSEAATGK-
SYC_BLOFL       GWHIECSAISHAFL--------------GKHIDIHGGGSDLVFPHHENEIAQSTCAHHIT
SYC_BLOPB       GWHIECSAMNYSIF--------------GNQIDIHGGGSDLIFPHHDNEIAQSVCAHE--
SYC_BUCAI       GWHIECSAITNVFF--------------NNSIDIHGGGSDLLFPHHENERSQSICFNN--
SYC_BUCAP       GWHIECTAITNVFF--------------KDYIDIHGGGSDLLFPHHENEISQSRCLNK--
SYC_BUCBP       GWHIECSSMCRSAF--------------KNKIDIHGGGVDLLFPHHENELAQSVCIDS--
SYC_WIGBR       GWHIECSAISDKTL--------------GNIFDIHGGGSDLIFPHHENEIAQSKCANS--
SYC_COLP3       GWHIECSAMNAKEL--------------GHHFDIHGGGSDLTFPHHENEIAQSCCALN--
SYC_PSET1       GWHIECSAMSSKHL--------------GEHFDIHGGGSDLQFPHHENEIAQSCCANN--
SYC_IDILO       GWHIECSAMNKKHL--------------GSTFDIHGGGSDLSFPHHENEIAQSCCANQ--
SYC_ECOL6       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SHIFL       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_ECOLI       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_ECO57       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SHISS       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SHIBS       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SHIDS       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SALCH       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SALTY       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SALPA       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_SALTI       GWHIECSAMNCKQL--------------GNHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_PECAS       GWHIECSAMNCKQL--------------GEHFDIHGGGSDLMFPHHENEIAQSCCAHD--
SYC_YERPE       GWHIECSAMNGKQL--------------GAHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_YERPS       GWHIECSAMNGKQL--------------GAHFDIHGGGSDLMFPHHENEIAQSTCAHD--
SYC_PHOLL       GWHIECSAMNSKQL--------------GNHFDIHGGGADLMFPHHENEIAQSTCAHD--
SYC_SODGM       GWHIECSAMNGRQL--------------GHHFDIHGGGSDLIFPHHENEIAQSTCAHD--
SYC_VIBVU       GWHIECSAMNSSIL--------------GNHFDIHGGGSDLQFPHHENEIAQSCCAHD--
SYC_VIBVY       GWHIECSAMNSSIL--------------GNHFDIHGGGSDLQFPHHENEIAQSCCAHD--
SYC_VIBPA       GWHIECSAMNSTIL--------------GDHFDIHGGGSDLQFPHHENEIAQSCCAHD--
SYC_VIBCH       GWHIECSAMNSSIL--------------GTHFDIHGGGSDLQFPHHENEIAQSCCAHD--
SYC_ALIF1       GWHIECSAMNSSIL--------------GDHFDIHGGGSDLMFPHHENEIAQSCCAHD--
SYC1_PHOPR      GWHIECSAMNSAIL--------------GDHFDIHGGGSDLQFPHHENEIAQSCCATG--
SYC_SHEON       GWHIECSAMNSKHL--------------GLHFDIHGGGSDLQFPHHENEIAQSCCAHD--
SYC_HAEDU       GWHIECSAMNNKEL--------------GEHFDIHGGGADLMFPHHENEIAQSCCAHQ--
SYC_MANSM       GWHIECSAMNDKEL--------------GNHFDIHGGGSDLMFPHHENEIAQSCCAHD--
SYC_HAEIN       GWHIECSAMNCKQL--------------GEYFDIHGGGSDLMFPHHENEIAQSCCAHG--
SYC_HAEI8       GWHIECSAMNCKQL--------------GEHFDIHGGGSDLMFPHHENEIAQSCCAHG--
SYC_PASMU       GWHIECSAMNHKEL--------------GEHFDIHGGGSDLTFPHHENEIAQSCCAHS--
SYC_FRATH       GWHIECSAMSKKLL--------------GDTFDIHAGGSDLRFPHHENEIAQSEACNE--
SYC_FRATT       GWHIECSAMSKKLL--------------GDTFDIHAGGSDLRFPHHENEIAQSEACNE--
SYC_COXBU       GWHIECSAMSSSIL--------------GQPFDIHGGGLDLKFPHHENEIAQSEAGEE--
SYC_DESAG       GWHIECSAMSEKHL--------------PLPLDIHGGGQDLVFPHHENEIAQTEAATG--
SYC_DESVH       GWHIECSAMSEKHM--------------PLPLDIHGGGQDLIFPHHENEIAQTEAALD--
SYC_ANADE       GWHIECSAMTQKHL--------------GAPIDLHAGGKDLVFPHHTNEIAQSVAATSDG
SYC_GEOMG       GWHIECSAMSMKYL--------------GETFDIHGGGKDLVFPHHENEIAQSEAANG--
SYC_GEOSL       GWHIECSAMSMKYL--------------GETFDIHGGGKDLVFPHHENEIAQSEAANG--
SYC_PELCD       GWHIECSAMSMEYL--------------GESFDIHGGGKDLVFPHHENEIAQSEGATG--
SYC_DESPS       GWHIECSAMSRKYL--------------GENFDIHGGGKDLIFPHHENEIAQSEGANG--
SYC_NOSS1       GWHIECSAMIRSKL--------------GATIDIHGGGGDLIFPHHENEIAQSEAAMN--
SYC_TRIV2       GWHIECSAMIRSKL--------------GATIDIHGGGGDLIFPHHENEIAQSEAAMN--
SYC_SYNY3       GWHIECSAMVREFL--------------GETIDLHVGGNDLIFPHHENEIAQSEAVTG--
SYC_SYNP6       GWHIECSAMVRDRL--------------GDSIDIHVGGADLVFPHHENEIAQSEAVTG--
SYC_SYNE7       GWHIECSAMVRDRL--------------GDSIDIHVGGADLVFPHHENEIAQSEAVTG--
SYC_THEEB       GWHIECSAMVRQAF--------------GATVDIHCGGMDLIFPHHENEIAQSEAVTQ--
SYC_GLOVI       GWHIECSAMVRKSL--------------GETIDIHAGGEDLQFPHHENEIAQSEAVTG--
SYC_SYNJB       GWHIECSAMVRETL--------------GDHIDIHAGGADLIFPHHENELAQSEPITG--
SYC_SYNJA       GWHIECSAMVRETL--------------GDHIDIHAGGADLIFPHHENELAQSEPITG--
SYC_SYNS9       GWHIECSAMVRAEL--------------GDTIDIHLGGADLVFPHHENEIAQSEAATG--
SYC_SYNPX       GWHIECSAMVRAEL--------------GDTIDIHLGGADLVFPHHENEIAQSEAATG--
SYC_PROMM       GWHIECSAMVREEL--------------GETIDIHLGGADLIFPHHENEIAQSEAATG--
SYC_SYNSC       GWHIECSAMVRQEL--------------GQTIDIHLGGGDLVFPHHENEIAQSETANG--
SYC_PROMA       GWHIECSAMVLQEL--------------GETIDIHLGGADLIFPHHENEIAQSEVANG--
SYC_PROMT       GWHIECSAMVKQEL--------------GESIDIHLGGSDLIFPHHENEIAQSEACNG--
SYC_PROM9       GWHIECSAMVKDEL--------------GDTIDIHLGGSDLIFPHHENEIAQSEAANG--
SYC_PROMP       GWHIECSAMVKDEL--------------GETIDIHLGGSDLIFPHHENEIAQSESANN--
SYC_AQUAE       GWHTECVAMVFKHL--------------GETIDIHGGGLDLVFPHHENEIAQAEAITG--
SYC_THEMA       GWHIECTVMSVKIL--------------GESFDIHAGGEDLVFPHHENEKAQAEALTG--
SYC_BACAN       GWHIECSAMARKYL--------------GDTIDIHAGGQDLAFPHHENEIAQSEALTG--
SYC_BACHK       GWHIECSAMARKYL--------------GDTIDIHAGGQDLAFPHHENEIAQSEALTG--
SYC_BACCZ       GWHIECSAMARKYL--------------GDTIDIHAGGQDLAFPHHENEIAQSEALTG--
SYC_BACC1       GWHIECSAMARKYL--------------GDTIDIHAGGQDLAFPHHENEIAQSEALTG--
SYC_BACCR       GWHIECSAMARKYL--------------GDTIDIHAGGQDLAFPHHENEIAQSEALTG--
SYC_BACLD       GWHIECSAMARKYL--------------GDSIDIHAGGQDLAFPHHENEIAQSEALTG--
SYC_BACSU       GWHIECSAMVKKYL--------------GDQIDIHAGGQDLTFPHHENEIAQSEALTG--
SYC_GEOKA       GWHIECSAMARKYL--------------GDTIDIHAGGQDLTFPHHENEIAQSEALTG--
SYC_OCEIH       GWHIECSAMVKKHL--------------GDTIDIHAGGQDLTFPHHENEIAQSEAMNG--
SYC_BACSK       GWHIECSAMIKKSL--------------GDTIDIHAGGKDLTFPHHENEIAQSEALTG--
SYC_BACHD       GWHIECSAMVKKYL--------------GDTIDIHAGGQDLKFPHHENEIAQSECMTG--
SYC_LISMO       GWHIECSALAKKYL--------------GDTIDIHAGGQDLVFPHHEDEIAQSEAATG--
SYC_LISMF       GWHIECSALAKKYL--------------GDTIDIHAGGQDLVFPHHEDEIAQSEAATG--
SYC_LISIN       GWHIECSALAKKYL--------------GDTIDIHAGGQDLVFPHHEDEIAQSEAATG--
SYC_STAAC       GWHIECSVMAFHEL--------------GPTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAA3       GWHIECSVMAFHEL--------------GPTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAAM       GWHIECSVMAFHEL--------------GPTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAAN       GWHIECSVMAFHEL--------------GPTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAAS       GWHIECSVMAFHEL--------------GPTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAAW       GWHIECSVMAFHEL--------------GPTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAAB       GWHIECSVMAFHEL--------------GPTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAAR       GWHIECSVMAFHEL--------------GATIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAES       GWHIECSVMAYHEL--------------GSTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAEQ       GWHIECSVMAYHEL--------------GSTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAHJ       GWHIECSVMAFHEL--------------GKTIDIHAGGSDLQFPHHENEIAQSEAHNH--
SYC_STAS1       GWHIECSVMAYHEL--------------GATIDIHAGGTDLQFPHHENEIAQSEAHNH--
SYC_LACPL       GWHIECSVMSTKYL--------------GDTFDIHGGGQDLEFPHHENEIAQSEAKTG--
SYC_LACSS       GWHIECSVMSTKYL--------------GDTIDIHGGGQDLEFPHHENEIAQSEAKTG--
SYC_ENTFA       GWHIECSVMATKHL--------------EETIDIHGGGQDLEFPHHENEIAQSEAKTG--
SYC_LACAC       GWHIECSVMSTKYL--------------GNTIDIHGGGQDLEFPHHENEIAQSEAKTD--
SYC_LACJO       GWHIECSVMSTKYL--------------GDTIDIHGGGQDLEFPHHENEIAQSEAKTG--
SYC_STRA1       GWHIECSVMATEIF--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRA5       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRA3       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRPM       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRP3       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRP8       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRP6       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRP1       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRT2       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRT1       GWHIECSVMATEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRMU       GWHIECSVMATTIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRPN       GWHIECSVMSTEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_STRR6       GWHIECSVMSTEIL--------------GDTIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_LACLA       GWHIECSVMSTSLL--------------GETIDIHGGGADLEFPHHTNEIAQSEAKTG--
SYC_CLOPE       GWHIECSCMAKKLL--------------GETIDIHAGGSDLKFPHHENEIAQSEALTG--
SYC_CLOTE       GWHIECSCMAHNLL--------------GDTIDIHAGGHDLIFPHHENEIAQSECRTG--
SYC_CLOAB       GWHIECSCMARDLL--------------GDTIDIHAGAIDLIFPHHENEIAQSEARTG--
SYC_CALS4       GWHIECSVMSTKYL--------------GKTLDIHAGGPDLIFPHHENEIAQSEAAYD--
SYC_SYMTH       GWHIECSAMARKYL--------------GDTIDIHAGGEDLTFPHHENEIAQSEAVTG--
SYC_CARHZ       GWHIECSAMSLKYL--------------GENFDIHGGGADLVFPHHENEVAQSEAFTG--
SYC_MOOTA       GWHIECSTMALKYL--------------GPGFDIHGGGADLIFPHHENEIAQAEAQTG--
SYC_FUSNN       GWHIECSAMSRKYL--------------GDSFDIHGGGLDLIFPHHENEMAQSKCGCG--
SYC_DEHM1       GWHIECSAMSLRYL--------------GEQIDIHGGGQDLIFPHHENEIAQSECFSGV-
SYC_DEHMC       GWHIECSAMSLRYL--------------GEQIDIHGGGQDLIFPHHENEIAQSECFSGV-
SYC_BDEBA       GWHIECSAMIKNLF--------------GDQIDIHGGGMDLIFPHHENEIAQSEGCTG--
SYC_COREF       GWHLECSAMATYYL--------------GAEFDIHCGGLDLQFPHHENEIAQAHAAGDG-
SYC_CORGL       GWHLECSAMATYYL--------------GEQFDIHCGGLDLQFPHHENEIAQAHAAGDK-
SYC_CORDI       GWHLECSAMATWYL--------------GGEFDIHCGGLDLQFPHHENEIAQSHAAGDG-
SYC_CORJK       GWHIECSAMATTYL--------------GSEFDIHCGGLDLQFPHHENEAAQATAAGDG-
SYC_MYCBO       GWHLECSAMARSYL--------------GPEFDIHCGGMDLVFPHHENEIAQSRAAGDG-
SYC_MYCTU       GWHLECSAMARSYL--------------GPEFDIHCGGMDLVFPHHENEIAQSRAAGDG-
SYC_MYCPA       GWHTECVAMAHEYL--------------GPEFDIHCGGMDLVFPHHENEIAQSRAAGDG-
SYC_MYCLE       GWHLECSAMARAYL--------------GSEFDIHCGGMDLVFPHHENEIAQSRAVGDG-
SYC_NOCFA       GWHLECSAMAEFYL--------------GAEFDIHCGGMDLVFPHHENEIAQSKAAGDG-
SYC_STRAW       GWHLECSAMAHKYL--------------GSAFDIHGGGLDLIFPHHENEIAQAKAFGDE-
SYC_THEFY       GWHLECSAMATKYL--------------GPTFDIHGGGVDLVFPHHENESAQSRAAGDG-
SYC_LEIXX       GWHIECSAMSRRYL--------------GPRFDIHGGGLDLRFPHHENELAQSAAAGDS-
SYC_CUTAK       GWHLECSAMSGKYL--------------GEAFDIHGGGIDLRFPHHENELAQSAAAGRP-
SYC_BIFLO       GWHIECSAMSHRYL--------------GDGFDIHGGGLDLRFPHHENEMAQTCAAGYP-
SYC1_TROW8      GWHIECSVMATKYL--------------GTRFAIHGGGVDLRFPHHENELAQARALGAH-
SYC1_TROWT      GWHIECSVMATKYL--------------GTRFAIHGGGVDLRFPHHENELAQARALGAH-
SYC_FRACC       GWHLECSAMAGKYL--------------GPVFDIHGGGLDLVFPHHENERAQTVCAATAR
SYC_RHOBA       GWHIECSAMSHEIL--------------GETFDIHGGGLDLMFPHHENERAQSTCCHGA-
SYC_BACFR       GWHAECTAMGRKYL--------------GEHFDIHGGGMDLIFPHHECEIAQSVASQGDD
SYC_BACFN       GWHAECTAMGRKYL--------------GEHFDIHGGGMDLIFPHHECEIAQSVASQGDD
SYC_BACTN       GWHAECTAMGRKYL--------------GEHFDIHGGGMDLIFPHHECEIAQSVASQGDD
SYC_PORGI       GWHCECTAMGRKYL--------------GEEFDIHGGGMDLVFPHHECEIAQAVASQGHP
SYC_CHLCH       GWHLECSAMAMKYL--------------GETIDIHGGGMENKFPHHECEIAQSEAATGKP
SYC_PELLD       GWHLECSAMSMKYL--------------GDTIDIHGGGMENRFPHHECEIAQSEAANEKP
SYC_CHLTE       GWHLECSAMAMKYL--------------GDTIDIHGGGMENKFPHHDCEIAQSEAATGKP
SYC_THET2       GWHIECTAMSLKYL--------------GEGFDLHAGGIDLQFPHHECEIAQAEAA-GFR
SYC_THET8       GWHIECTAMSLKYL--------------GEGFDLHAGGIDLQFPHHECEIAQAEAA-GFR
SYC_DEIRA       GWHIECSAMSLKYL--------------GEGFDIHGGGLDLQFPHHEAEIAQAEAA-GHH
SYC_BORBU       SWHLECAAMNLEYF--------------KDALDIHLGGVDHIGVHHINEIAIAECFLNKK
SYC_BORBP       SWHLECAAMNLEYF--------------KDTLDIHLGGVDHIGVHHINEIAIVECFLNKK
SYC_TREDE       GWHIECSAMSMKYL--------------GEQIDIHKGGIDHIRVHHTNEIAQSEGATGKK
SYC_TREPA       GWHIGCSAMSMKFL--------------GPRCDIHIGGVDHIRVHHRNERAQCEAITGAP
SYC_NOVAD       GWHLECSVMSGEVL--------------GFPFDIHTGGIDHREIHHPNEIAQNQAFCCTN
SYC_ZYMMO       GWHLECSVMSMKYL--------------GEQFDIHTGGIDHREIHHCNEIAQNQAFTGDQ
SYC1_BURL3      GWHIECSAMSAKYL--------------GTLFDIHCGGEDHIAVHHSNEIAQTRAAHGTQ
SYC_SALRD       GWHIECSVMGMQYL--------------GDRFDLHTGGEDLIFPHHECEIAQNQSLAGHQ
SYC_CHLTR       GWHLECSIMSISLL--------------GQSLDIHAGGVDNIFPHHENEIAQSE-SLSHK
SYC_CHLTA       GWHLECSIMSISLL--------------GQSLDIHAGGVDNIFPHHENEIAQSE-SLSHK
SYC_CHLMU       GWHLECSIMSMALL--------------GQSLDIHAGGVDNIFPHHENEIAQSE-SLSRK
SYC_CHLCV       GWHLECSIMAMELL--------------GASIDIHAGGVDNIFPHHENEIAQSE-SLSHQ
SYC_CHLFF       GWHLECSIMAMELL--------------GSSIDIHAGGVDNIFPHHENEIAQSE-SLSHK
SYC_CHLAB       GWHLECSIMAMELL--------------GPSIDIHAGGVDNIFPHHENEIAQSE-SLSHQ
SYC_CHLPN       GWHLECSIMAMELL--------------GDSLDIHAGGVDNIFPHHENEIAQSE-ALSGK
SYC_PARUW       GWHLECSAMAMHLL--------------GETIDIHVGGIDNMFPHHENEIAQSE-ACSGK
SYC_LEPIN       GWHLECSAMIRKVY--------------GSGVDIHTGGVDLLFPHHENEIAQSEGAFPEE
SYC_LEPIC       GWHLECSAMIRKVY--------------GSGVDIHTGGVDLLFPHHENEIAQSEGAFPEE
SYC_CAMJE       GWHTECVAMIDSIFE--------------NTLDIHAGGIDLLFPHHENEAAQCRCGCKRK
SYC_CAMJR       GWHTECVAMIDSIFE--------------NTLDIHAGGIDLLFPHHENEAAQCRCGCKRK
SYC_HELPY       GWHIECSSMVFETLALTNTP---------YQIDIHAGGADLLFPHHENEACQTRCAFGVE
SYC_HELPJ       GWHIECSSMVFETLALANAP---------YQIDIHAGGTDLLFPHHENEACQTRCAFGVE
SYC_HELHP       GWHIECSAMIEKHLAYQNEE---------YGIDIHAGGSDLLFPHHENEASQTRCATGRE
SYC_WOLSU       GWHIECSAMIEKHLAKEGD----------YAIDIHAGGSDLLFPHHENEACQTRCATGRE
SYC_SULDN       GWHLECSAMIEKHLSKPNAK---------FAVDIHGGGADLLFPHHENEAAQTRCATDHA
SYC_AYWBP       GWHTECATMIEQLF-------------KLP-LDIHGGGTDLKFPHHENEIAQTHAHSHQK
SYC_ONYPE       GWHTECATMIEQLF-------------KLP-LDIHGGGTDLKFPHHENEIAQTHAHSHQK
SYC_MYCCT       GWHTECVLLIDEYF-------------NHQTIDIHVGGIDLKFPHHENERIQFIAKNNKE
SYC_MYCMS       GWHTECVLLIDEYF-------------NHQTIDIHVGGIDLKFPHHENERIQFIAKNNKE
SYC_MESFL       GWHTECALLIDEYF-------------KGETIDIHSGGIDLQFPHHENERIQFIAKHGKE
SYC_MYCGA       GWHTECAYIIDQEF-------------KQKGFVIHGGGIDLVFPHHENENAQNLALHNKN
SYC_UREPA       GWHSECSCLINTYI-------------GEQ-VSIHGGGIDLKFPHHENENAQNQVLYNKN
SYC_MYCPE       GWHTECSCLINKYL-------------GDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKD
SYC_MYCH2       GWHTECAALIYDYF-------------QKKSLDLHGGGVDLIFPHHENENAQHFALTGNP
SYC_MYCMO       GWHTECSALINHIF-------------KKDQIDIHGGGIDLIFPHNENENIQNIALHGLS
SYC_MYCGE       GWHVECAFLIDYCF-------------KNE-LTIHGGGVDLKFPHHENENALHMALYNQP
SYC_MYCPN       GWHVECAFLIDYSF-------------KDQ-LTIHGGGVDLKFPHHENENAMHMALYDKP
                .**  *  :                        :* *. :    *:  *           

SYC_AGRFC       --------------------------VMANVWMHNGFVQVE-------------------
SYC_RHIEC       --------------------------VMANVWMHNGFVQVE-------------------
SYC_RHIME       --------------------------VMANVWMHNGFLQVE-------------------
SYC_RHILO       --------------------------VMANVWMHNGFLQVE-------------------
SYC_NITWN       --------------------------AMANYWMHNGFLQVE-------------------
SYC_BARHE       --------------------------RMANLWMHNGFLQVE-------------------
SYC_BARQU       --------------------------RMANLWMHNGFLQVE-------------------
SYC_BRUAB       --------------------------RMANIWMHNGFLQVE-------------------
SYC_BRUA2       --------------------------RMANIWMHNGFLQVE-------------------
SYC_BRUME       --------------------------RMANIWMHNGFLQVE-------------------
SYC_BRUSU       --------------------------RMANIWMHNGFLQVE-------------------
SYC_RHOPA       --------------------------RMAQTWMHNGFLQVE-------------------
SYC_RHOP2       --------------------------RMAQTWMHNGFLQVE-------------------
SYC_RHOPB       --------------------------RMATTWMHNGFLQVE-------------------
SYC_BRADU       --------------------------RMANYWMHNGFLQVE-------------------
SYC_JANSC       ---------------------------FANIWMHNEMLQVE-------------------
SYC_RUEPO       --------------------------HFANFWLHNEMLQVE-------------------
SYC_RHOS4       --------------------------GFARVWMHNEMLLVD-------------------
SYC_ANAMM       --------------------------EYARYWVHNGFLTVNG------------------
SYC_ANAPZ       --------------------------EYARYWVHNGFLTVNA------------------
SYC_EHRCJ       --------------------------YYAKYWIHNGFLTVN-------------------
SYC_EHRCR       --------------------------RYAKYWVHNGFLTVN-------------------
SYC_EHRRG       --------------------------YYAKYWIHNGFLTVN-------------------
SYC_EHRRW       --------------------------YYAKYWIHNGFLTVN-------------------
SYC_WOLPM       --------------------------MFAKYWIHNGFLTVN-------------------
SYC_WOLTR       --------------------------MFAKYWVHNGSLTVN-------------------
SYC_NEOSM       --------------------------QFARYWVHNGFLTVN-------------------
SYC_RICCN       --------------------------TYAKYWVHNGFLTVN-------------------
SYC_RICFE       --------------------------TYAKYWVHNGFLTVN-------------------
SYC_RICPR       --------------------------TYAKYWIHNGFLTVN-------------------
SYC_RICTY       --------------------------TYAKYWIHNGFLTVN-------------------
SYC_RICBR       --------------------------TYAKYWVHNGFLTVN-------------------
SYC_PELUB       --------------------------VFANYWIHNAFITMS-------------------
SYC_XANOR       --------------------------TFARFWLHNGMLNFS-------------------
SYC_XANOM       --------------------------TFARFWLHNGMLNFS-------------------
SYC_XANAC       --------------------------TFARFWLHNGMLNFS-------------------
SYC_XANC5       --------------------------TFARFWLHNGMLNFS-------------------
SYC_XANCP       --------------------------VFARFWLHNGMLNFS-------------------
SYC_XANC8       --------------------------VFARFWLHNGMLNFS-------------------
SYC_XYLFA       --------------------------TFARVWMHNGMLNFE-------------------
SYC_XYLFT       --------------------------TFARVWMHNGMLNFE-------------------
SYC_CAUVC       --------------------------VLANYWMHNGFLDMS-------------------
SYC_MAGSA       --------------------------PFARFWLHNGWLMVE-------------------
SYC_RHORT       --------------------------TFARYWMHNGYLMVE-------------------
SYC_GLUOX       --------------------------KFATHWVHNGMLLSN-------------------
SYC_SACD2       --------------------------EYVRYWMHNGYVNID-------------------
SYC_PSYA2       --------------------------EYARNWMHVGFINVDG------------------
SYC_PSYCK       --------------------------EYARNWMHVGFINVDG------------------
SYC_ACIAD       --------------------------QYVNYWMHVGFINVDG------------------
SYC_PSEF5       --------------------------TYANAWMHCGMIRING------------------
SYC_PSEPF       --------------------------TYANAWMHCGMIRING------------------
SYC_PSE14       --------------------------TYANAWLHCGMIRING------------------
SYC_PSEU2       --------------------------TYANAWLHCGMIRING------------------
SYC_PSESM       --------------------------PYANAWLHCGMIRING------------------
SYC_PSEPK       --------------------------QYANAWMHCGMIRING------------------
SYC_PSEAE       --------------------------PYAKSWLHCGMITING------------------
SYC_HAHCH       --------------------------KYVNYWMHAGAVRVNK------------------
SYC_BURMA       --------------------------TFVNYWMHNGFVQVDS------------------
SYC_BURPS       --------------------------TFVNYWMHNGFVQVDS------------------
SYC_BURP1       --------------------------TFVNYWMHNGFVQVDS------------------
SYC_BURTA       --------------------------TFVNYWMHNGFVQVDS------------------
SYC2_BURL3      --------------------------TFVNYWMHNGFVQVDN------------------
SYC_CUPPJ       --------------------------PFVNVWMHNGFVRVND------------------
SYC_RALSO       --------------------------TFVNTWMHNGFVRVND------------------
SYC_DECAR       --------------------------NFVNYWMHNGFVRVDN------------------
SYC_AROAE       --------------------------TFVNYWMHNGFVRVDD------------------
SYC_THIDA       --------------------------TFVNYWLHNGFVRVDN------------------
SYC_NEIG1       CGHDHAQTHHGQSI-----------ASHVKYWLHNGFIRVDG------------------
SYC_NEIMB       CGHHHAQTHHGQSI-----------ASHVKYWLHNGFIRVDG------------------
SYC_CHRVO       --------------------------QYVNYWLHNGFINVDG------------------
SYC_NITEU       --------------------------SHVNYWMHNGFVRVDN------------------
SYC_NITMU       --------------------------PFVNYWMHNGFVRVND------------------
SYC_BORBR       --------------------------ALANVWMHCGPLMVDA------------------
SYC_BORPA       --------------------------ALANVWMHCGPLMVDA------------------
SYC_BORPE       --------------------------ALANVWMHCGPLMVDA------------------
SYC_BORA1       --------------------------TLANIWMHCGPLMVDA------------------
SYC_RHOFT       --------------------------PLASIWMHNGFVTRDN------------------
SYC_METCA       --------------------------HFVNYWMHNGFVRINE------------------
SYC_NITOC       --------------------------KFVNYWMHNGFVRLND------------------
SYC_HYDCU       --------------------------HYVNSWMHCGFVRIDD------------------
SYC_LEGPL       --------------------------PFANYWLHVGMLQVNG------------------
SYC_LEGPA       --------------------------PFANYWLHVGMLQVNG------------------
SYC_LEGPH       --------------------------PFANYWLHVGMLQVNG------------------
SYC_BLOFL       V------------------------DSYVNTWIHTGMLTFND------------------
SYC_BLOPB       -------------------------TSYANIWMHSGLLLLNY------------------
SYC_BUCAI       -------------------------KSMINFWMHTGMVILNN------------------
SYC_BUCAP       -------------------------NFRVKFWMHSGLVIIKN------------------
SYC_BUCBP       -------------------------NFSIKHWMHTGLVIINN------------------
SYC_WIGBR       -------------------------KFNVNFWVHTGMVMFKK------------------
SYC_COLP3       -------------------------TPYVNYWMHTGMVQVDQ------------------
SYC_PSET1       -------------------------GKYVNTWIHTGMVQVNK------------------
SYC_IDILO       -------------------------SEYVKYWMHSGMVQVDN------------------
SYC_ECOL6       -------------------------GQYVNYWMHSGMVMVDR------------------
SYC_SHIFL       -------------------------GQYVNYWMHSGMVMVDR------------------
SYC_ECOLI       -------------------------GQYVNYWMHSGMVMVDR------------------
SYC_ECO57       -------------------------GQYVNYWMHSGMVMVDR------------------
SYC_SHISS       -------------------------GQYVNYWMHSGMVMVDR------------------
SYC_SHIBS       -------------------------GQYVNYWMHSGMVMVDR------------------
SYC_SHIDS       -------------------------GQYVNYWMHSGMVMVDR------------------
SYC_SALCH       -------------------------GEYVNYWMHSGMVMVDR------------------
SYC_SALTY       -------------------------GEYVNYWMHSGMVMVDR------------------
SYC_SALPA       -------------------------GEYVNYWMHSGMVMVDR------------------
SYC_SALTI       -------------------------GEYVNYWMHSGMVMVDR------------------
SYC_PECAS       -------------------------GPYVNYWMHSGMVMVDR------------------
SYC_YERPE       -------------------------GPYVNYWMHSGMVMIDK------------------
SYC_YERPS       -------------------------GPYVNYWMHSGMVMIDK------------------
SYC_PHOLL       -------------------------GPYVNYWMHSGMVMVDK------------------
SYC_SODGM       -------------------------GPYVNVWMHAGMVMVDR------------------
SYC_VIBVU       -------------------------TQYVNTWMHSGMVMVDK------------------
SYC_VIBVY       -------------------------TQYVNTWMHSGMVMVDK------------------
SYC_VIBPA       -------------------------TKYVNTWMHSGMVMVDR------------------
SYC_VIBCH       -------------------------TQYVNTWMHSGMVMVDK------------------
SYC_ALIF1       -------------------------TPYVNTWMHSGMVMVDR------------------
SYC1_PHOPR      -------------------------SQYVNTWMHSGMVMVDR------------------
SYC_SHEON       -------------------------TPYVNYWMHTGMVMIDR------------------
SYC_HAEDU       -------------------------GEYVNYWLHTGMLTIDK------------------
SYC_MANSM       -------------------------GEYVNYWLHTGMLTINE------------------
SYC_HAEIN       -------------------------GQYVNYWIHSGMIMVDK------------------
SYC_HAEI8       -------------------------GQYVNYWIHSGMIMVDK------------------
SYC_PASMU       -------------------------GRYVNYWIHSGMIMVDR------------------
SYC_FRATH       -------------------------CTFANYWLHSGMVKVNA------------------
SYC_FRATT       -------------------------CTFANYWLHSGMVKVNA------------------
SYC_COXBU       -------------------------KPFVKLWMHAGLLEINK------------------
SYC_DESAG       -------------------------KEFARYWVHNGFVQVNA------------------
SYC_DESVH       -------------------------KPFVRYWMHNGFVQVDA------------------
SYC_ANADE       LHA----------------------EDFARYWMHNGFVQIDD------------------
SYC_GEOMG       -------------------------KPFAHYWIHNGFVNINS------------------
SYC_GEOSL       -------------------------KPFARYWIHNGFVNINA------------------
SYC_PELCD       -------------------------KPFVKYWLHNGFVNVNQ------------------
SYC_DESPS       -------------------------KPFANTWIHHGFVTIKD------------------
SYC_NOSS1       -------------------------QPLARYWTHNGMVMVNG------------------
SYC_TRIV2       -------------------------QPLARYWTHNGMVMVNG------------------
SYC_SYNY3       -------------------------QPLAQYWLHNGMVKVDG------------------
SYC_SYNP6       -------------------------HPLARYWLHNGMVNVGG------------------
SYC_SYNE7       -------------------------HPLARYWLHNGMVNVGG------------------
SYC_THEEB       -------------------------QPLARFWLHNGFVTVNT------------------
SYC_GLOVI       -------------------------KPLARYWMHNAFLNVVNSSG---------------
SYC_SYNJB       -------------------------KPMAKYWMHNGFLNING------------------
SYC_SYNJA       -------------------------KPLAKYWLHNGFVNVNG------------------
SYC_SYNS9       -------------------------QELAQVWMHNGMVNVGG------------------
SYC_SYNPX       -------------------------KELARVWMHNGMVNVGG------------------
SYC_PROMM       -------------------------KQLARYWLHNGMVNVGG------------------
SYC_SYNSC       -------------------------TTLAKLWMHNGMVNVGG------------------
SYC_PROMA       -------------------------KKLAKYWLHNGMVNVGG------------------
SYC_PROMT       -------------------------KELAKYWLHNGMVNVGG------------------
SYC_PROM9       -------------------------KKLANYWLHNGMVNVNG------------------
SYC_PROMP       -------------------------KKLANYWLHNGMVNVNG------------------
SYC_AQUAE       -------------------------KPFARYWMHNGLVTVG-------------------
SYC_THEMA       -------------------------KVFARYWMHNGMVRFL-------------------
SYC_BACAN       -------------------------KTFARYWMHNGYINI--------------------
SYC_BACHK       -------------------------KTFARYWMHNGYINI--------------------
SYC_BACCZ       -------------------------KTFARYWMHNGYINI--------------------
SYC_BACC1       -------------------------KTFARYWMHNGYINI--------------------
SYC_BACCR       -------------------------KTFARYWMHNGYINI--------------------
SYC_BACLD       -------------------------KPFAKYWLHNGYINI--------------------
SYC_BACSU       -------------------------KTFAKYWLHNGYINI--------------------
SYC_GEOKA       -------------------------KPFAKYWLHNGYLNI--------------------
SYC_OCEIH       -------------------------ETFANYWMHNGYINI--------------------
SYC_BACSK       -------------------------KKLANYWMHNGFVNI--------------------
SYC_BACHD       -------------------------KPMANYWLHNGFINL--------------------
SYC_LISMO       -------------------------KTFANYWMHNAFLNI--------------------
SYC_LISMF       -------------------------KTFANYWMHNAFLNI--------------------
SYC_LISIN       -------------------------KTFAKYWMHNAFLNI--------------------
SYC_STAAC       -------------------------APFANYWMHNGFINI--------------------
SYC_STAA3       -------------------------APFANYWMHNGFINI--------------------
SYC_STAAM       -------------------------APFANYWMHNGFINI--------------------
SYC_STAAN       -------------------------APFANYWMHNGFINI--------------------
SYC_STAAS       -------------------------APFANYWMHNGFINI--------------------
SYC_STAAW       -------------------------APFANYWMHNGFINI--------------------
SYC_STAAB       -------------------------APFSNYWMHNGFINI--------------------
SYC_STAAR       -------------------------APFANYWMHNGFINI--------------------
SYC_STAES       -------------------------APFANYWMHNGFINI--------------------
SYC_STAEQ       -------------------------APFANYWMHNGFINI--------------------
SYC_STAHJ       -------------------------APFANYWMHNGFINI--------------------
SYC_STAS1       -------------------------APFANYWMHNGFINI--------------------
SYC_LACPL       -------------------------KTFANYWLHNGFVTVGD------------------
SYC_LACSS       -------------------------QTFVNYWLHNGFVTVGD------------------
SYC_ENTFA       -------------------------HTFANYWMHNGYVTIGE------------------
SYC_LACAC       -------------------------QKFVNYWMHNGFVTVGK------------------
SYC_LACJO       -------------------------KKFVNYWMHNGFVTVGK------------------
SYC_STRA1       -------------------------KTFANYWMHNGFVNV--------------------
SYC_STRA5       -------------------------KTFANYWMHNGFVNV--------------------
SYC_STRA3       -------------------------KTFANYWMHNGFVNV--------------------
SYC_STRPM       -------------------------KTFANYWMHNGFVTV--------------------
SYC_STRP3       -------------------------KTFANYWMHNGFVTV--------------------
SYC_STRP8       -------------------------KTFANYWMHNGFVTV--------------------
SYC_STRP6       -------------------------KTFANYWMHNGFVTV--------------------
SYC_STRP1       -------------------------KTFANYWMHNGFVTV--------------------
SYC_STRT2       -------------------------KTFANYWMHNGFVNV--------------------
SYC_STRT1       -------------------------KTFANYWMHNGFVNV--------------------
SYC_STRMU       -------------------------KKFANYWMHNGFVNI--------------------
SYC_STRPN       -------------------------KAFANYWMHNGFVNI--------------------
SYC_STRR6       -------------------------KAFANYWMHNGFVNI--------------------
SYC_LACLA       -------------------------QKFVNYWMHNGFVNV--------------------
SYC_CLOPE       -------------------------EPFARYWLHSAFVNV--------------------
SYC_CLOTE       -------------------------KPFAKYWMHSAFLNI--------------------
SYC_CLOAB       -------------------------KPFSKYWMHAAYLNI--------------------
SYC_CALS4       -------------------------QPFSKYWMHIGYLNV--------------------
SYC_SYMTH       -------------------------KPFARYWMHNAHLMI--------------------
SYC_CARHZ       -------------------------KPFARYWMHNGFITV--------------------
SYC_MOOTA       -------------------------CTFARFWLHNGFITV--------------------
SYC_FUSNN       -------------------------GTFAKYWMHNGYINI--------------------
SYC_DEHM1       -------------------------KPFVKYWLHNGLLKLG-------------------
SYC_DEHMC       -------------------------KPFVKYWLHNGLLKLG-------------------
SYC_BDEBA       -------------------------KAFVKYWMHNNMLNFGG------------------
SYC_COREF       ---------------------------FARYWMHNHWVTMAGE-----------------
SYC_CORGL       ---------------------------FANYWMHNHWVTMAGE-----------------
SYC_CORDI       ---------------------------FANYWMHNHWVTMSGE-----------------
SYC_CORJK       ---------------------------FARYWMHNGWVTMSGE-----------------
SYC_MYCBO       ---------------------------FARYWLHNGWVTMGGE-----------------
SYC_MYCTU       ---------------------------FARYWLHNGWVTMGGE-----------------
SYC_MYCPA       ---------------------------FARYWLHNGWVTMGGE-----------------
SYC_MYCLE       ---------------------------FARYWLHNGWVTMGGE-----------------
SYC_NOCFA       ---------------------------FARYWLHNGWVTMGGE-----------------
SYC_STRAW       ---------------------------FARYWVHNAWVTMSGE-----------------
SYC_THEFY       ---------------------------FARYWLHNGLLTTGGE-----------------
SYC_LEIXX       ---------------------------FANYWVHNGLVNVNGQ-----------------
SYC_CUTAK       ---------------------------FAHYWMHNAWVTMSGE-----------------
SYC_BIFLO       ---------------------------SAARWMHSAWVTAKGE-----------------
SYC1_TROW8      ---------------------------FADIWMHTGAVNVEGI-----------------
SYC1_TROWT      ---------------------------FADIWMHTGAVNVEGI-----------------
SYC_FRACC       PASNAASADSPGPGGGEPGGGEPSSGEMARYWMHVGLLTTGGT-----------------
SYC_RHOBA       --------------------------PMVKYWMHNGLMRAGEKGKVGGKSDRENAAAEAA
SYC_BACFR       ---------------------------MVHYWMHNNMITINGT-----------------
SYC_BACFN       ---------------------------MVHYWMHNNMITINGT-----------------
SYC_BACTN       ---------------------------MVHYWMHNNMITINGT-----------------
SYC_PORGI       ---------------------------IVRYWMHNNMITINGQ-----------------
SYC_CHLCH       ---------------------------YVRYWMHNNMVTVNGT-----------------
SYC_PELLD       ---------------------------YVRYWMHNNMVTVNGT-----------------
SYC_CHLTE       ---------------------------FVRYWMHNNMVTVDGV-----------------
SYC_THET2       ---------------------------FARHWMHHNHVLLEGE-----------------
SYC_THET8       ---------------------------FARHWMHHNHVLLEGE-----------------
SYC_DEIRA       ---------------------------FARYWMHNNMLTIGGE-----------------
SYC_BORBU       ---------------------------WCDVFVHGEFLIMDY------------------
SYC_BORBP       ---------------------------WCDIFVHGEFLIMDY------------------
SYC_TREDE       ---------------------------WVNYWLHNEFLVMNK------------------
SYC_TREPA       ---------------------------WVRYWLHHEFLLMQLQKRAVHADMG--------
SYC_NOVAD       GLDV-------------------PANSGARIWMHNNFL-VERSG----------------
SYC_ZYMMO       ------------------------QKTGANFWLHNNFL-VDRSG----------------
SYC1_BURL3      ---------------------------LANYWMHGHFLTLDVHT----------------
SYC_SALRD       ---------------------------VVNYWVHTRFLQVEGE-----------------
SYC_CHLTR       --------------------------PFVRYWLHSHHLLVDRK-----------------
SYC_CHLTA       --------------------------PFVRYWLHSHHLLVDRK-----------------
SYC_CHLMU       --------------------------PFVRYWLHSHHLLVDGK-----------------
SYC_CHLCV       --------------------------PFSRYWLHSEHLLVDGK-----------------
SYC_CHLFF       --------------------------PFSRYWLHSEHLLVDGK-----------------
SYC_CHLAB       --------------------------PFSRYWLHSEHLLVDGK-----------------
SYC_CHLPN       --------------------------PFARYWLHSEHLLIDGK-----------------
SYC_PARUW       --------------------------KFVNLWMHAEHLVVDQK-----------------
SYC_LEPIN       --------------------------SFVKTWLHSEHLLVDGQ-----------------
SYC_LEPIC       --------------------------SFVKTWLHSEHLLVDGQ-----------------
SYC_CAMJE       ---------------------------LANIWLHNGFVKIDG------------------
SYC_CAMJR       ---------------------------LANIWLHNGFVKIDG------------------
SYC_HELPY       ---------------------------LAKYWMHNGFVNINN------------------
SYC_HELPJ       ---------------------------IAKYWMHNGFVNINN------------------
SYC_HELHP       ---------------------------IAKYWLHNGFVNING------------------
SYC_WOLSU       ---------------------------LAKYWMHNGFVTING------------------
SYC_SULDN       ---------------------------LAAYWMHNGFVNIDG------------------
SYC_AYWBP       ---------------------------LANFFMHVERLDYQN------------------
SYC_ONYPE       ---------------------------LANFFMHVERLDYQN------------------
SYC_MYCCT       ---------------------------LADIWLHNGHLQIND------------------
SYC_MYCMS       ---------------------------LAHIWLHNGHLQIND------------------
SYC_MESFL       ---------------------------ISDIWVHNGHLTING------------------
SYC_MYCGA       ---------------------------LVNCWVHVGYLLIDN------------------
SYC_UREPA       ---------------------------LAKVWMHFGLVNINN------------------
SYC_MYCPE       ---------------------------LARIWMHVGHLNINN------------------
SYC_MYCH2       ---------------------------IAENWFRSGFVNLNG------------------
SYC_MYCMO       ---------------------------LAKKWLHVGHIKWEN------------------
SYC_MYCGE       ---------------------------ITKHWMHIGHLMIEN------------------
SYC_MYCPN       ---------------------------LTQHWMHIGHLMFEN------------------
                                               : :   :                      

SYC_AGRFC       ------GRKMSKSEGNFVTIYELLHTDKFG---------GRQWPGEVLRLAMLMTHYREP
SYC_RHIEC       ------GRKMSKSEGNFVTIHDLLHTETFG---------GRKWPGEVLRLAMLMTHYREP
SYC_RHIME       ------GRKMSKSEGNFITIYELLHTEKFG---------GRKWPGEVLRLAMLMTHYREP
SYC_RHILO       ------GQKMSKSLGNFYSIHELLETETFG---------GRSWPGEVLRLAMLMTHYREP
SYC_NITWN       ------GEKMSKSLGNFVTINELLTTEKFG---------GRKWPGEVLRLNMLRTHYRQP
SYC_BARHE       ------GKKMSKSLSNFITIRSILESDFFEFNGVLTNEMKQNWAGLSARFSMLQTHYREP
SYC_BARQU       ------GKKMSKSLGNFITIRSILESDFFEFNGVLTDEMKQNWAGLSARFSMLQTHYREP
SYC_BRUAB       ------GQKMSKSLGNFITIRDVLNDGLPQLGEWGDNTVRDHWAGLAARLSMLQTHYREP
SYC_BRUA2       ------GQKMSKSLGNFITIRDVLNDGLPQLGEWGDNTVRDHWAGLAARLSMLQTHYREP
SYC_BRUME       ------GQKMSKSLGNFITIRDVLNDGLPQLGEWGDNTVRDRWAGLAARLSMLQTHYREP
SYC_BRUSU       ------GQKMSKSLGNFITIRDVLNDGLPQLGEWGDNTVRDRWAGLAARLSMLQTHYREP
SYC_RHOPA       ------GEKMSKSLGNFITIRELLATNKFG---------GRSWDGATLRLAMLKTHYRQP
SYC_RHOP2       ------GEKMSKSLGNFITIRELLATEKFG---------GDSWVGEILRFAMIKTHYRSP
SYC_RHOPB       ------GEKMSKSLGNFLTISDQ----------------RDQWGPAVLRLNMLKTHYRQP
SYC_BRADU       ------SEKMSKSLGNFITIHELL----------------ADWPGEVLRLNMLKTHYRSP
SYC_JANSC       ------GKKMSKSLGNFFTVRDLLD---------------QGVPGEVIRFVMLSTHYGKP
SYC_RUEPO       ------GKKMSKSLGNFFTVRDLLD---------------QGIPGEVIRFVFLSTHYRKP
SYC_RHOS4       ------GRKMSKSLGNFFTVRDLLD---------------QGWPGEVIRMVYLGTHYGRP
SYC_ANAMM       ------GEKMSKSLGNVITVRGLLS---------------NGVDGEVIRYVFLSTHYRKP
SYC_ANAPZ       ------GEKMSKSLGNVITVRGLRN---------------SGIEGAVIRYVFLCTHYRKP
SYC_EHRCJ       ------GEKMSKSLGNVLTVRQLLE---------------SGVKGELIRYVLLNTHYRKP
SYC_EHRCR       ------DEKMSKSLGNVLTVRQLLN---------------SGITGELIRYVLLSTHYRKP
SYC_EHRRG       ------HEKMSKSLGNFLTVRQLLD---------------SGIRGEVIRYIFLSTHYRKP
SYC_EHRRW       ------HEKMSKSLGNFLTVRQLLD---------------SGIRGEVIRYIFLSTHYRKP
SYC_WOLPM       ------EEKMSKSLFNIVKVRDLLD---------------SGIKGEVIRYALLKTHYRKP
SYC_WOLTR       ------KEKMSKSLFNIVKVRDLLD---------------SGIKGEVIRYALFKTHYRKP
SYC_NEOSM       ------GEKMSKSLGNVVNVDTLVE---------------SGVTPNVIRFVLISTHYSKP
SYC_RICCN       ------GEKMSKSLGNFITVRDLMD---------------KQIQGEVVRLFLLSSHYRRP
SYC_RICFE       ------GEKMSKSLGNFITVRNLMD---------------KEISGEVVRLFLLSSHYRRP
SYC_RICPR       ------GSKMSKSLGNFITVRDLMD---------------KQIQGEVVRLFLLSSHYRRP
SYC_RICTY       ------GEKMSKSLGNFITVRDLMD---------------KQIQGEVVRLFLLSSHYRRP
SYC_RICBR       ------GEKMSKSLGNFITVRDLMD---------------KQIKGEIVRLFLLTAHYRRP
SYC_PELUB       ------NEKMAKSTGNILKIKDFKD---------------N-VDGQVLKLALMSAHYKQP
SYC_XANOR       ------GAKMSKSLGNIETVHDLIA----------------KHPPEALRYALLSAHYRQP
SYC_XANOM       ------GAKMSKSLGNIETVHDLIA----------------KHPPEALRYALLSAHYRQP
SYC_XANAC       ------GAKMSKSLGNIETVHELIA----------------RHPPEALRYALLSAHYRQP
SYC_XANC5       ------GAKMSKSLGNIETVHELIA----------------RHPPEALRYALLSAHYRQP
SYC_XANCP       ------GAKMSKSLGNIETVHDLIA----------------KHPPEALRYALLSAHYRQP
SYC_XANC8       ------GAKMSKSLGNIETVHDLIA----------------KHPPEALRYALLSAHYRQP
SYC_XYLFA       ------GAKMSKSLGNIETVHGLVA----------------KHPPEALRYALLSAHYRKP
SYC_XYLFT       ------GAKMSKSLGNIETVHELVA----------------KHPPEALRYALLSAHYRKP
SYC_CAUVC       ------GEKMSKSLGNVIIPHELLE----------------TTPGEVIRWALLSAHYRQP
SYC_MAGSA       ------GEKMSKSLGNFFTVRDLLD----------------QAPGEAIRLAMLTTHYHQP
SYC_RHORT       ------GEKMSKSLGNFVTVRDLLD----------------QAPGEAMRLAMLGTHYRQP
SYC_GLUOX       ------GEKMSKSLGNFFTIREVLD----------------RSPAEPLRLLYLGAHYRST
SYC_SACD2       ------GEKMSKSLGNFRTVRDLLQ----------------QYHGETIRFALLSAQYRSE
SYC_PSYA2       -------EKMSKSLGNFFTIRDVMAK----------------YLPETVRFFLLSSHYRSQ
SYC_PSYCK       -------EKMSKSLGNFFTIRDVMAK----------------YLPETVRFFLLSSHYRSQ
SYC_ACIAD       -------EKMSKSLGNFFTIRDVMEK----------------FHPEVIRYFIVSSHYRSP
SYC_PSEF5       -------EKMSKSLNNFFTIRDVLDK----------------YHPEVVRYLLVASHYRSA
SYC_PSEPF       -------EKMSKSLNNFFTIRDVLDK----------------YHPEVVRYLLVSSHYRSA
SYC_PSE14       -------EKMSKSLNNFFTIRDVLEK----------------YHPEVVRYLLVSSHYRSA
SYC_PSEU2       -------EKMSKSLNNFFTIRDVLEK----------------YHPEVVRYLLVSSHYRSA
SYC_PSESM       -------EKMSKSLNNFFTLRDVLEK----------------YHPEVVRYLLVSSHYRSA
SYC_PSEPK       -------EKMSKSLNNFFTIRDVLEK----------------YHPEVVRYLLVASHYRSA
SYC_PSEAE       -------EKMSKSLGNFFTIREVLEK----------------YHPEVVRYLLIASHYRSP
SYC_HAHCH       -------EKMSKSLGNFFTIREILDK----------------YPAEVVRYFLASSHYRSA
SYC_BURMA       -------EKMSKSLGNFFTIREVLEK----------------FDAEVVRFFIVRTHYRSP
SYC_BURPS       -------EKMSKSLGNFFTIREVLEK----------------FDAEVVRFFIVRTHYRSP
SYC_BURP1       -------EKMSKSLGNFFTIREVLEK----------------FDAEVVRFFIVRTHYRSP
SYC_BURTA       -------EKMSKSLGNFFTIREVLEK----------------YDAEVVRFFIVRTHYRSP
SYC2_BURL3      -------EKMSKSLGNFFTIREVLER----------------YDAEVMRFFIVRTHYRSP
SYC_CUPPJ       -------EKMSKSLGNFFTIREVLKE----------------YDAEVVRFFILRAHYRSP
SYC_RALSO       -------EKMSKSLGNFFTIRDVLKV----------------YDPEVVRFFILRSHYRSD
SYC_DECAR       -------EKMSKSLGNFFTIRTVLEQ----------------FDAEVVRFFILRAHYRSP
SYC_AROAE       -------EKMSKSLGNFFTIRDVLER----------------FDPEVVRFFILRAHYRSP
SYC_THIDA       -------EKMSKSLGNFFTIREVLQK----------------YDAEIVRFFILRAHYRSP
SYC_NEIG1       -------EKMSKSLGNFFTIREVLKQ----------------YDPEVVRFFILRAHYRSP
SYC_NEIMB       -------EKMSKSLGNFFTIREVLKQ----------------YDPEVVRFFILRAHYRSP
SYC_CHRVO       -------EKMSKSLGNFFTIRDVLQH----------------FDGEVIRFFIVRSHYRSP
SYC_NITEU       -------EKMSKSLGNFFTVREVLTR----------------YQPEVVRFFIVRAHYRSP
SYC_NITMU       -------EKMSKSLGNFFTVREILAH----------------FQPEVVRFFILRAHYRSP
SYC_BORBR       -------DKMSKSLGNFRTIRQTIAQGALSDTQA--EYAVNPREAEMLRFFIVRNHYRSP
SYC_BORPA       -------DKMSKSLGNFRTIRQTIAQGALSDTQA--EYAVNPREAEMLRFFIVRNHYRSP
SYC_BORPE       -------DKMSKSLGNFRTIRQTIAQGPLSDTQA--EYAVNPREAEMLRFFIVRNHYRSP
SYC_BORA1       -------EKMSKSLGNFRTIRQTIAQGEAQDGEA--DYQANPREAEMLRFFIVRNHYRSP
SYC_RHOFT       -------EKMSKSLGNFFTIRDILAR----------------YDAETTRFFIIRAHYRSA
SYC_METCA       -------EKMSKSLGNFFTVREILAR----------------YRPEVVRFFILNSHYRSP
SYC_NITOC       -------EKMSKSLGNFFTVREVLEH----------------YHPEVLRYFILSSHYRSP
SYC_HYDCU       -------EKMSKSLGNFFTIREVLKQ----------------YHPEVIRYFLLASHYRSP
SYC_LEGPL       -------EKMAKSIGNFYTIADVLKE----------------HHPEVIRYFLLSSHYRSP
SYC_LEGPA       -------EKMAKSIGNFYTIADVLKE----------------HHPEVIRYFLLSSHYRSP
SYC_LEGPH       -------EKMAKSIGNFYTIADVLKE----------------HHPEVIRYFLLSSHYRSP
SYC_BLOFL       -------EKMSKSLNNFFTIREIIQK----------------YDPETIRYFLLSAHYRKP
SYC_BLOPB       -------EKMSKSLNNFFTIRDILKH----------------YDPETIRFFLMSAHYRSQ
SYC_BUCAI       -------KKMSKSLGNVYFLRNILKD----------------CDAEVLRYFFLSTHYRHP
SYC_BUCAP       -------QKMSKSLGNSFFLKDVLEK----------------YEAEVLRFFFLSTHYRHP
SYC_BUCBP       -------EKMSKSLNNTLLLRDLLTQ----------------YDSEIIRFFLLSTHYRHP
SYC_WIGBR       -------EKMSKSLGNSCLIREIVKK----------------YDADTLKYFLTSSHYRSQ
SYC_COLP3       -------EKMSKSLGNFFTIRDVLAQ----------------YDAETVRFFLTTGHYRSQ
SYC_PSET1       -------EKMSKSLDNFFTVREVLKQ----------------YDAESVRYFLISGHYRSQ
SYC_IDILO       -------EKMSKSLGNFFTIRSVLEQ----------------YDAETVRYFLLSSHYRSQ
SYC_ECOL6       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SHIFL       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_ECOLI       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_ECO57       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SHISS       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SHIBS       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SHIDS       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SALCH       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SALTY       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SALPA       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_SALTI       -------EKMSKSLGNFFTVRDVLKY----------------YDAETVRYFLMSGHYRSQ
SYC_PECAS       -------EKMSKSLNNFFTVRDVLAY----------------YDPETVRYFLMSGHYRSQ
SYC_YERPE       -------EKMSKSLNNFFTIRDVLAY----------------YDAETVRYFLMSGHYRSQ
SYC_YERPS       -------EKMSKSLNNFFTIRDVLAY----------------YDAETVRYFLMSGHYRSQ
SYC_PHOLL       -------EKMSKSLNNFFTIRDVLAY----------------YDAETVRYFLLSGHYRSQ
SYC_SODGM       -------EKMSKSLGNFFTVRDVLRY----------------YDAETVRYFLMSGHYRSQ
SYC_VIBVU       -------EKMSKSLGNFFTIRDVLGH----------------YDAETVRYFLMSGHYRSQ
SYC_VIBVY       -------EKMSKSLGNFFTIRDVLGH----------------YDAETVRYFLMSGHYRSQ
SYC_VIBPA       -------EKMSKSLGNFFTIRDVLGH----------------YDAETVRYFLMSGHYRSQ
SYC_VIBCH       -------EKMSKSLGNFFTIRDVLGH----------------YDAETVRYFLMSGHYRSQ
SYC_ALIF1       -------EKMSKSLGNFFTIRDVLAH----------------YDSETVRYFLMSGHYRSQ
SYC1_PHOPR      -------EKMSKSLGNFFTIRDVLAH----------------YDAESVRYFLMSGHYRSQ
SYC_SHEON       -------EKMSKSLGNFFTIRDVLSH----------------YDAETVRYFLLSGHYRSQ
SYC_HAEDU       -------EKMSKSVGNFFSIRHMLGL----------------YDAESLRYFFLTAHYRSL
SYC_MANSM       -------EKMSKSLNNFFTIRDILTK----------------YDAESVRYFFLTAQYRSL
SYC_HAEIN       -------EKMSKSLGNFFTIRDVLNH----------------YNAEAVRYFLLTAHYRSQ
SYC_HAEI8       -------EKMSKSLGNFFTIRDVLNH----------------YNAEAVRYFLLTAHYRSQ
SYC_PASMU       -------EKMSKSLGNFFTLREVLSL----------------YDAESVRYFLLTAHYRSQ
SYC_FRATH       -------EKMSKSLNNFFTIVEVLEE----------------YHPEVVRYFLASTVYRSE
SYC_FRATT       -------EKMSKSLNNFFTIVEVLEE----------------YHPEVVRYFLASTVYRSE
SYC_COXBU       -------EKMSKSLGNIISIREALKE----------------SDVEVLRYFLLSGHYRNP
SYC_DESAG       -------EKMSKSLGNFSTIRDILQG----------------YLPETLRYFLLTKHYRSP
SYC_DESVH       -------EKMSKSLGNFKTIRDILEG----------------YLPEVLRFFLLTKHYRSP
SYC_ANADE       -------EKMSKSLGNFFTIRDVLAR----------------FDGEALRFFLLGTHYRRD
SYC_GEOMG       -------EKMSKSLGNFFTIKEVLEK----------------YDAEVLRFFLLSAHYRSP
SYC_GEOSL       -------EKMSKSLGNFFTIKEVLES----------------YDAEVLRFFLLSAHYRSP
SYC_PELCD       -------EKMSKSLGNFFTIRDILQT----------------YDPEVLRFFILTAHYRSP
SYC_DESPS       -------EKMSKSLGNFLTIKDILDH----------------YHPEILRAFIFSTQYRNP
SYC_NOSS1       -------QKMSKSLGNFITIRELLDGVG--------SWKEDPVNPMAVRLFVLQAHYRKP
SYC_TRIV2       -------QKMSKSLGNFITIRELLDGVG--------SWKGDPVNPMAVRLFVLQAHYRKP
SYC_SYNY3       -------EKMSKSLGNFTTIRALLK----------------TVDPMAIRLLVLQGHYRKP
SYC_SYNP6       -------EKMSKSLGNFTTIRQLLD--------------EGGISPMVLRLFVLQANYRKP
SYC_SYNE7       -------EKMSKSLGNFTTIRQLLD--------------EGGISPMVLRLFVLQANYRKP
SYC_THEEB       -------EKMSKSLGNFTTIRDLLA---------------QGLDPMALRLLVLQAQYRKP
SYC_GLOVI       -----AEEKMSKSLGNFKTLRDLFE----------------VFPPMALRLFLLKTSYRNP
SYC_SYNJB       -------EKMSKSLGNFTTLRQALA----------------VYHPMALRLFLLQTHYRSP
SYC_SYNJA       -------QKMSKSLGNFTTLRQALA----------------LYHPMALRLFLLQTHYRSP
SYC_SYNS9       -------QKMSKSLGNFTTIRALLE---------------SGVSPMTLRLFVLQAHYRKP
SYC_SYNPX       -------QKMSKSLGNFTTIRALLE---------------SGVSPMTLRLFVLQAHYRKP
SYC_PROMM       -------QKMSKSLGNFTTIRALLE---------------NGVSPMTLRLFILQAHYRKP
SYC_SYNSC       -------TKMSKSLGNFTTIRALLD---------------SGISPMTLRLFVLQAHYRKP
SYC_PROMA       -------QKMSKSLGNFTTIRALLK---------------EGISAMTLRLFILQAHYRKP
SYC_PROMT       -------EKMSKSLGNFTTIRSLLE---------------EDISPMTLRFFVLQTNYRKP
SYC_PROM9       -------QKMSKSLKNFKTIRELIK---------------SGISPMTLRYFVMTVNYRKP
SYC_PROMP       -------QKMSKSLKNFTTIRDLLD---------------SGTSPMTLRYFVLTVNYRKP
SYC_AQUAE       ------GQKMSKSLGNYVTLREVYT----------------KYHPDVLRLLVLFTHYRSP
SYC_THEMA       ------GDKMSKSTGNIFTVREAVK----------------RYGRDGLRYMILSKHYRSP
SYC_BACAN       -----NNEKMSKSLGNFILVHDIIK----------------QYDPQLIRFFMLSVHYRHP
SYC_BACHK       -----NNEKMSKSLGNFILVHDIIK----------------QYDPQLIRFFMLSVHYRHP
SYC_BACCZ       -----NNEKMSKSLGNFILVHDIIK----------------QYDPQLIRFFMLSVHYRHP
SYC_BACC1       -----NNEKMSKSLGNFILVHDIIK----------------QYDPQLIRFFMLSVHYRHP
SYC_BACCR       -----NNEKMSKSLGNFILVHDIIK----------------QYDPQLIRFFMLSVHYRHP
SYC_BACLD       -----DNEKMSKSLGNFVLVHDIIK----------------EHDPQVLRFFMLSVHYRHP
SYC_BACSU       -----DNEKMSKSLGNFVLVHDIIK----------------QHDPQLLRFFMLSVHYRHP
SYC_GEOKA       -----NNEKMSKSLGNFVLVHDIIR----------------EIDPQVLRFFMLSVHYRHP
SYC_OCEIH       -----DNEKMSKSLGNFVLARDLIQ----------------AHDPRVLRFFMLSVHYRNP
SYC_BACSK       -----NNEKMSKSLGNFVLAHDIIQ----------------QYSPEVVRFFMLTAHYRTP
SYC_BACHD       -----DNEKMSKSLGNVVLANEMIR----------------QHSAEVLRFFMLSAHYRSP
SYC_LISMO       -----DGEKMSKSLGNFITLHDVLK----------------DNDPNVIRFFMLSVHYRKP
SYC_LISMF       -----DGEKMSKSLGNFITLHDVLK----------------DNDPNVIRFFMLSVHYRKP
SYC_LISIN       -----DGEKMSKSLGNFITLHDVLK----------------DNDPNVIRFFMLSVHYRKP
SYC_STAAC       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAA3       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAAM       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAAN       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAAS       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAAW       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAAB       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAAR       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFVISVHYRSP
SYC_STAES       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAEQ       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAHJ       -----DNEKMSKSLGNFILVHDIIK----------------EVDPDVLRFFMISVHYRSP
SYC_STAS1       -----DNEKMSKSLGNFVLVHDIIK----------------QIDPDVLRFFMISVHYRSP
SYC_LACPL       -----DNEKMSKSLGNFVTVHDIIK----------------TVDPQVLRFFMATTQYRRP
SYC_LACSS       -----DDQKMSKSLGNFVTVHDLIQ----------------EVNPQALRFLMSSTQYRRP
SYC_ENTFA       -----DDEKMSKSLGNFITVHEMIQ----------------KVDPQILRFFMSTTQYRRP
SYC_LACAC       -----DQEKMSKSLHNFVTVHDILR----------------KIDPQVLRFFMASVQYRRQ
SYC_LACJO       -----KQEKMSKSLHNFVTVHDILK----------------QIDPQVLRFYMSSVQYRRP
SYC_STRA1       -----DNEKMSKSLGNFITVHDMLK----------------SVDGQVIRFFLATQQYRKP
SYC_STRA5       -----DNEKMSKSLGNFITVHDMLK----------------SVDGQVIRFFLATQQYRKP
SYC_STRA3       -----DNEKMSKSLGNFITVHDMLK----------------SVDGQVIRFFLATQQYRKP
SYC_STRPM       -----DNEKMSKSLGNFVTVHDMLQ----------------TVDGQVLRFFLATQQYRKP
SYC_STRP3       -----DNEKMSKSLGNFVTVHDMLQ----------------TVDGQVLRFFLATQQYRKP
SYC_STRP8       -----DNEKMSKSLGNFVTVHEMLQ----------------TVDGQVLRFFLATQQYRKP
SYC_STRP6       -----DNEKMSKSLGNFVTVHDMLQ----------------TVDGQVLRFFLATQQYRKP
SYC_STRP1       -----DNEKMSKSLGNFVTVHDMLQ----------------TVDGQVLRFFLATQQYRKP
SYC_STRT2       -----DNEKMSKSLGNFVTVHDMLK----------------TVDGQVLRFFLATQQYRKP
SYC_STRT1       -----DNEKMSKSLGNFVTVHDMLK----------------TVDGQVLRFFLATQQYRKP
SYC_STRMU       -----DNEKMSKSLGNFITVHDALK----------------TMDGQVLRFFFATQHYRKP
SYC_STRPN       -----DNVKMSKSLGNFITVHDALK----------------TLDGQVLRFFFATQHYRKP
SYC_STRR6       -----DNVKMSKSLGNFITVHDALK----------------TLDGQVLRFFFATQHYRKP
SYC_LACLA       -----DGEKMSKSLGNFTTVHELLQ----------------VVNPQILRFFLATTHYRRP
SYC_CLOPE       -----NNEKMSKSLNNFFTAREILE----------------RYDADVIRFLMLSAHYRQQ
SYC_CLOTE       -----DNKKMSKSLNNFFTAREILE----------------KYDADVVRLFMLSAHYRAQ
SYC_CLOAB       -----NNEKMSKSLNNFLTARDILK----------------EYDAEVIRLFLLSAHYRTP
SYC_CALS4       -----NNEKMSKSKGNFFTVRELTE----------------KYDPEVLRLFMLMAHYRSP
SYC_SYMTH       -----DGAKMSKSVGNFFTVRDILK----------------RYDGEVVRMFLLSAHYRTQ
SYC_CARHZ       -----NQEKMSKSLGNFFLVREILE----------------KFPGRVVRFFLLSTHYRSP
SYC_MOOTA       -----NQEKMSKSKGNFFLVRDILK----------------RFRPLAVRLYLLATHYRSP
SYC_FUSNN       -----NGEKMSKSSGSFVLLRDILK----------------YFEGRVIRLFVLGSHYRKP
SYC_DEHM1       ------EEKMSKSLGNLVTIKEALS----------------RYSADALRIFVLSSSYRNP
SYC_DEHMC       ------EEKMSKSLGNLVTIKEALS----------------RYSADALRIFVLSSSYRNP
SYC_BDEBA       -------QKMSKSLGNIVTMREFLE----------------MYNAEIYKWMILSAHYRTL
SYC_COREF       --------KMSKSLGNVLSVPNMLEK----------------VRPVELRYYLGSAHYRSV
SYC_CORGL       --------KMSKSLGNVLAVPEMLKQ----------------VRPVELRYYLGSAHYRSV
SYC_CORDI       --------KMSKSLGNVLSVPNILDK----------------VRPVELRYYLGSAHYRSM
SYC_CORJK       --------KMSKSLGNVLSIPNVLKL----------------VRPVELRYYLGSAHYRSM
SYC_MYCBO       --------KMSKSLGNVLSMPAMLQR----------------VRPAELRYYLGSAHYRSM
SYC_MYCTU       --------KMSKSLGNVLSMPAMLQR----------------VRPAELRYYLGSAHYRSM
SYC_MYCPA       --------KMSKSLGNVLAIPAMLQR----------------VRPAELRYYLGSAHYRSM
SYC_MYCLE       --------KMSKSLGNVLSIPAVLQR----------------VRPAELRYYLGSAHYRSM
SYC_NOCFA       --------KMSKSLGNVLSVPNMLTK----------------VRAVELRFYLGSAHYRSM
SYC_STRAW       --------KMSKSLGNSVLVSEMVKQ----------------WRPIVLRYYLGTPHYRSM
SYC_THEFY       --------KMSKSLGNSLLIPEITRR----------------VRPVELRYYLGQAHYRSN
SYC_LEIXX       --------KMSKSLGNSVSAAELLGA----------------ARPLAVRYSLGSAHYRST
SYC_CUTAK       --------KMSKSLGNTAQVSEVTKT----------------YSPRAVRYFLLAPHYRSM
SYC_BIFLO       --------KMSKSLGTGLSVPSVLAE----------------HSAWVVRYALGSVQYRSM
SYC1_TROW8      --------KMSKSFGNSVLVQDALSK----------------VSPSALRYYFLTAHYRST
SYC1_TROWT      --------KMSKSFGNSVLVQDALSK----------------VSPSALRYYFLTAHYRST
SYC_FRACC       --------KMSKSLGNSVLVADALDA----------------VRPQVLRYHLLSAHYRST
SYC_RHOBA       SVEEQASGKISRSKG-AGGLADLIRS----------------QTGERIRFFLLRTQYRST
SYC_BACFR       --------KMGKSLGNFITLDEFFSGSHKLLT--------QAYSPMTIRFFILQAHYRSP
SYC_BACFN       --------KMGKSLGNFITLDEFFSGSHKLLT--------QAYSPMTIRFFILQAHYRSP
SYC_BACTN       --------KMGKSLGNFITLDEFFNGTHKLLA--------QAYTPMTIRFFILQAHYRST
SYC_PORGI       --------KMGKSLGNFITLEEFFSGAHPSLN--------KAYSPMTIRFFILGAHYRGT
SYC_CHLCH       --------KMGKSLKNFVNLKELL----------------QTRNPLALRFFILQSHYRSP
SYC_PELLD       --------KMGKSLKNAVNLKEIF----------------KTVDPLAVRFFILQSHYRSP
SYC_CHLTE       --------KMGKSLKNFVNLKELF----------------GKFDPLVIRFFILQSHYRSP
SYC_THET2       --------KMAKSTGNLVLLHDLL----------------EAHEPMALRFYLLQTHYRSP
SYC_THET8       --------KMAKSTGNLVLLHDLL----------------EAHEPMALRFYLLQTHYRSP
SYC_DEIRA       --------KMSKSKGNFTTIQDIL----------------KKYDPMVVRFLLVSSHYRSV
SYC_BORBU       -------NKMSKSRGNFITVKDLEDQN---------------FSPLDFRYLCLTSHYRNQ
SYC_BORBP       -------NKMSKSHGNFITVKGLEEQN---------------FSPLDFRYLCLTSHYRNQ
SYC_TREDE       -------GKMSKSAGSFIILEDVINKG---------------FSALDYRFLLLGGHYRSQ
SYC_TREPA       SSVVSSFSKMSKSCGQFLTLSSLQERG---------------FQPADFRFFLLSGQYRTQ
SYC_NOVAD       --------KMSKSSGEFLRLQLLIDKG---------------YHPLAYRLMCLQAHYRSE
SYC_ZYMMO       --------KMSKSKGSFLTLSTLIEAG---------------IHPLAYRVLCLSAHYRSE
SYC1_BURL3      --------KMSKSSGDFVRLQTLQRRG---------------VDPLAYRYLCLTAHYRSK
SYC_SALRD       --------KMSKSKGNFYTVRDLIAPGPDDDHVPDSVREQGGVDPLALRYALMQGQYRKP
SYC_CHLTR       --------KMSKSLGNFFTLRDLLDQG---------------FSGEEVRYLLLQGHYRTQ
SYC_CHLTA       --------KMSKSLGNFFTLRDLLDQG---------------FSGEEVRYLLLQGHYRTQ
SYC_CHLMU       --------KMSKSLGNFFTLRDLLQQG---------------FSGEEVRYLLLQGHYRTQ
SYC_CHLCV       --------KMSKSLGNFFTLRNLLDRG---------------FSGEEIRYMLLQSHYRMQ
SYC_CHLFF       --------KMSKSLGNFFTLRNLLDRG---------------FSGEEIRYLLLQSHYRMQ
SYC_CHLAB       --------KMSKSLGNFFTLRNLLDRG---------------FSGAEIRYMLLQSHYRMQ
SYC_CHLPN       --------KMSKSLGNFLTLRDLLHQE---------------FTGQEVRYMLLQSHYRTQ
SYC_PARUW       --------KMSKSLGNFYTLRDLLNKG---------------FTGIQVRYLLLQTHYKTQ
SYC_LEPIN       --------KMSKSKGNFYTLRDLIQQG---------------LDPKAIRFLLISTHYRSK
SYC_LEPIC       --------KMSKSKGNFYTLRDLIQQG---------------LDPKAIRFLLISTHYRSK
SYC_CAMJE       -------EKMSKSLNNSFFIKDALKE----------------FMGEALRFYLLSSHYRSH
SYC_CAMJR       -------EKMSKSLNNSFFIKDALKE----------------FMGEALRFYLLSSHYRSH
SYC_HELPY       -------EKMSKSLGNSFFVKDALKN----------------YDGEILRNYLLGVHYRSV
SYC_HELPJ       -------EKMSKSLGNSFFIKDALKN----------------YDGEILRNYLLGVHYRSV
SYC_HELHP       -------EKMSKSLGNSFFIKDALKV----------------YDGEILRNYLLGVHYRLA
SYC_WOLSU       -------EKMSKSLGNSFFVKDALRV----------------YDGEVLRFYLLSTHYRMG
SYC_SULDN       -------EKMSKSLGNSFFLKDALKI----------------YDGEVLRFYLLSTHYRSN
SYC_AYWBP       -------QKMSKSLGNIIWCKDLLKQ----------------YNPCIIKFLILSTHYRKP
SYC_ONYPE       -------QKMSKSLGNIIWCKDLLKQ----------------YNPCIIKLLILSTHYRKP
SYC_MYCCT       -------EKMSKSLGNVILVKDFIKK----------------HNKNTLRWIFLTTNYTQP
SYC_MYCMS       -------EKMSKSLGNVILVRDFIKK----------------HNKNTLRWIFLTTNYTQP
SYC_MESFL       -------EKMSKSLGNTMTLTNFLAN----------------YNSDILRWIFLTTYYKQP
SYC_MYCGA       -------EKMSKSLNNFIYVKHLIES----------------HNYRAIRWVFYNTAHTQP
SYC_UREPA       -------EKMSKSLNNFILVKDLLAE----------------YDYQVVRWFFYQADYKQP
SYC_MYCPE       -------QKMSKSLSNFILAKDLLSE----------------YNTNTVRWFFYQTSYSNP
SYC_MYCH2       -------KKMAKSLNNVLLAKDFSHK----------------YNPDIIRSIFLSINPTVP
SYC_MYCMO       -------EKMSKSLNNFILADDFIEK----------------YGNDTFRTLILNTSFSTP
SYC_MYCGE       -------QKMSKSLQNFLLAVDFLNF----------------HDFRVLRWIFYQKHYLHP
SYC_MYCPN       -------QKMSKSLQNFLLAVDFLTI----------------HDFRILRWLFYQKHYYHP
                        *:.:*                                   :           

SYC_AGRFC       IDFSV------KRLEEAERLLSK-------WPAAETSDAAADE-----------------
SYC_RHIEC       IDFSI------KRLEEAERLLAK-------WPTAEAGDAAPDE-----------------
SYC_RHIME       IDFSI------KRLEEAEHLLSK-------WPVYGDAAGEADP-----------------
SYC_RHILO       IDFSV------RKLEEAENTLRK-------WKRAADLAPAAGQL----------------
SYC_NITWN       IDWTI------KALEESETILRRVCGRIKQFEYARRGMPTKERSVQL-------------
SYC_BARHE       LNWTA------QRLMQSSSELYR-------WYELLRCEKTEMEKKNE-------------
SYC_BARQU       LNWTA------QRLVQSSSELYR-------WYELLCFEREEMEK-NE-------------
SYC_BRUAB       INWTA------QRLAESADELHR-------WYGLLRDEGFGAPE-KL-------------
SYC_BRUA2       INWTA------QRLAESADELHR-------WYGLLRDEGFGAPE-KL-------------
SYC_BRUME       INWTA------QRLAESADELHR-------WYGLLRDEGFGAPE-KL-------------
SYC_BRUSU       INWTA------QRLAESADELHR-------WYGLLRDEGFGAPE-KL-------------
SYC_RHOPA       IDWTV------DALHEAEKAILD-------WSDFAKDATPVRC-----------------
SYC_RHOP2       IDWTV------KALDEGHKVLWD-------WYRDIGDVGPAQQL----------------
SYC_RHOPB       IDWTQ------HNLSETGRELDR-------WFEFLESASGGDPN----------------
SYC_BRADU       IDWTM------KSLEESAKTLDD-------WYRVAADVDPGRP-----------------
SYC_JANSC       MDWTE------KKRAEAEATLRK-------WYA-ALRQSVAEQEAT--------------
SYC_RUEPO       MDWTE------KKAKEAEATLRK-------WWRLTAPLDEMEIKPS--------------
SYC_RHOS4       MDWTA------EKAEQAKTTLRN-------WAEMVEGAAPGEVRA---------------
SYC_ANAMM       LDWGD------KAVLDAKEALNK-------IYRSCEGFSAQLLSTGLED-----------
SYC_ANAPZ       LDWNE------KAIFDAQSALSK-------MRRSCEEFTSEELNSDIEA-----------
SYC_EHRCJ       LDWFN------MTLVSAQESLNR-------MYTALSSVNVDLSLDDD-------------
SYC_EHRCR       LDWNS------QMVASAQESLNR-------MYTALSSTNVDLSLDDS-------------
SYC_EHRRG       LDWND------NVVSSAQESLNR-------IYMALNVTDERLLLDD--------------
SYC_EHRRW       LDWND------NVVSNAQESLNR-------IYMALNVTDERLLLDD--------------
SYC_WOLPM       LDWTE------NVISDAQETLNK-------FYRLSRGLDTINIDESN-------------
SYC_WOLTR       LDWTE------SVISESQETLNK-------FYRLLRGIDVASIEKSD-------------
SYC_NEOSM       LDWND------AMVGEAINSLIK-------FKLALLDSGVLPKSKSHIGSLNIGVCSDNA
SYC_RICCN       LDYND------KAIEDAKKTLDY-------WYRAIENINVQKID----------------
SYC_RICFE       LDYND------KAIEDAKKTLDY-------WYRAIENINVQKID----------------
SYC_RICPR       LDYND------KAIDDAKKTLDY-------WYRAIEHINVQKVD----------------
SYC_RICTY       LDYND------KAIDDAKKTLDY-------WYRAIKEINVQKVD----------------
SYC_RICBR       LDYND------KAIEDAKKTLDY-------WYRAIQNINIQKIDT---------------
SYC_PELUB       LDWNE------KLLEDCKNTIDK-------WYEVYLPPK-DKIV----------------
SYC_XANOR       LDWSD------GLIEQATNTLDR-------LYGTLRDLAALEACGSSGVEV---------
SYC_XANOM       LDWSD------GLIEQATNTLDR-------LYGTLRDLAALEACGSSGVEV---------
SYC_XANAC       LDWSD------GLIEQAKNTLDR-------LYGTLRDLAALQADSGNDVAP---------
SYC_XANC5       LDWSD------GLIEQAKNTLDR-------LYGTLRDLAALEAESGSDLAV---------
SYC_XANCP       LDWSD------GLIEQAKNTLDR-------LYGTLRDL--------HDVAA---------
SYC_XANC8       LDWSD------GLIEQAKNTLDR-------LYGTLRDL--------HDVAA---------
SYC_XYLFA       LDWSE------ALIAQSVRTLNR-------LYGTLRDL--------AAYPA---------
SYC_XYLFT       LDWSE------ALIAQSVRTLNR-------LYGTLRDL--------AAYPA---------
SYC_CAUVC       LDWTP------ELLEQSKKSLDR-------LYGALRRAK------DVAPDQ---------
SYC_MAGSA       FDWTA------DGLKQAKATLDR-------LYTALRGVA-----DIDANGY---------
SYC_RHORT       FDWTA------EGLEQARRGLDR-------LYSALRRVA-----GIAAS-----------
SYC_GLUOX       LDFSW------EKLEEARRVLDR-------LYRALERGN-----AQPGT-----------
SYC_SACD2       LDFSV------SLLDQSKAGLDT-------LYGALKNAP------ATSTDA---------
SYC_PSYA2       VNFSD------SALDEAHNSLSR-------LYQALKVVEQQK----GQTLIVD-------
SYC_PSYCK       VNFSD------SALDESHNSLSR-------LYQALKVAEQQK----GKVLIID-------
SYC_ACIAD       VNFSD------VALKEAKTALTR-------FYHAFKAYEQVY----GQN---D-------
SYC_PSEF5       INYSE------DNLKDAKGALER-------FYHALKGLPKVA----PAGG----------
SYC_PSEPF       INYSE------DNLKDAKGALER-------FYHALKGLPKVA----PAGG----------
SYC_PSE14       INYSE------DSLRESKAALER-------FYHALKGLPVAE----PAGG----------
SYC_PSEU2       INYSE------DSLRESKAALER-------FYHALKGLPVAE----PAGG----------
SYC_PSESM       INYSE------DSLRESKAALER-------FYHALKGLPAAE----PAGG----------
SYC_PSEPK       INYSE------DSLRDAKGALER-------FYHALRGLPRVA----AKGG----------
SYC_PSEAE       INYSE------ENLREAKAALDR-------FYNALKGLPEAA----PAEA----------
SYC_HAHCH       IDYSD------VALEEARSGLER-------LYNSIRELYGEL----GAVSMDE-------
SYC_BURMA       LNYSD------VHLDDARASLTR-------LYTALKDATPDA----QP------------
SYC_BURPS       LNYSD------VHLDDARASLTR-------LYTALKDATPDA----QP------------
SYC_BURP1       LNYSD------VHLDDARASLTR-------LYTALKDATPDA----QP------------
SYC_BURTA       LNYSD------VHLDDARASLTR-------LYTALKDVTPDA----AP------------
SYC2_BURL3      LNYSD------VHLDDARASLTR-------LYTALKDVEADT----LA------------
SYC_CUPPJ       LNYSD------AHLDDARHALTR-------LYTALKDTQPGG----YA------------
SYC_RALSO       LNYSD------VHLDDARHALTR-------LYTALKDVPAEA----QAR-----------
SYC_DECAR       LNYSD------AHLDDARRSLDS-------LYFALRDVPPAA----AD------------
SYC_AROAE       LNYSD------AHLEDARQALTR-------LYTALRNVQPSD----AQ------------
SYC_THIDA       LNYSD------AHLDDARGALTR-------LYTALKGAPAAG----PV------------
SYC_NEIG1       LNYSD------AHLDDAKGALTR-------LYTTLKNTPAAE----FDL-----------
SYC_NEIMB       LNYSD------AHLDDAKGALTR-------LYTTLKNTPPAD----PMP-----------
SYC_CHRVO       VNYTD------SILNDAKHGLTR-------LYTALRGIELPT----SDG-----------
SYC_NITEU       LNYSD------AHLNDARSALER-------LYTVLKNHAPSQ----DSEV----------
SYC_NITMU       LNYAD------MQLEDAGRALDR-------LYTALKGIEVHD----EVE-----------
SYC_BORBR       QNYAP------DNLVDAQNALDR-------LYQALQNTAAD-----GQG-----------
SYC_BORPA       QNYAP------DNLVDAQNALDR-------LYQALQNTAAD-----GQG-----------
SYC_BORPE       QNYAP------DNLVDAQNALDR-------LYQALQNTAAD-----GQG-----------
SYC_BORA1       QNYTP------DNLVDAQNALDR-------LYQALANVTPD-----VAG-----------
SYC_RHOFT       LNHSD------AHLDDARNSLKR-------LYTALDLVAPEP----LLE-----------
SYC_METCA       LNYSD------ENLDEAAAALSR-------LYTALRGL--------APDL----------
SYC_NITOC       LNYTK------QQLDTAKAAMTR-------LYTALRGIPRGEDRASAQGL----------
SYC_HYDCU       VNYSE------ENLDVAKASVGR-------LYSALELV----------------------
SYC_LEGPL       LNYSE------ENLLNAKKALIR-------LYQAVKDVPPQTA-----------------
SYC_LEGPA       LNYSE------ENLLNAKKALIR-------LYQAVKDVPPQTA-----------------
SYC_LEGPH       LNYSE------ENLLNAKKALIR-------LYQAVKDVPPQTE-----------------
SYC_BLOFL       LRYSD------NNIKNARLSLKH-------LYSALHGINFNPIVQLYDNN----------
SYC_BLOPB       LKYND------NNLKNAQTSLKR-------LYIALRDTNPTIQPNGGDNE----------
SYC_BUCAI       IYYCE------KNLDQAYTSLKY-------LYTALYDTNPFFNN----EE----------
SYC_BUCAP       IYYTE------ENLKKSEMSLEY-------LYVTLYGTKPIFDP----IE----------
SYC_BUCBP       LYFCY------KNLSNSSKLLKK-------LYLSLRGVDFDIKG----LD----------
SYC_WIGBR       ITYSV------DNMEKSKSAVKR-------LYRSLHNTNYFYN-----LP----------
SYC_COLP3       LNYST------DNLTQARASVER-------IYTSLRDVNIESDYVIN-------------
SYC_PSET1       LNYSQ------ENLDQARSSLER-------IYTALRGVEPVACELD--------------
SYC_IDILO       LNYTQ------ENLDQAHSALER-------LYTALRDITPQTASEE--------------
SYC_ECOL6       LNYSE------ENLKQARAALER-------LYTALRGTDKTVAPAG--------------
SYC_SHIFL       LNYSE------ENLKQARAALER-------LYTALRGTDKTVAPAG--------------
SYC_ECOLI       LNYSE------ENLKQARAALER-------LYTALRGTDKTVAPAG--------------
SYC_ECO57       LNYSE------ENLKQARAALER-------LYTALRGTDKTVAPAG--------------
SYC_SHISS       LNYSE------ENLKQARAALER-------LYTALRGTEKTVAPAG--------------
SYC_SHIBS       LNYSE------ENLKQTRAALER-------LYTALRGTDKTVAPAG--------------
SYC_SHIDS       LNYSE------ENLKQARAALER-------LYTALRGTDKTVAPAG--------------
SYC_SALCH       LNYSE------ENLKQARASLER-------LYTALRGTDKSAAPAG--------------
SYC_SALTY       LNYSE------ENLKQARASLER-------LYTALRGTDKSAAPAG--------------
SYC_SALPA       LNYSE------ENLKQARASLER-------LYTALRGTDKSAAPAG--------------
SYC_SALTI       LNYSE------ENLKQARASLER-------LYTALRGTDKSAAPAG--------------
SYC_PECAS       LNYSE------DNLKQARAALER-------LYIALRGTDPSVEAHG--------------
SYC_YERPE       LNYSE------ENLKQARASLER-------LYTALRGTDANATPAG--------------
SYC_YERPS       LNYSE------ENLKQARASLER-------LYTALRGTDANATPAG--------------
SYC_PHOLL       LNYTE------DNLKQARTALER-------FYTALRGTDASVPPAG--------------
SYC_SODGM       LNYSE------ENLKQARSALER-------LYIALRGTDATAVPAG--------------
SYC_VIBVU       LNYSE------ENLNQARASLER-------LYTSLRGLDFSAAPAG--------------
SYC_VIBVY       LNYSE------ENLNQARASLER-------LYTSLRGLDFSAAPAG--------------
SYC_VIBPA       LNYSE------DNLNQARASLER-------LYTSLRGLDLNAAPAG--------------
SYC_VIBCH       LNYSE------ENLNQARASLER-------LYNALRGLDRSVPAAG--------------
SYC_ALIF1       LNYSE------ENLNQARASLER-------LYTSLRGLDLSVTPAG--------------
SYC1_PHOPR      LNYSE------DNLKQARSALER-------LYTSLRGLDLTAQAEG--------------
SYC_SHEON       INYSE------ENLKQARAALER-------LYTAIKDVDLTVAAAP--------------
SYC_HAEDU       LDYST------DNLDLARSALER-------LYTALRGCDLSVQANG--------------
SYC_MANSM       LDYSE------ENIGLARKALER-------LYTALRGCE-TVEIPA--------------
SYC_HAEIN       LNYSE------ENLNLAQGALER-------LYTALRGTDQSAVAFG--------------
SYC_HAEI8       LNYSE------ENLNLAQGALER-------LYTALRGTDQSAVVFG--------------
SYC_PASMU       LNYSE------ENLNLAHSALER-------LYTALRGTDPTAVATE--------------
SYC_FRATH       INYSK------ENLENAKASVER-------LFNALRDIEPIEVNLP---D----------
SYC_FRATT       INYSK------ENLENAKASVER-------LFNALRDIEPIEVNLP---D----------
SYC_COXBU       LSYSK------ENLENGRLALER-------FYLALRGLPVVNHEKT--------------
SYC_DESAG       IDFTF------DGMDEAEKNLRR-------IYQTLNLVENELQKTKWS--AAP-------
SYC_DESVH       IDFTF------DSMDEAEKSLKR-------IYEALSLARTERSRSKWS--ATP-------
SYC_ANADE       FNFSD------QVLAEAERRLSA-------LYETVEKAERLGAGVEPG--AEP-------
SYC_GEOMG       IDFSD------QNLREAEAGLER-------IYGTLAGIDENLTKGAEGT-AEE-------
SYC_GEOSL       IDFSD------QNLKEAAAGLER-------IYNALAGIDEAVAADGTG--AGR-------
SYC_PELCD       IDFSD------QNLQDARLGLSR-------FYEGLHAASEVLAACPPG------------
SYC_DESPS       LDFSE------IAMQDAETALVR-------LYECLHDIQQ-LAKGDPTL-PAL-------
SYC_NOSS1       LDFTE------EAIATAENSWKT-------LKEGLLFGYQYGEKLGWGQE----------
SYC_TRIV2       LDFTE------EAIANAENSWKT-------LKEGLLFGYQYGEKLGWGQE----------
SYC_SYNY3       LDFTE------TAIAAATNGWHT-------LREGLQFGYDYGGDFGWELAFTP-------
SYC_SYNP6       IDFTD------EALQACQNGWET-------LQEGLHFGEHWGDRLGWTES----------
SYC_SYNE7       IDFTD------EALQACQNGWET-------LQEGLHFGEHWGDRLGWTES----------
SYC_THEEB       LDFTP------EALTAAAKGWQT-------LGEALHLHQQIPLPPIDAAE----------
SYC_GLOVI       IAFSA------EAFKGSEQNWRE-------LEEVLQLAGWIAGQGRPATD----------
SYC_SYNJB       IDLTE------AAMQAASRGWET-------LQKGIHCAQHFCKEEKGSPD----------
SYC_SYNJA       IDLTE------AAMEAASHGWET-------LQKGIHCAQQFG--QGGSPD----------
SYC_SYNS9       LDFTA------EALEAAATGWKG-------LNAALGLGERHGQSLEWPATPALAP-----
SYC_SYNPX       LDFTA------EALEAAATGWKG-------LNAALGLGERYSDQLGWPSPAALSE-----
SYC_PROMM       LDFTA------DAINAAATGWKG-------LNAALGLGNIYSETLNWPECKPLPQ-----
SYC_SYNSC       LDFTA------EALEAAATGWKG-------LNAALSLGGRHGESLGWSTAAPLAE-----
SYC_PROMA       LDFTK------ESLDAASTGWKR-------LNVILCLGLMKHQTLNWPKPNIQES-----
SYC_PROMT       LDFTE------EALKAASKGWER-------LNNCLSFGYIYKIKDQSKNEIFLDK-----
SYC_PROM9       LDFTE------EALRSAAEAWKN-------INLALSFMDLTKGAFRSIDKNES-------
SYC_PROMP       LDFTD------EALKSASEAWKN-------INVALSLFDITKKENLSIEVNETNE-----
SYC_AQUAE       LDFSW------EKMEETLKAYER-------LKNAIEDLEL----LKKLQVV---------
SYC_THEMA       MDFSE------ELLQDYSRAVKR-------VWEILGRYE---------------------
SYC_BACAN       INFSE------ELLQSTNNGLER-------IKTAYGNLKH---RMESS------------
SYC_BACHK       INFSE------ELLQSTNNGLER-------IKTAYGNLKH---RMESS------------
SYC_BACCZ       INFSE------ELLQSTNNGLER-------IKTAYGNLKH---RMESS------------
SYC_BACC1       INFSE------ELLQSTNNGLER-------IKTAYGNLKH---RMESS------------
SYC_BACCR       INFSE------ELLQSTNNGLER-------IKTAYGNLKH---RMESS------------
SYC_BACLD       INYSV------ELLENTKNAFGR-------LKTAYSNLQH---RLKSS------------
SYC_BACSU       INYSE------ELLENTKSAFSR-------LKTAYSNLQH---RLNSS------------
SYC_GEOKA       INYSE------ELLESARRGLER-------LKTAYSNLQH---RLQAS------------
SYC_OCEIH       INFTE------ALLESAKTSLER-------IQTAYHNLSH---RRDSS------------
SYC_BACSK       INFSD------ELLKGAEAGLER-------LKNTVANLQH---RLAET------------
SYC_BACHD       INFSD------ELLEGAKRGLER-------LQTAVSSLVH---RLQES------------
SYC_LISMO       ITLND------AILEDAKNGLER-------LMIAYQNIDH---RIQTDDGE---------
SYC_LISMF       ITLND------AILEDAKNGLER-------LMIAYQNIDH---RIQTDDGE---------
SYC_LISIN       ITLND------AILEDAKNGLER-------LMIAYQNIDH---RIQTDDGE---------
SYC_STAAC       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAA3       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAAM       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAAN       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAAS       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAAW       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAAB       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAAR       INYNL------ELVESARSGLER-------IRNSYQLIEE---RAQIA------------
SYC_STAES       INYNL------ELVGAARSGLER-------IRNSYKLIEE---REQIA------------
SYC_STAEQ       INYNL------ELVGAARSGLER-------IRNSYKLIEE---REQIA------------
SYC_STAHJ       INYNL------ELVNAAKSGLER-------IRNSYQLIEE---RETIA------------
SYC_STAS1       INYNM------ELVEAAKSGLER-------VRNSYQAIEE---REAIA------------
SYC_LACPL       IQYTQ------ANLDEAANNLDK-------LRNAYRNLTF---RLQDAT-----------
SYC_LACSS       IRYSQ------SLLAEAQTNLDR-------LKTTLDNLAF---RQPTAE-----------
SYC_ENTFA       IRYSE------STLKEAAANYQK-------LKNAFENLRF---RQADAV-----------
SYC_LACAC       INYSE------ENLKQAATILDR-------FKNTLTNINY---RIADDT-----------
SYC_LACJO       INYSE------DGLKQAETVLKR-------YQNTLRNLDA---RLNDEN-----------
SYC_STRA1       VNFTE------KAVHDAEVNLKY-------LKNTFNLPIQ---ENAND------------
SYC_STRA5       VNFTE------KAVHDAEVNLKY-------LKNTFNLPIQ---ENAND------------
SYC_STRA3       VNFTE------KAVHDAEVNLKY-------LKNTFNLPIQ---ENAND------------
SYC_STRPM       INFTE------KAIHDAEINLKY-------LKNTLQQPLT---ETADE------------
SYC_STRP3       INFTE------KAIHDAEINLKY-------LKNTLQQPLT---ETADE------------
SYC_STRP8       INFTE------KAIHDAEINLKY-------LKNTLQQPLT---ETADE------------
SYC_STRP6       INFTE------KAIHDAEINLKY-------LKNTLQQPLT---ETADE------------
SYC_STRP1       INFTE------KTIHDAEINLKY-------LKNTLQQPLT---ETADE------------
SYC_STRT2       INFTE------KAIHDAEVNLKY-------LKNTHSLPLT---EEVSQ------------
SYC_STRT1       INFTE------KAIHDAEVNLKY-------LKNTHSLPLT---EEVSQ------------
SYC_STRMU       FNFTE------KAIRDAEINLKY-------LKNTYEQPFT---ATVDE------------
SYC_STRPN       INFTE------KAVRDAETNLKY-------LKNTYEQPFT---GNVDA------------
SYC_STRR6       INFTE------KAVRDAETNLKY-------LKNTYEQPFT---GNVDA------------
SYC_LACLA       VNFTD------DALTEAENNIKK-------IENAYRHLDE---QAESNL-----------
SYC_CLOPE       LNFSE------DLLESAKASVER-------IYNAIGNLEN---LIDEVSRE---------
SYC_CLOTE       LNFSE------ELLQSAMSAVER-------LYNAIYNLEN---LANEVKRN---------
SYC_CLOAB       LNFTE------ESIEAAKTSLER-------LYNTINNLGS---LLNNTAE----------
SYC_CALS4       INFSL------DLLDQAKSAYER-------LSNAVVNLKH---LANITKDR---------
SYC_SYMTH       LSFSD------QLMEDTRRALER-------LYNTVANLEH---LAKTAPRA---------
SYC_CARHZ       LDFDD------KKLNEAKAALER-------VDNFVQNLKEVNPLPGEARIE---------
SYC_MOOTA       IDFDD------AGLLAAERGLER-------LENTRRLLGEARCQLTGTGAE---------
SYC_FUSNN       MEFSD------TELNQTKSSLER-------IENTLKRIKE---LDREN------------
SYC_DEHM1       LTYSE------EALEAAEKGAER-------LRQTAARQDN--------------------
SYC_DEHMC       LTYSE------EALEAAEKGAER-------LRQTAARKDN--------------------
SYC_BDEBA       SDFGD------EAVERAVGGLSR-------VYSALSMAESYLTPEVTQ------------
SYC_COREF       LEYSE------GALTEAAAGYRR-------IEAFVDRVGE--------------------
SYC_CORGL       LEYSE------SALSEAAVGYRR-------IESFLERVGD--------------------
SYC_CORDI       LEYSE------GALLEAAAGYRR-------IEAFLTKVAD--------------------
SYC_CORJK       LEYSE------AALGEAAAGYRR-------IEKFLVRAIEYVTGE---------------
SYC_MYCBO       LEFSE------TAMQDAVKAYVG-------LEDFLHRVRTRV------------------
SYC_MYCTU       LEFSE------TAMQDAVKAYVG-------LEDFLHRVRTRV------------------
SYC_MYCPA       LEFSD------TALQDAVKAYVG-------VEEFLHRVRVRV------------------
SYC_MYCLE       LEFSE------AALQDAVKAYVG-------VENFLTRVRTRV------------------
SYC_NOCFA       LEYSD------KALDDAVAGYQR-------IEAFLHRTAERV------------------
SYC_STRAW       IEYSE------EALREAESAFAR-------IEGFVQRVVEKA------------------
SYC_THEFY       LDYSE------ESLREAASAYQR-------LENFLVRVNEIA------------------
SYC_LEIXX       IDYHD------GSLSEAEAALER-------IAGFFERVDRRLAGT---------------
SYC_CUTAK       IEFSPSDEGTMGSLDEATKAIER-------IDSFLDRASN-LVGE---------------
SYC_BIFLO       LEWSD------QALVEAQAAYDR-------VSNFIERAGVALGGQ---------------
SYC1_TROW8      LNYTE------NSLSQACNTWNK-------LQGCIYRVYDYLERE---------------
SYC1_TROWT      LNYTE------NSLSQACNTWNK-------LQGCIYRVYDYLERE---------------
SYC_FRACC       LEYSA------EALAESTAAHDR-------VETFVRNALDILGGPGEAAALAADEVVSSV
SYC_RHOBA       IVYNE------ETLAEAGTSLEA-------FYRYFDRFAEITGDSFYDLSAATRRADGGF
SYC_BACFR       VDFSN------EALQAAEKGLSRLMEAVDSLE----KITPAATSN--VDVKSL-------
SYC_BACFN       VDFSN------EALQAAEKGLSRLMEAVDSLE----KITPAATSN--VDVKSL-------
SYC_BACTN       VDFSN------EALQASEKGLQRLIEAIEGLD----KITPAATTSEGINVKEL-------
SYC_PORGI       VDFSN------EALEAAEKGLERLLDAAALLD----GLKTADTTS--VEVGDL-------
SYC_CHLCH       LDYSE------AALDAAAQGLEKLHETLRRFR----HQAAGSGSL---DVTPY-------
SYC_PELLD       LDYSD------TAVAGSTAGLQKLRETRQRLI----EATPGTGLL---DAAPF-------
SYC_CHLTE       LDFSE------AAIRASQSGFEKLQETYKRLV----ESAEGKGQL---DVATF-------
SYC_THET2       MDFTW------EGLESAKRGYGRLLHAYREVRGRKKTAPPGTTPELERALDAL-------
SYC_THET8       MDFTW------EGLESAKRGYGRLLHAYREVRGRKKTAPPGTTPELERALDAL-------
SYC_DEIRA       TEMNE------EAFASAANGYRRLSETLHEIERRLKDAPAGSDTALDSKIAAR-------
SYC_BORBU       LKFSL------DNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYD
SYC_BORBP       LKFSF------NNLKASKIARENMINRLSYFYASLDPADLNMLNKDLKNFGFSIEKEYYD
SYC_TREDE       LTFSW------EAMETAKNGRKNLNNRVAKWLDGLSDSEIMEYAALTENLNLKSAKDMIK
SYC_TREPA       LAFSW------DALKTARAARRSFVRRVARVVDAARATTGSVRGTSAECAAERVCESRAS
SYC_NOVAD       LEFSW------EGLGAALTRLKRMLIAVGQLKERAPEVAAQPGP----------------
SYC_ZYMMO       LEFSP------DNILAALTRLKRLVIAVGQLKKKVQKKVVADGEPDWLRAFDERSFSKGA
SYC1_BURL3      LHFTW------ESLDAAQTALNRL----RHLYIGWPDGGRVDAD----------------
SYC_SALRD       FNFTL------DTLHTAARHVRRYQDAAERVDAALAADADGPDELGGRLRPIYDRT----
SYC_CHLTR       LNFTQ------EGLHASRQSLKRLRDFICRLEDPSY--PDDIIHPEVATACQS-------
SYC_CHLTA       LNFTQ------EGLHASRQSLKRLRDFICRLEDPSY--PDDIIHPEVATACQS-------
SYC_CHLMU       LNFTQ------EGLQAARQSLKRLRDFISRLEDPFY--PDDIIHPEVGSACQN-------
SYC_CHLCV       LNFTE------EGLLACRQALKRLRDFISRIESVYP--ESSHISEDMQQHGEG-------
SYC_CHLFF       LNFTE------EGLLACRQALKRLRDFISRLENPYP--ESTTISDEIDQQGKT-------
SYC_CHLAB       LNFTE------EGLMACRQALKRLRDFISRLESPYP--ESATISEGIDQCGQR-------
SYC_CHLPN       LNFTE------EALLACRHALRRLKDFVSRLEGVDL--PGESPLPRTLDSSSQ-------
SYC_PARUW       LNFTF------QGVESVKSSLQRLNDFIQRIYNIQT--LQS--DGQVDLLVND-------
SYC_LEPIN       LNFST------DRIAEASANIRKIQNCLDRILELEPDIKADFYFLFSIPFVQT-------
SYC_LEPIC       LNFST------DRIAEASANIRKIQNCLDRILELEPDIKADFYFLFSIPFVQT-------
SYC_CAMJE       FNYSL------SDLENAKKRLDK-------FYRLKKRLDLGEISDFDVL-----------
SYC_CAMJR       FNYSL------SDLENAKKRLDK-------FYRLKKRLDLGEISDFDVL-----------
SYC_HELPY       LNFNE------EDLLVSKKRLDK-------IYRLKQRVLG--------------------
SYC_HELPJ       LNFNE------EDLLMSKKRLDK-------IYRLKQRVLG--------------------
SYC_HELHP       LNFNE------EDLLQSKKRLDK-------LYRLKKRVIESHIQSPQITREEIKQFTHNI
SYC_WOLSU       LNFSE------EDLLASKKRLDR-------LYRLKKRVGEG-------------------
SYC_SULDN       FNFNE------EDLATAKKRLDK-------IYRLKKRLFGV-------------------
SYC_AYWBP       INFSY------DLMEQTQQKYKKITYFLTKNNFYLKVNH-FFCQT---------------
SYC_ONYPE       INFSY------DLMEQAQQKYQKITDFLTKNNFYLKVNQ-FSCQA---------------
SYC_MYCCT       LNISD------DLIYQANKFFEKLTNLSKKTIQFIIKNDLKISLI---------------
SYC_MYCMS       LNISD------DLIYQANKFFEKLTNLSKKTIQFIIKKDLKIKSI---------------
SYC_MESFL       LNIND------DLIEQANKFIQKINNLSKKIKQLLIENKFVKTNQ---------------
SYC_MYCGA       LNFDG------TIIKAAQKDVEKIISTVNRFRTFLIANK-NNIPS---------------
SYC_UREPA       IKFSH------EIMKQNEKEILKIKNAIYNAKNYLYFNN-QLKSL---------------
SYC_MYCPE       LNFTT------ENLINSKNQLENIIYNLNIFKSHLIIEQ-KYNE----------------
SYC_MYCH2       INLTE------ELIKNHKKLIEKYQKICFEWYF----DKKN-------------------
SYC_MYCMO       ISINE------EILESNKKISNKYQVTFNQANLLIMQSKKRQNEV---------------
SYC_MYCGE       IDLNQ------SLIEKANNDIQRIAKTLNVARTWLVYSE--QSEL---------------
SYC_MYCPN       LDLSQ------SLIEQACSDIKRIQKAVNVCRTWFVYSE--QSAI---------------
                                                                            

SYC_AGRFC       -------------------------------------------------TVLEALADDLN
SYC_RHIEC       -------------------------------------------------SVLNALADDLN
SYC_RHIME       -------------------------------------------------AVVTALADDLN
SYC_RHILO       -----------------------------------------------PVEVIDALSDDLA
SYC_NITWN       ---------------------------------------------NLPPEILEALVDDLN
SYC_BARHE       ---------------------------------------------VIDDSLINALSDDLN
SYC_BARQU       ---------------------------------------------ALDDSVIDALSDDLN
SYC_BRUAB       ---------------------------------------------SHASAVAAALCDDLN
SYC_BRUA2       ---------------------------------------------SHASAVAAALCDDLN
SYC_BRUME       ---------------------------------------------SHASAVAAALCDDLN
SYC_BRUSU       ---------------------------------------------SHASAVAAALCDDLN
SYC_RHOPA       ------------------------------------------------DEVIAALTDDLN
SYC_RHOP2       -----------------------------------------------PGEFIDCLADDLN
SYC_RHOPB       ----------------------------------------------DANDVMSALADDLN
SYC_BRADU       -----------------------------------------------AASVVEPLLDDLN
SYC_JANSC       ------------------------------------------------PHLVDSLADDLN
SYC_RUEPO       ------------------------------------------------PQFIDALTDDLN
SYC_RHOS4       -------------------------------------------------EVVDPLSDDLN
SYC_ANAMM       --------------------------------------------VGVHDAVMASLRDDMN
SYC_ANAPZ       --------------------------------------------VGVHNMLLEALKDDMN
SYC_EHRCJ       --------------------------------------------VELSSDVVDCLKDDIN
SYC_EHRCR       --------------------------------------------VELSSHVIDCLKDDIN
SYC_EHRRG       --------------------------------------------VEVSDEIISCLKDDMN
SYC_EHRRW       --------------------------------------------VEVSDEIISCLKDDMN
SYC_WOLPM       --------------------------------------------AEISKDFIDALKNDLN
SYC_WOLTR       --------------------------------------------VEVSRDFIETLKNDLN
SYC_NEOSM       EDEEVDPRSCASEVIVARNKRKAKNFSKKMNEIFNKFGGLGDDCSIYTREFFECMADDFN
SYC_RICCN       ----------------------------------------------LPHDFMQSLLDDMN
SYC_RICFE       ----------------------------------------------LPHNFMQSLLDDMN
SYC_RICPR       ----------------------------------------------LPSNFMRSLFDDMN
SYC_RICTY       ----------------------------------------------LPSDFMQSLFDDMN
SYC_RICBR       ----------------------------------------------LPSDFMQSLFDDMN
SYC_PELUB       ----------------------------------------------LDEDILSPLYDDLN
SYC_XANOR       -------------------------------------------SKTIPVEVESALQDDLN
SYC_XANOM       -------------------------------------------SKTIPVEVESALQDDLN
SYC_XANAC       -------------------------------------------SRTIPVEVESALEDDLN
SYC_XANC5       -------------------------------------------SMTIPAEVESALDDDLN
SYC_XANCP       -------------------------------------------SAVIPAPVEAALDDDLN
SYC_XANC8       -------------------------------------------SAVIPAPVEAALDDDLN
SYC_XYLFA       -------------------------------------------HPFIPGNIEAALDDDLN
SYC_XYLFT       -------------------------------------------RAIIPGNIEAALDDDLN
SYC_CAUVC       -------------------------------------------AMEAPAEVMSALMDDLN
SYC_MAGSA       -------------------------------------------EGEAPLEVLAALKDDLN
SYC_RHORT       -------------------------------------------PAEVPEGVMAALCDDLN
SYC_GLUOX       ---------------------------------------------ALPAAVMDALCDDLN
SYC_SACD2       -------------------------------------------VDLSDNAGYLALLDDLN
SYC_PSYA2       -----------------------------------DALINNAYASAPGQDFIKAMNDDFN
SYC_PSYCK       -----------------------------------EALINNAYASAVGQDFIKAMNDDFN
SYC_ACIAD       -----------------------------------STQKDEQFIER----FNIAMRDDFN
SYC_PSEF5       ----------------------------------------EAFVER----FTQVMNDDFG
SYC_PSEPF       ----------------------------------------EAFVER----FTQVMNDDFG
SYC_PSE14       ----------------------------------------EAFVER----FSTAMNDDFG
SYC_PSEU2       ----------------------------------------EAFVER----FSTAMNDDFG
SYC_PSESM       ----------------------------------------EAFVER----FTTAMNDDFG
SYC_PSEPK       ----------------------------------------EAFVER----FSVAMNDDFG
SYC_PSEAE       ----------------------------------------AEYVER----FAAAMDDDFN
SYC_HAHCH       -----------------------------------PLV--GEYRER----FHQAMDDDFN
SYC_BURMA       ---------------------------------------LDWSEA-HAQRFAAAMNDDFN
SYC_BURPS       ---------------------------------------LDWSEA-HAQRFAAAMNDDFN
SYC_BURP1       ---------------------------------------LDWSEA-HAQRFAAAMNDDFN
SYC_BURTA       ---------------------------------------LDWSEA-HAQRFAAAMNDDFN
SYC2_BURL3      ---------------------------------------LDWNEP-HAQRFAAAMNDDFN
SYC_CUPPJ       ---------------------------------------VDWEEA-HAKRFAEAMCDDFN
SYC_RALSO       ---------------------------------------PDWNEP-HGKRFREAMHDDFN
SYC_DECAR       ---------------------------------------IDWSNE-FAGRFAAALNEDFD
SYC_AROAE       ---------------------------------------VDWDEP-HAMRFRAAMDDDFN
SYC_THIDA       ----------------------------------------DWDAP-AAARFRGAMDDDFN
SYC_NEIG1       ---------------------------------------SENANG-YTRRFYAAMNDDFG
SYC_NEIMB       ---------------------------------------SEAGDD-YTRRFYVAMNDDFD
SYC_CHRVO       ---------------------------------------IDWNHA-YAARFKAAMDDDFG
SYC_NITEU       -----------------------------------ATAVIDWENNVYARRFMSAMNDDFN
SYC_NITMU       ---------------------------------------IDWDDP-YASRFREAMNDDFN
SYC_BORBR       ---------------------------------------VDWSE-PQAQAFKAAMDDDFN
SYC_BORPA       ---------------------------------------VDWSE-PQAQAFKAAMDDDFN
SYC_BORPE       ---------------------------------------VDWSEEPQAQAFKAAMDDDFN
SYC_BORA1       ---------------------------------------IDWNE-AQAQAFKAAMNDDFN
SYC_RHOFT       ---------------------------------------IDWRQ-PFAARFKAAMDEDFG
SYC_METCA       -----------------------------------PLPLGEDRDEGFSSRFADAMQDDFN
SYC_NITOC       -----------------------------------SWEFTDGGDP-FVLRFREAMDDDFN
SYC_HYDCU       -----------------------------------PADQAEPAESKLEAEFMAAMNDDFN
SYC_LEGPL       ---------------------------------------DSKLDEYWQEQFNQAMNDDFN
SYC_LEGPA       ---------------------------------------DSKLDEYWQEQFNQAMNDDFN
SYC_LEGPH       ---------------------------------------DSKLDEYWQVQFNQAMNDDFN
SYC_BLOFL       ------------------------------------------SEKYFISKFNNKMNNDFN
SYC_BLOPB       ------------------------------------------GE-YFISKFISKMNDDFN
SYC_BUCAI       ------------------------------------------GL-NFELEFYNAMNDDFN
SYC_BUCAP       ------------------------------------------GV-NFEIDFFEALNDDFN
SYC_BUCBP       ------------------------------------------IVDNFKTDFYKAMNSDFN
SYC_WIGBR       ------------------------------------------IKEKFTSKFIDAMNDDFN
SYC_COLP3       ------------------------------------------KDSSFVKQFCQAMDDDFN
SYC_PSET1       -------------------------------------------DNEYVIKFRKAMDDDFN
SYC_IDILO       ------------------------------------------LRSKYWQSFQQAMDDDLN
SYC_ECOL6       -------------------------------------------GEAFEARFIEAMDDDFN
SYC_SHIFL       -------------------------------------------GEAFEARFIEAMDDDFN
SYC_ECOLI       -------------------------------------------GEAFEARFIEAMDDDFN
SYC_ECO57       -------------------------------------------GEAFEARFIEAMDDDFN
SYC_SHISS       -------------------------------------------GEAFEARFIEAMDDDFN
SYC_SHIBS       -------------------------------------------GEAFEARFIEAMDDDFN
SYC_SHIDS       -------------------------------------------GEAFEARFIEAMDDDFN
SYC_SALCH       -------------------------------------------GEAFEARFVEAMNDDFN
SYC_SALTY       -------------------------------------------GEAFEARFVEAMNDDFN
SYC_SALPA       -------------------------------------------GEAFEARFVEAMNDDFN
SYC_SALTI       -------------------------------------------GEAFEARFVEAMNDDFN
SYC_PECAS       -------------------------------------------GDEFEARFHDAMDDDFN
SYC_YERPE       -------------------------------------------GAEFEARFRTAMDDDFN
SYC_YERPS       -------------------------------------------GAEFEARFRTAMDDDFN
SYC_PHOLL       -------------------------------------------GEIFEARFIDAMNDDFN
SYC_SODGM       -------------------------------------------GDHFVAQFIAAMDDDFN
SYC_VIBVU       -------------------------------------------GEEYVSRFTAAMNDDFN
SYC_VIBVY       -------------------------------------------GEEYVSRFTAAMNDDFN
SYC_VIBPA       -------------------------------------------GEEYVSRFTAAMNDDFN
SYC_VIBCH       -------------------------------------------GEEYVTRFTAAMNDDFN
SYC_ALIF1       -------------------------------------------GEEFVGRFSTAMNDDFN
SYC1_PHOPR      -------------------------------------------GEEFVTRFTASMNDDFN
SYC_SHEON       -------------------------------------------AEEFVAKFKAAMDDDFN
SYC_HAEDU       -------------------------------------------GENYVTAFKTAMDDDFN
SYC_MANSM       -------------------------------------------EDQYVIDFKTAMDDDFN
SYC_HAEIN       -------------------------------------------GENFVATFREAMDDDFN
SYC_HAEI8       -------------------------------------------GENFVETFREAMDDDFN
SYC_PASMU       -------------------------------------------GQNYLAAFREAMDDDFN
SYC_FRATH       ------------------------------------------DASEYEEKFIKAMDNDFN
SYC_FRATT       ------------------------------------------DASEYEEKFIKAMDNDFN
SYC_COXBU       --------------------------------------------SSYTDRFYEAMDDDFN
SYC_DESAG       -----------------------------------LPEEVLSEMDETERAWNEAMEDDLN
SYC_DESVH       -----------------------------------LPADVTAEFDTLDRAFDEALEDDLN
SYC_ANADE       -----------------------------------AFVERARA----------ALDDDFN
SYC_GEOMG       -----------------------------------TDRELAEKAVTFPERFREAMDDDFN
SYC_GEOSL       -----------------------------------IDEELAEKAAGLPTRFREAMDDDFN
SYC_PELCD       -------------------------------------DVTSEAGATLENVFREAMDDDFN
SYC_DESPS       -----------------------------------ISAKDAAKLNSIETRFQEAMNNDFN
SYC_NOSS1       ----------------------------------------SAIIPELATRFQELGDDDFN
SYC_TRIV2       ----------------------------------------SAIIPELATRFQELGDDDFN
SYC_SYNY3       ---------------------------------------LGPDANQWTVAFQEAVDDDFN
SYC_SYNP6       ----------------------------------------VTVDPDLSDRFRMAMDDDLN
SYC_SYNE7       ----------------------------------------VTVDPDLSDRFRMAMDDDLN
SYC_THEEB       -----------------------------------------VRSHPKTEAFCQAMDEDLN
SYC_GLOVI       ----------------------------------------DIESEPWVRRFNEAMDDDFN
SYC_SYNJB       --------------------------------------------AEAMQAFQAAMDNDFG
SYC_SYNJA       --------------------------------------------SEAMRAFQTAMDDDFG
SYC_SYNS9       ------------------------------VALVAPSNHPSEPLEPLQQRFIDAMDDDLN
SYC_SYNPX       ------------------------------DAIGPQTSPDAEALQALEQQFIGSMEDDLN
SYC_PROMM       ------------------------------GVIQAAHPSNQEQCNKIRQHFIDALDDDLN
SYC_SYNSC       ------------------------------GAMNADGGPADTALVELEQRFISAMDDDLN
SYC_PROMA       ------------------------------KITSLSKHSLNETLNLSRQQFIDALNNDIN
SYC_PROMT       ------------------------------PIKKSANTKLDKNSFKLLSDFEKYMDDDLN
SYC_PROM9       -------------------------------IEEEYKEKLSFELSQKKLKFSEALGNDLN
SYC_PROMP       ------------------------------FVEETYKDMINYEISQKKIKFTNALNNDLN
SYC_AQUAE       ------------------------------ESKEGGTHPLYEQVKEFEENFYASLSDDFN
SYC_THEMA       ------------------------------KSGDIGIPKRNAVYEEYVNRFVEALDDDFN
SYC_BACAN       ------------------------------TDLTDHNEKWLADLEKFQTAFEEAMNDDFN
SYC_BACHK       ------------------------------TDLTDHNEKWLADLEKFQTAFEEAMNDDFN
SYC_BACCZ       ------------------------------TDLTDHNEKWLADLEKFQTAFEEAMNDDFN
SYC_BACC1       ------------------------------TDLTDHNEKWLADLEKFQTAFEEAMNDDFN
SYC_BACCR       ------------------------------TDLTDHNEKWLAEIEKFQTAFEEAMNDDFN
SYC_BACLD       ------------------------------TNLTEGDSEWLEKIEEQRKAFQTAMDDDFN
SYC_BACSU       ------------------------------TNLTEDDDQWLEKVEEHRKAFEEEMDDDFN
SYC_GEOKA       ------------------------------TNLTDNDEEWVSRIADIRASFIREMDDDFN
SYC_OCEIH       ------------------------------LNLTNDDAKWLQLVSAAMSKFEQDMDDDFN
SYC_BACSK       ------------------------------ADMG-AEEEWLEKIAGAKQRFIEEMDDDFN
SYC_BACHD       ------------------------------ADFG-GTEPWLERIDEFRGRFIEEMDDDFN
SYC_LISMO       ------------------------------YVEEAHEDEWLEQLTELKQAFEDDMDDDFN
SYC_LISMF       ------------------------------YVEEAHEDEWLEQLTELKQAFEDDMDDDFN
SYC_LISIN       ------------------------------YVEETHEDEWLEQLTELKQAFEDDMDDDFN
SYC_STAAC       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAA3       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAAM       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAAN       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAAS       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAAW       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAAB       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAAR       -------------------------------TNIENQQTYIDQIDAILNRFETVMNDDFN
SYC_STAES       -------------------------------SDLEEQSEYIQQIDKILNQFETVMDDDFN
SYC_STAEQ       -------------------------------SDLEEQSEYIQQIDKILNQFETVMDDDFN
SYC_STAHJ       -------------------------------TDIVDQSKYIEQIDAIIEQFETVMDDDFN
SYC_STAS1       -------------------------------TDIEAQSDYIAEIDKILEQFETVMNDDFN
SYC_LACPL       -------------------------------NG--TDTAVAEQLQTLITNFGTAMDDDFN
SYC_LACSS       -------------------------------PG--EDQIVMDKAAELEAAFVTAMDDDFN
SYC_ENTFA       -------------------------------ASLPEDEHYLAQLNELEQRFITEMDDDFN
SYC_LACAC       -------------------------------PTK-TSEDLVKAINETEEKFVAAMDDDFN
SYC_LACJO       -------------------------------ETL-EDNGLRDDLTQAKAEFIEAMDDDFN
SYC_STRA1       -----------------------------------------EELEQFVKAFQGAMDDDFN
SYC_STRA5       -----------------------------------------EELEQFVKAFQGAMDDDFN
SYC_STRA3       -----------------------------------------EELEQFVKAFQEAMDDDFN
SYC_STRPM       -----------------------------------------QELKQFVIAFQDAMDDDFN
SYC_STRP3       -----------------------------------------QELKQFVIAFQDAMDDDFN
SYC_STRP8       -----------------------------------------QELKQFVIAFQDAMDDDFN
SYC_STRP6       -----------------------------------------QELKQFVIAFQDAMDDDFN
SYC_STRP1       -----------------------------------------QELKQFVIAFQDAMDDDFN
SYC_STRT2       -----------------------------------------AELQAYLDAFQAAMDDDFN
SYC_STRT1       -----------------------------------------AELQAYLDAFQAAMDDDFN
SYC_STRMU       -----------------------------------------AVFARFLEKFQAAMDEDFN
SYC_STRPN       -----------------------------------------QELQNFKDKFVAAMDEDFN
SYC_STRR6       -----------------------------------------QELQNFKDKFVAAMDEDFN
SYC_LACLA       -----------------------------------------SALTTFRNDFVAAMDEDFN
SYC_CLOPE       -------------------------------EMNEEEKAYLESLNKYKEKYIEKMDDDFN
SYC_CLOTE       -------------------------------DLNEEEKKYIKKLDEYREKYIEKMDDDFN
SYC_CLOAB       ---------------------------------SNDDSEYLKALDSYREKFIEKMDDDFN
SYC_CALS4       -------------------------------ELSDEEKDLIVKFDEYKKQFEEAMDDDFN
SYC_SYMTH       -------------------------------EMTAEEQAVLAELSQARERFVAAMDDDFN
SYC_CARHZ       ---------------------------------------IQEKITNFLRDFNEAMEDDFN
SYC_MOOTA       ------------------------------TTVPARTSALAGRAEELRQEFISAMDDDFN
SYC_FUSNN       ------------------------------IKGIDDCQELLATKKEMEAKFIEAMNEDFN
SYC_DEHM1       ----------------------------------PRLQEINVDVKTYRERFTQYMDNDFN
SYC_DEHMC       ----------------------------------PQFKETAVDTKAYRERFTQYMDNDFN
SYC_BDEBA       -----------------------------------EDAAFAKITQDAWKKVEEAMNHDFG
SYC_COREF       -----------------------------------------VEVGTWTAGFEAAMDEDLA
SYC_CORGL       -----------------------------------------VEVGEWTPGFEVAMDEDIA
SYC_CORDI       -----------------------------------------VEAGQWTTEFEEAMNDDLA
SYC_CORJK       ---------------------------------TAV-DPQALPVGEMPAQFAEKMDDDLA
SYC_MYCBO       ---------------------------------------GAVCPGDPTPRFAEALDDDLS
SYC_MYCTU       ---------------------------------------GAVCPGDPTPRFAEALDDDLS
SYC_MYCPA       ---------------------------------------GAVEPGEPNPRFADALNDDLA
SYC_MYCLE       ---------------------------------------GAVGTGELTPRFAAALDDDLA
SYC_NOCFA       ---------------------------------------GEIPVGKWTDAFAEAMDDDLA
SYC_STRAW       -------------------------------------GGVVEPSPEVPPAFAEAMDDDLG
SYC_THEFY       -------------------------------------GPIPDDVP-VPEEFAAALDDDLG
SYC_LEIXX       ---------------------------------R----FTGSGSEVVPIAFAEAMDDDLA
SYC_CUTAK       ---------------------------------Q----VTAS--HELSEAFVTAMDDDLG
SYC_BIFLO       ---------------------------------PSREEVAAVSADDLPADFVAAMNDDVN
SYC1_TROW8      ---------------------------------G---YENDFCVSQLNTDFSTSLDNDLN
SYC1_TROWT      ---------------------------------G---YENDFCVSQLNTDFSTSLDNDLN
SYC_FRACC       AGAQPTVAGARP------------------VPVPGPGGESRLTPRRAWSDFTIAMDDDLA
SYC_RHOBA       ---------------------------------DPAGDALLTEIHAIREKFLAAMDDDFN
SYC_BACFR       -----------------------------------------------RTKCFEAMNDDLN
SYC_BACFN       -----------------------------------------------RTKCFEAMNDDLN
SYC_BACTN       -----------------------------------------------RAKCYEAMNDDLN
SYC_PORGI       -----------------------------------------------RKRCYDAMNDDLN
SYC_CHLCH       -----------------------------------------------AERFSEAMNDDFN
SYC_PELLD       -----------------------------------------------SLRFREAMDDDFN
SYC_CHLTE       -----------------------------------------------EQKITDALNDDFN
SYC_THET2       -----------------------------------------------EKAFMEAIEDDLS
SYC_THET8       -----------------------------------------------EKAFMEAIEDDLS
SYC_DEIRA       -----------------------------------------------VTEFEDAMRDDFN
SYC_BORBU       -------------------------------------------------SFVEKISFDLN
SYC_BORBP       -------------------------------------------------SFVEKVSFDLN
SYC_TREDE       N----------------------------------------EKARSCFDNFIAAMEDDLS
SYC_TREPA       ------------------------------------------ESELLLTDFRAALEDDFS
SYC_NOVAD       ------------------------------------------RFTPFLERFDAAMSDDLN
SYC_ZYMMO       PLDYQRGLIEAPLK---------------------------KEALAILERFDQAVSNDLM
SYC1_BURL3      ----------------------------------------------FAARFDAEVNEDLN
SYC_SALRD       -----------------------------------------------LEAMCDDLNTPAA
SYC_CHLTR       ----------------------------------------------FLETFITSLTNDLN
SYC_CHLTA       ----------------------------------------------FLETFITSLTNDLN
SYC_CHLMU       ----------------------------------------------FLEAFVTSITNDLN
SYC_CHLCV       ----------------------------------------------FLQAFSEAIANDLN
SYC_CHLFF       ----------------------------------------------FLKAFSDSIANDLN
SYC_CHLAB       ----------------------------------------------FLQDFSNAIANDLN
SYC_CHLPN       ----------------------------------------------FIEAFSRALANDLN
SYC_PARUW       ----------------------------------------------ALIRFAEALADDLN
SYC_LEPIN       ----------------------------------------------WKKEFEESLADDLN
SYC_LEPIC       ----------------------------------------------WKKEFEESLADDLN
SYC_CAMJE       --------------------------------------NDIGIKSEIAKQILEILNDDLN
SYC_CAMJR       --------------------------------------NDIEIKSEIAKQILEILNDDLN
SYC_HELPY       --------------------------------------TLGGINPNFKKEILECMQDDLN
SYC_HELPJ       --------------------------------------TLGGINPNFKKEILECMQDDLN
SYC_HELHP       K------------------------------------ETAKEAHKTFLSSLVEALSDDYN
SYC_WOLSU       --------------------------------------EVGAPSEKFLERLLEGLRDDMN
SYC_SULDN       --------------------------------------TYEDEKTDFKKELLETLSDDLN
SYC_AYWBP       ------------------------------------------LDQDIMQLFHQLMQDDFA
SYC_ONYPE       ------------------------------------------LDQDIMQLFHQLMQDDLA
SYC_MYCCT       ------------------------------------------KQSKYIDQFNNYMDDDLN
SYC_MYCMS       ------------------------------------------NSSEYINKFNEYMEDDLN
SYC_MESFL       ------------------------------------------FDEEIIKQFKIHMKNDLN
SYC_MYCGA       ------------------------------------------SSL-VCEEFKKALFDNLN
SYC_UREPA       ------------------------------------------TQIDHFELFDERINDDLD
SYC_MYCPE       ------------------------------------------KNLEFDKSNLIELTNNFN
SYC_MYCH2       ------------------------------------------EKTEKVEQ-VLNLFIEGK
SYC_MYCMO       ------------------------------------------ETQKYLEK-IAKLLENFE
SYC_MYCGE       ------------------------------------------ISPKQYDPVFSALLDNLN
SYC_MYCPN       ------------------------------------------PAPKQFEPVFKALLNNLN
                                                                            

SYC_AGRFC       TVAAVQALHALAHAANTD-----------------PSRLPAFAASAALLGVLPKKT----
SYC_RHIEC       TVAAVQALHALAQPGND----------------------AVFAASAVLLGVLPKKV----
SYC_RHIME       TVAAIQALHALAQKASAD-----------------SRHLGTFAASAALLGVVPKEV----
SYC_RHILO       TYAAFQVLTQLAGEAADG-----------------NEAAAALKASLLFLGFDVASA----
SYC_NITWN       TPLMLSRIGELSYDDAFD-----------------H---ALLSIGIDVLSYARWLR----
SYC_BARHE       TPKALTLLRKFYKRGNA----------------------VSLASGMNFFGLLRQEWVRDG
SYC_BARQU       TPKALTLLRKFYKAGNA----------------------IALANGMNLFGLLRQEWVQEV
SYC_BRUAB       SWAAITALRQAFKVRDV----------------------AALGEGMALMGLLDPYFVTAS
SYC_BRUA2       SWAAITALRQAFKVRDV----------------------AALGEGMALMGLLDPYFVTAS
SYC_BRUME       SWAAITALRQAFKVRDV----------------------AALGEGMALMGLLDPYFVTAS
SYC_BRUSU       SWAAITALRQAFKVRDV----------------------AALGEGMALMGLLDPYFVTAS
SYC_RHOPA       TPKMIAELHALRRAGKA----------------------DELRGAMQLLGINP-----VV
SYC_RHOP2       ISSAIAFMHSLRKDKKF----------------------AELLATMNFLGFSNA-ESVLA
SYC_RHOPB       TSAAITALRVQFKNKNS----------------------AALRSGLDLLGIPIGREFIQG
SYC_BRADU       TSLAIAALHGLR-NSDV----------------------SALAGSLRLLGFLSE---SAA
SYC_JANSC       TALAITTLHGMYETGNF----------------------GPLAGGLRLLGLWSGT-----
SYC_RUEPO       TPGAIAELHRLAKEKDY----------------------AALEAGLEMLGLQETVN----
SYC_RHOS4       TAGALAALSDLYKRKDA----------------------AGLLGSAHLLGVDLQAIRHQP
SYC_ANAMM       TPAAIAALHELVKEINKTNNA-----------GEKLRLARVLNKSAMLMGMFRNFPERKL
SYC_ANAPZ       TPMAIAALHALVGEINKTTDF-----------KERLKLARVLNRSAKLMGITDGFAGK--
SYC_EHRCJ       TPKAISVLHEMVTEINKTSDV-----------MKKTSLAKTLIKTANFLGILQHSWQD--
SYC_EHRCR       TPKAISMLHEMVTEINKTADM-----------IEKISLTKTLIKTANFLGILQHSWQD--
SYC_EHRRG       TPKAIAVLHEMVTRINKASDI-----------DKKVYFIKVLIKSANFLGILHHSWQE--
SYC_EHRRW       TPKAIAVLHEMVTRINKASDI-----------DKKVYFIKVLIKSANFLGILYHSWQE--
SYC_WOLPM       IPEALAILHEMAAKINKMSNE-----------SEKLKLTESFVKSARFIGLLESSYEK--
SYC_WOLTR       IPEALAILHEMATKINKTNNE-----------NEKLKLTESFIKSARFIGLLESSYQE--
SYC_NEOSM       TPGAIAVLHKLSDGVRLV-GA-----------EKVNNLAHLLYNLLIFLGIDLGVRQS--
SYC_RICCN       TPLAVKIINDYAKGVFISKTE-----------EERQLNASAIITCANFIGLMNKTPHEWF
SYC_RICFE       TPLAVKIINDYAKGVFISKTE-----------EEKQLNASAIITCANFIGLMNKTPHEWF
SYC_RICPR       TPLAIKIINDYAKCVFISKTE-----------AERKFNASAIITCANFIGLMRKTQYEWF
SYC_RICTY       TPLAIKIINDYAKGVFISKTE-----------AERKFNASAIITCANFIGLMRKTQYEWF
SYC_RICBR       SPLAIKIINDYAKAIFTATNE-----------EEKQFNASNLIACANFIGLMNETPHEWF
SYC_PELUB       TPGYIAKLHQLYDKALKGGNE-----------EK-----SLFVLACNFIGILNKTKEEWI
SYC_XANOR       TPLALSVIASIASEARALRNELVHGGEPSARMSELHAVRAKLLGAGLALGLLQQDPAAWF
SYC_XANOM       TPLALSVIASIASEARALRNELVHGGEPSARMSELHAVRAKLLGAGLALGLLQQDPAAWF
SYC_XANAC       TPLALSVIASIASEARALRNELVHGGEPSTRMSDLHAVHAKLLGAGLALGLLQQDPAAWF
SYC_XANC5       TPLALSVMASIASDARALRSDLMQSGQASARMIELHAARAKLLGAGMALGLLQQDPAAWF
SYC_XANCP       TPQALAEVARIAGEARKANDA-----------ADRARLKAELLGAGLALGLLQQEPAAWF
SYC_XANC8       TPQALAEVARIAGEARKANDA-----------ADRARLKAELLGAGLALGLLQQEPAAWF
SYC_XYLFA       TPQALAELATLANEARIQLADTTHHAAAEV-TAALTRLKAELLGAGLALGLLQQTPEAWF
SYC_XYLFT       TPQALAELATLANEARIQLADTTHHAAAEV-TTALTRLKAKLLGAGLALGLLQQTPEAWF
SYC_CAUVC       TPLATSAFFEVSSAIEKAVTAGD--------TVAIAANKARLLEAGALLGFLQADPDAWF
SYC_MAGSA       TPLAISHLHELAGALNKATGL-----------EDKARRKGALLASGHLLGLLYQDPEAWF
SYC_RHORT       TPKALAEVYDLLGVLNRATTT-----------EEQAKAKGALLAAGALLGLFQADPEVWL
SYC_GLUOX       TPLAIAALHPLADAAMQG----------------DQDAASSLLAAGKLLGLFNVTPAEWF
SYC_SACD2       TPQVIAELHRLAKIVNKNEGQ------------EAAIAAAQLQALGGLLGLLQQEPEAWF
SYC_PSYA2       SSTAISVLFGLARDINKASKVEDI--------ESAWQLAQQLKALAQTLNILQQPVQQFL
SYC_PSYCK       SSTAISVLFGLARDINKASKAQDV--------ETAWQLAQHLKALAQTLNILQQPVQQFL
SYC_ACIAD       TPEAIAVLFELNRELNRAVKEQQA--------EQAAIYYVTLRHLTQILGLVQHDVDEFL
SYC_PSEF5       TPEACAVLFEMVREINRLRE-SDI--------DAAAGLAARLKELASVLGVLQLEADDFL
SYC_PSEPF       TPEACAVLFEMVREINRLRE-SDL--------DAAAGLAARLKELASVLGVLQLEADDFL
SYC_PSE14       TPEACAVLFEMVREINRLRE-SDV--------TAAAGLAARLKQLASVLGVLQLEADDFL
SYC_PSEU2       TPEACAVLFEMVREINRLRE-SDI--------AAAACLAARLKQLASVLGVLQLEADDFL
SYC_PSESM       TPEACAVLFEMVREINRLRE-TDV--------AAAAGLAARLKQLASVLGVLQLEADDFL
SYC_PSEPK       TPEACAVLFDLVREINRLRD-SDV--------EAAAGLAGRLRELGDVLGVLQLEADDFL
SYC_PSEAE       TAGACSVLFELAREVNRLRE-SDL--------SAAAALAARLKQLAGLLGVLQLEPEAFL
SYC_HAHCH       TSSAVAVLFDMAKAVNVAKK-EDR--------TRALSLAKGMVDLAEVLGLLQADPESLM
SYC_BURMA       TAVAVAVLFELATEVNRTR---------------EPALARQLRLLAGLLGLLGREPREFL
SYC_BURPS       TAVAVAVLFELATEVNRTR---------------EPALARQLRLLAGLLGLLGREPREFL
SYC_BURP1       TAVAVAVLFELATEVNRTR---------------EPALARQLRLLAGLLGLLGREPREFL
SYC_BURTA       TAVAVAVLFELATEVNRTR---------------EPALARQLKRLAGLLGLLGREPREFL
SYC2_BURL3      TPVAVATLFELAGEVNRTR---------------DASLARQLKQLAGLLGLLGREPRAFL
SYC_CUPPJ       TPIAVSVLFDLASEVNRTG---------------SSVAARQLKGLAGTLGLLERDPHTFL
SYC_RALSO       TPVAMAVLFELATEVNKTR---------------SPALASQLAALGGVMGLLVRDPHAFL
SYC_DECAR       SHGAIAVLFELAAEVNRQK---------------SAGLSCLLKGLGGVIGLLEREPSAYL
SYC_AROAE       TAEAVAVLFELANEANRSG---------------SAATAAQLKGLGGVLGLLAREPASFL
SYC_THIDA       TPEAIAVLFELAAEANR-G---------------DTGAAQTLRNLGAVIGLLQRDASDFL
SYC_NEIG1       TVEAVAVLFELAGEVNKTN---------------DAHLAGCLKALGGIIGLLQRNPIEFL
SYC_NEIMB       TVKAVAVLFELAGEVNKTN---------------DAQLAGRLKALGGIIGLLQRDPTEFL
SYC_CHRVO       TSEAVAVLFELAGEVNKSR---------------DPQLARLLKDLGGVLGLLTRDPEVFL
SYC_NITEU       TPEAVAVLFDLASEANRTG---------------DSHYASLLKALGGVLGLLQQPPQQYL
SYC_NITMU       TPEALAVLFDLATEVNKTR---------------LPRDIALMKALGGVLGLLQQDPWKYF
SYC_BORBR       SSGAVAALFELASEANRTG---------------SARAAGQLKALGAVLGLLQQDPPAYF
SYC_BORPA       SSGAVAALFELASEANRTG---------------SARAAGQLKALGAVLGLLQQDPPAYF
SYC_BORPE       SSGAVAALFELASEANRTG---------------SARAVGQLKALGAVLGLLQQDPPAYF
SYC_BORA1       SSGAVAALFELAGQVNRER---------------DSRAAGQLKALGAVLGLLQQDPAVYF
SYC_RHOFT       TPEAVAVMFELATEVNKTR---------------DPKLAGLLKALGACLGLLQGDPKVFL
SYC_METCA       TPEAIAVLFDLAREINRHK-AAEP--------AKAAALGATLKSLGNVLGLLQTDPEAYF
SYC_NITOC       TPEALALLNEVRHALNRAREAGDT--------EKGQSLAVLLRSLGGILGLLAHEPEQFL
SYC_HYDCU       TPQAMAVLFELAKEVNKQK---------------SPGLAALLKKLANQIGLLEQTAESFF
SYC_LEGPL       TPVALSVLFQLAHEVNKSN---------------SPALAHTLKNLAGILGFLQKDPESFL
SYC_LEGPA       TPVALSVLFQLAHEVNKSN---------------SPALAHTLKNLAGILGFLQKDPESFL
SYC_LEGPH       TPVALSVLFQLAHEVNKSN---------------SPALAHTLKNLAGILGFLQKDPESFL
SYC_BLOFL       FPEAYSILFEMAHALNIAKIKDH---------VRAKSLAAHLKYLANILGILYQDPEIYL
SYC_BLOPB       TPEAYSVLFDIAHRLNNLKIKGHS--------LLAQGMAATLKYLANIIGLLHQNPEIFL
SYC_BUCAI       TPAVFSIFFKIARKINFLKNKDI---------LKTNKFAFRLKYLANNLGFLFQDPKEFL
SYC_BUCAP       TPQAFSILFKLARKINYLKKIDL---------SKSNFFAFRLQKLAGYLGFLLNTSQYFL
SYC_BUCBP       TPLALSILLRLSKEINKFKLIDS---------NKASQLASKLRQLGSILGILLKDPEYFL
SYC_WIGBR       TPKAYSVLFSISRQINYFKNKNP---------EKANQLSTVLKNLSNIIGILNENPDSYL
SYC_COLP3       TPQALAVLFEISKELNVAKAAA--------NNALAIDLASTLVALGEIVGLLQLDPAAFL
SYC_PSET1       TPEALPVLFELAKELNLVKDID--------SQQ-AGQLAFILGSISEVLGVAQQDPEAFL
SYC_IDILO       APEAMSVLFEIAREINRNRESA--------PDT-AAQLAHVLLELAEVMGLLQQSPEEFL
SYC_ECOL6       TPEAYSVLFDMAREVNRLKAED---------MAAANAMASHLRKLSAVLGLLEQEPEAFL
SYC_SHIFL       TPEAYSVLFDMAREVNRLKAED---------MAAANAMASHLRKLSAVLGLLEQEPEAFL
SYC_ECOLI       TPEAYSVLFDMAREVNRLKAED---------MAAANAMASHLRKLSAVLGLLEQEPEAFL
SYC_ECO57       TPEAYSVLFDMAREVNRLKVED---------MAAANAMASHLRKLSAVLGLLEQEPEAFL
SYC_SHISS       TPEAYSVLFDMAREVNRLKAED---------MAAANAMASHLRKLSAVLGLLEQEPEAFL
SYC_SHIBS       TPEAYSVLFDMAREVNRLKAED---------MAAANAMASHLRKLSAVLGLLEQEPEAFL
SYC_SHIDS       TPEAYSVLFDMAREVNRLKAED---------MAAANAMASHLRKLSAVLGLLEQEPEAFL
SYC_SALCH       TPEAYSVLFDMAREVNRLKGED---------MTAANAMASHLRKISGVLGLLEQEPDVFL
SYC_SALTY       TPEAYSVLFDMAREVNRLKGED---------MTAANAMASHLRKISGVLGLLEQEPDVFL
SYC_SALPA       TPEAYSVLFDMAREVNRLKGED---------MTAANAMASHLRKISGVLGLLEQEPDVFL
SYC_SALTI       TPEAYSVLFDMAREVNRLKGED---------MTAANAMASHLRKISGVLGLLEQEPDVFL
SYC_PECAS       TPEAYSVLFDMAREVNRLKAED---------VQAANQLASTLRKLSGVLGLLEQDPEQFL
SYC_YERPE       TPEAYSVLFDIAREVNRLKNED---------MAAANGLAAELRKLAQVLGLLEQDPELFL
SYC_YERPS       TPEAYSVLFDIAREVNRLKNED---------MAAANGLAAELRKLAQVLGLLEQDPELFL
SYC_PHOLL       TPEAYSVLFDMVREINRLKSED---------MDAANGLAAELRKLAGILGLLQQQPEQFL
SYC_SODGM       TPKAYSVLFDIAREVNRLKSE----------QPAAQGMAATLRQLAGVLGLLEQEPAAFL
SYC_VIBVU       TPEAYSVLFDMAREINRLKTE---------DLANASALGALMRELADVIGILHQDPDAFL
SYC_VIBVY       TPEAYSVLFDMAREINRLKTE---------DLANASALGALMRELADVIGILHQDPEAFL
SYC_VIBPA       TPEAYSVLFDMAREVNRLKTE---------SVEKASELGALMRELADVIGILYQDPEAFL
SYC_VIBCH       TPEAYSVLFDMAREINRLKSE---------DMTNASALGSLMRELADVIGILYQEPEAFF
SYC_ALIF1       TPEAYSVLFEMAREVNRLKTE---------NIDTASKLGALMRELADVLGLLSQEPEAFL
SYC1_PHOPR      TPEAYSVLFDMAREINRLKADETIA----NNIVQASALGARLRELADILGLLSQDPEAFL
SYC_SHEON       TPEAYSVLFDMVREINRLKLT---------DMAEASALAVSMKQLADVLGLLHQSPDAFF
SYC_HAEDU       TPAALAVLFEMAREVNKLKTED---------QQQANALAVCLKELAAVLGLLTQDPDNFL
SYC_MANSM       TPGALAVLFELAREINKLKTED---------QTKANQLASRLKQLAGVLGLLEQAPETFL
SYC_HAEIN       TPNALSVLFEMAREINKLKTED---------VEKANGLAARLRELGAILGLLQQEPEKFL
SYC_HAEI8       TPNALSVLFEMAREINKLKTED---------AEKANGLAARLRELGAILGLLQQDPEKFL
SYC_PASMU       TPKAISVLFEIAREINKLKNED---------ILKANALAARLRELAGILGLLYQDPEQFL
SYC_FRATH       TPEALAVLFSLAKEINTLKTTN---------KYKASGYAYLLRKLCDVLGILFTDIEEYF
SYC_FRATT       TPEALAVLFSLAKEINTLKTTN---------KYKASGYAYLLRKLCDVLGILFTDIEEYF
SYC_COXBU       TPIAFALLFEMVREINRFRDNNQ--------IEKAAVLAAELKCLGNIFGLLQYSPEQFL
SYC_DESAG       TAAALGHIFGLVRLVNRIIEDKTMR-KSAQARDALLRMQSMMARWGAVLGLFTRQPAEFL
SYC_DESVH       TAAALGHVFGTIRLVNRLLEDKNLR-KSAETLALLERLDGLVAKWMKVLGVFGREPEAFL
SYC_ANADE       TPQVLGIVAEAFTEANALADRK-GK-KSPEEKARLAAFARGARAVGAVLGILGRPPAQAL
SYC_GEOMG       TAQALGFVFDLVRSANRVLGEGKGGGSNRALLAEAR---DRIRKVGAVLGIFTSEPRAFA
SYC_GEOSL       TAQALGYVFDLVRAVNRVLAEGE---IDRAVLASAR---EAIDRVGAVLGLFTSEPGAFV
SYC_PELCD       TAAAIGHLFDAVRTINRLITEKGFR-KNREKVAQVRALYDALLKLGGVLGLFVSDPAAWL
SYC_DESPS       TALALGVLYDAIKIINRAQRALTDT-PSALDVKMLKGSMTLIQKLAGIVGLLQEDANLFL
SYC_NOSS1       FSGGLAVLFELAKELRREGNILVHE--GTTKTPSDE---LQRQW--NTLVTLAKILGL--
SYC_TRIV2       FSGGLAVLFELAKELRREGNILVHE--GTTKTPSDE---LQRQW--NTLVTLGKVLGL--
SYC_SYNY3       FAGGLAVMFELAKHLRSEGNKLKFE--GSTPADLDL---LQTQW--ITLVSLAEILGL--
SYC_SYNP6       TPAALAVLFELAKELRRQQNLLIHE--GHLDGDAQQ---LHQHW--VTLVQLAGVLGL--
SYC_SYNE7       TPAALAVLFELAKELRRQQNLLIHE--GHLDGDAQQ---LHQHW--VTLVQLAGVLGL--
SYC_THEEB       TAAALAVIFELAKTLNREQHRYLHG--GGWGRSPAE---VSRDW--HTLVTLAQVLGL--
SYC_GLOVI       TAAALAEVIALGKQLAGRYHAAIH---GTPLADPAR---FAREW--RTFALLCDILGL--
SYC_SYNJB       TPEALAIAFELAKELTREHNLFTHQ--GQTHLEPQA---LKQKS--AALLEILATLGFCW
SYC_SYNJA       TPGALALAFELAKELIREHNLLTHQ--GHTHLQPHL---LRQKG--AALLEILATLGFCW
SYC_SYNS9       SSGALAVLFDLAKPLRALANRLERG--DRADRPADELAALALRW--RLLRDLAAVLGLR-
SYC_SYNPX       SSGALAVLFDLAKPLRALANRLERG--DEPGLPEADIRNLAPRW--QLLRELAVVLGLR-
SYC_PROMM       SSGAIAVLFDLARPLRALANRLKRG--DTKAIQETAKLNLLPRW--QLLVELANVLGLE-
SYC_SYNSC       SSGGLAVLFDLAKPLRSLANRLERG--EDAALPELELKGLEGRW--QLLRHLAAVLGLR-
SYC_PROMA       TSVAISILFELARPLRSLSNQIENG--SSELISESDKHTSYSRW--LLLTELANVLGLQ-
SYC_PROMT       TSGALSILFELSQPIRKIINFLKEK--DINEVDQDELNQVFNKW--ELLSELAGVLGLK-
SYC_PROM9       TAGAIAIIYDLAKPLKNFLNQFQRI--EGLKIDLNEKFFLLENF--KTLEKLTEVLGLK-
SYC_PROMP       TAGAIAIIYELAKPLKNFINQFQRI--KNLEINTNEKFHLRETF--KTLEELTDVLGLK-
SYC_AQUAE       TPEALSHVYKLVGELNKVKNKAYSE--GKITDRELSAYEFASKSLLNTMKKIFGLLEDLY
SYC_THEMA       TPVAVSLIFELARNLSKAMDDNDRE--DALLYYHLIRREFGPVLGLFDLNE---------
SYC_BACAN       TANAITELYNVANHANQYLLEEHTS--TVVIEAYVKQLETLF----DILGLELAQEE---
SYC_BACHK       TANAITELYNVANHANQYLLEEHTS--TVVIEAYVKQLETLF----DILGLELAQEE---
SYC_BACCZ       TANAITELYNVANHANQYLLEEHTS--TVVIEAYVKQLETLF----DILGLELAQEE---
SYC_BACC1       TANAITELYNVANHANQYLLEEHTS--TVVIQAYVKQLETLF----DILGLELAQEE---
SYC_BACCR       TANAITELYNVANHANQYLLEEHTS--KVVIEAYVKQLETLF----DILGLELSKEE---
SYC_BACLD       TANAISVLFDLAKHANYYLQEKNTA--EHVIQAFIQLFDEIC----SVLGFSLKEQE---
SYC_BACSU       TANAISVLFDLAKHANYYLQKDHTA--DHVITAFIEMFDRIV----SVLGFSLGEQE---
SYC_GEOKA       TANGIAVLFELAKQANLYLQEKTTS--EKVIHAFLREFEQLA----DVLGLTLKQDE---
SYC_OCEIH       TANAISVLFDLSKEANVYLQENQTS--TEVIDAFQDAISQIL----TVLGINILEDEET-
SYC_BACSK       SANAISVLFDLAKEANIYMSEAQTS--KKVLNAFLELFAEFG----EVLGVSFTQQEEE-
SYC_BACHD       SANGIAVLFDLAKEANRYLREEQTS--KAVLQSFIDLFNELG----GVLGVTLNRQEE--
SYC_LISMO       TANAITTFHELAKRANIYLAKETVS--INVLREFLSMMRLFA----EVLGLKLENTQTDS
SYC_LISMF       TANAITTFHELAKRANIYLAKETVS--INVLREFLSMMRLFA----EVLGLKLENTQTDS
SYC_LISIN       TANAITTFHELAKRANIYLSKETVS--INVLREFLSMMRLFA----EVLGLKLENTQTDS
SYC_STAAC       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKNADE
SYC_STAA3       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKNADE
SYC_STAAM       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKNADE
SYC_STAAN       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKNADE
SYC_STAAS       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKNADE
SYC_STAAW       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKNADE
SYC_STAAB       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKNADE
SYC_STAAR       TANAITAWYDLAKLANKYVLENTTS--TEVIDKFKAVYQIFS----DVLGVPLKSKKADE
SYC_STAES       TANAVTAWYDLAKLANKYVLENTTS--TKVLNRFKEVYSIFS----DVLGVPLKSKETEE
SYC_STAEQ       TANAVTAWYDLAKLANKYVLENTTS--TKVLNRFKEVYSIFS----DVLGVPLKSKETEE
SYC_STAHJ       TANAVTAWYDLSKLANKYVLENNTS--TQVISRFKEVYQIFS----DVLGVPLKGNKSDM
SYC_STAS1       TANAITAWYDLAKLANKYVLENTTS--TKVLGRFKEVYQIFS----DVLGVPLKGKDSDE
SYC_LACPL       VQNGVAAVYELAKLANVYAAKATVQ--KETLIALQKALVQLT----GVFGVTFETANAT-
SYC_LACSS       VQNGLTQLYELAKLSNQYLEQPTVQ--SDTLTSLATRLTRLL----AIFGVVFKADQ---
SYC_ENTFA       AANGITVVYELAKMMNQYSEQATVS--EPVLVAMDKLFSGWL----AIFGLFFKNEE---
SYC_LACAC       VQNALTSIYDLLPVVNANANSDNVD--KDALKLFEEKLAAWL----LVFGVDIKKLCAQT
SYC_LACJO       VQNALSIMYDLATTLNNHLQKDQVD--KPALKRAKKLLIAWL----EIFGVSFKEEQAE-
SYC_STRA1       TANGITVIFEMAKWINSGHYTS----------RVKETFAELL----EIFGIVFQ-EEVL-
SYC_STRA5       TANGITVIFEMAKWINSGHYTS----------RVKETFAELL----EIFGIVFQ-EEVL-
SYC_STRA3       TANGITVIFEMAKWINSGHYTS----------KVKETLAELL----EIFGIVFQ-EEVL-
SYC_STRPM       TANGITVVFDMAKWINSGSYTE----------PVKSAFEKML----AVFGIIFE-EEVL-
SYC_STRP3       TANGITVVFDMAKWINSGSYTE----------PVKSAFEKML----AVFGIIFE-EEVL-
SYC_STRP8       TANGITVVFDMAKWINSGSYTE----------PVKSAFEKML----AVFGIIFE-EEVL-
SYC_STRP6       TANGITVVFDMAKWINSGSYTE----------PVKSAFEKML----AVFGIVFE-EEVL-
SYC_STRP1       TANGITVVFDMAKWINSGSYTE----------PVKSAFEKML----AVFGIIFE-EEVL-
SYC_STRT2       TANGVTVLFDMAKWINSGNYDE----------TVKDAFEKIL----QVFGIVFE-EETL-
SYC_STRT1       TANGVTVLFDMAKWINSGNYDE----------TVKDAFEKIL----QVFGIVFE-EETL-
SYC_STRMU       TANGITVVFELAKWINSGHYDQ----------TVKDKFAEIL----QIFGVVFK-EEVL-
SYC_STRPN       AANGITVVFEMAKWINSGNYDA----------SVKQALADML----EIFGIVFV-EEVL-
SYC_STRR6       AANGITVVFEMAKWINSGNYDA----------SVKQALADML----EIFGIVFV-EEVL-
SYC_LACLA       IANGMTVFYDFVSWVNKGNGGP----------EVKEFFDQVL----EILGIKFKFEQSL-
SYC_CLOPE       TADAITAIFDLIKDTNTNITIDS-S--KELAQKALELIRELG----APLGMFQKSTKGNL
SYC_CLOTE       TADAIAVIFDMIRDINSNVKSDS-S--KKIIEYALSIIRELG----SPLGILQKSTEESV
SYC_CLOAB       TADGISVIFDLAKDINININGKS-S--KAAVEKAISLMRELG----KPLGILQKVEKHNL
SYC_CALS4       TADAISVLFEMAKTANANLSGNS-S--KKLVEYILEMFLKLS----DVLGLSYKNAETEI
SYC_SYMTH       TAEGLAVIFDLSRELNSRVKPGA-S--AAFAEGGLALLRELA----GVLGLLERKAQPQE
SYC_CARHZ       TAQAMASLFELVRFGNTQIASGNLT--AGDKKLFEEALNVYT----QVFGIEFGVLEKIA
SYC_MOOTA       TARALAALYDLAREINSYL-NGTTT--IDPAALRTAAITFEQLGG-EVLGLFGQARQQVD
SYC_FUSNN       TAQALGHIFELVKAVNKTLDEANIS--KKGLEVIDEVYSYLVMIIQDVLGVQLKLEVEVN
SYC_DEHM1       TSAALATIFDLGRELNRIEAEGGKS------TQGQELFKELA----GILGLSLIIAEPTT
SYC_DEHMC       TSAALATIFDLSRELNRIEGEAGKS------TDGQKLFKELA----DILGLSLIVAESKT
SYC_BDEBA       TPDAFAAMFEVVRQFNAQVRRGMKA--NPAIQGKALAFHNFVRKMGSMMSLFQEPAHAFL
SYC_COREF       VPKALAEIHNAVREGNSALAA----GEME----KARELAGAVRAMTGVLGFDPVE--WGT
SYC_CORGL       VPKALAEIHNAVREGNAALDK----GDRE----AAEKLASSVRAMTGVLGFDPVE--WGS
SYC_CORDI       VPRALAEIHTQVRHGNSALAA----GDVD----KAHEIAASVRAMAAVLGVDPLDEKWLD
SYC_CORJK       VPQSLAVIHDVVREGNKLLDA----KPTDEAKQQVKEIAGQVRAMAAVLGVDPLSEAWLE
SYC_MYCBO       VPIALAEIHHVRAEGNRALDA----GDHD----GALRSASAIRAMMGILGCDPLDQRWES
SYC_MYCTU       VPIALAEIHHVRAEGNRALDA----GDHD----GALRSASAIRAMMGILGCDPLDQRWES
SYC_MYCPA       VPAALAEVHQARAEGNRALDS----GDHE----GALRQARSIRAMMGILGCDPLHERWET
SYC_MYCLE       VPIALAEVHHARVEGNRALDI----GDHE----GALTNAGAIRAMMGILGCDPLDERWES
SYC_NOCFA       VPRALAEVFRLVTEGNKALEA----GAVD----TARELGGQVRAMLGILGVCPFDPQWDH
SYC_STRAW       VPQALAIVHTTVRQGNSALAA----DDKE----AAVARLAEVRAMLGVLGLDPLDPQWAG
SYC_THEFY       VPQALAVAHNHVREGNSALAE----GAKE----RAAQIGARLRAMLAVLGLDPLSPQWAG
SYC_LEIXX       VPQALAVLHETVRSGNAALDA----EDLE----AAAAARGQVFAMTEVLGINPLSPQWRQ
SYC_CUTAK       TPQAVAALFSQITEGNKSVSI----GDAE----ATRHHLSQVKAMLAVFGLDPQAPEWAD
SYC_BIFLO       VSGATAAIFTAIRSGNTLLSQLADRADSETAKAEVREALLAVRAMLDTLGLDPLAEPWVS
SYC1_TROW8      IPEALAIVHNKVREMNRLVDT---QADMQ----YLGNTLSEVVEMLSILC--PIDHKITY
SYC1_TROWT      IPEALAIVHNKVREMNRLVDT---QADMQ----YLGNTLSEVVEMLSILC--PIDHKITY
SYC_FRACC       VGRALAALFGAVSQGNQVLSK----AHSR----ELAGWVDVTRRMLNIFGLDPHEQWPTA
SYC_RHOBA       TGAAISVLFDALRTLNRHIDANQLAAGADAKSPAVESLVKATSVIAELSRVLGLFAKPPA
SYC_BACFR       TPIVISHLFDGAKMINNIIAGNNTIS----ADDLKDLKEVFHTFCFDILGLKEE-----I
SYC_BACFN       TPIVISHLFDGAKMINNIIAGNNTIS----ADDLKDLKEVFHTFCFDILGLKEE-----I
SYC_BACTN       TPIVIAQLFEGARIINNINAGNATIS----AEDLKDLKETFHLFCFDIMGLKEE-----K
SYC_PORGI       SPMVIAALFDAARAINAVHNGQGTIT----SSNLEELRTTFRLFLFDLLGMRDE-----R
SYC_CHLCH       TPIAIAVLFDLSKAINSALD-SKGIV----EADRAAIEAFLTIAATNTLGIASNNLADEQ
SYC_PELLD       TPVAIAALFDFSKALNTALDRPDGLN----ASSLEAARELFSTAAVTVLGIMTEDAEGGM
SYC_CHLTE       TPVAIAVLFEFIKALNGALD-KDGLD----AASKSGAQNLFDSYAGKVLGILKSRDELLA
SYC_THET2       TPEALAALFAFLPELHKLLP-EAKA------ESLARAEAVFHTLGEGILGLFPER-VLEE
SYC_THET8       TPEALAALFAFLPELHKLLP-EAKA------ESLARAEAVFHTLGEGILGLFPER-VLEE
SYC_DEIRA       TPKAVASLFGLTGELNTALN-AGPVG----RDTLERARDAYRSLGGDVLGLFAET-GSAA
SYC_BORBU       VAQGLALLWEIIKSDNLSFVSKL--------RLAFIFDEIMSLNLREEILKNLQNHDVVI
SYC_BORBP       VSKGLALLWEVIKSENLGFVSKL--------KLAFIFDEIISLNLREEILKKSENHNIVI
SYC_TREDE       TPKALSELQLLIKEKDIPQKDVL--------TVLAAMDSILGIKLIEESFNTLKDKGSIE
SYC_TREPA       TPRALSALQKLVRDTSVPPSLCV--------SALQVADTVLGLGIIQEATASLSAQVPAG
SYC_NOVAD       TAVALTVFEEVLGLKKVDPADKL--------AAVAAMDAVLGLGLLELDRRALRIRPKGV
SYC_ZYMMO       LPQALPLLEETLGNKKLQPEEQL--------RLIASMDMILGLNLLHLDRASLNIRPKNA
SYC1_BURL3      LPRALAVLWDLV-RSNLPPATLK--------ATVDSFDMVLGLGLREW-------RPVAV
SYC_SALRD       TAAALDGVKAIEQTDRLNGATAR--------SARNWLDRTNALLGVVEPEHEADQRTDAG
SYC_CHLTR       ISSSLAALFDFIRKINSSIDQHTGIQTETDSSVFSKQDAQHILALLRKIDQVLGVLPFSQ
SYC_CHLTA       ISSSLAALFDFIRKINSSIDQHTGIQTETDSSVFSKQDAQHILALLRKIDQVLGVLPFSQ
SYC_CHLMU       ISSALASLFDFIRKINGMIDRQS-IQEET-SSEFSKQDAQHILSLLRQIDQVLGVLPFSQ
SYC_CHLCV       IAAALAALFDFIHQTNSTIDQAN----------FTQADANYVLDIMKRINTVLGVIPFSA
SYC_CHLFF       IAAALAALFDFIHQTNSFIDKSK----------FTQADANYILDLLKKINTVLGILQFSA
SYC_CHLAB       IAAALASLFDFIHQTNSRIDQSH----------FTQADSHYVLDILKKINTVLGVIPFST
SYC_CHLPN       VSTGFASLFDFVHEINTLIDQGH----------FSKADSLYILDTLKKVDTVLGVLPLTT
SYC_PARUW       ISSALAAIFDFVREINCLCDVNQ----------VSQKEAETVINLMKKFDTILGVLTFDK
SYC_LEPIN       ISKALAVVFESVKQINSLLDTNQ----------SDSKQRIEYIQILAYFDRILGVLNFES
SYC_LEPIC       ISKALAVVFESVKQINSLLDTNQ----------SDSKQRIEYIQILAYFDRILGVLNFES
SYC_CAMJE       VSKALALLDDFISSANLELDKESKN------KILKQNIKEALSELAKIFGFGFMDATLYF
SYC_CAMJR       VSKALALLDDFISSANLELDKESKN------KILKQNIKEALSELAKIFGFGFMDTTLYF
SYC_HELPY       VSKALSVLESMLSSTNEKLDQNPKN------KALKGEILANLKFIEELLGIGFKDPSAYF
SYC_HELPJ       VSKALSVLESMLSSTNEKLDQNPKN------KALKGEILANLKFIEELLGIGFKDPSAYF
SYC_HELHP       ISKALSIIEDMLSTSNEYLDKNPKD------KAYKQAIKANLACIEFLLGLGGKSTQSYF
SYC_WOLSU       ISRALSAMDEMLTLSNEELDSSPKE------RALQATIRGNLEVLERLLGIGAKSPILYF
SYC_SULDN       ISASLALIEEMITRANETLDTAGKH------KELKREALSNLSFIEKILGFGIKNPYEYF
SYC_AYWBP       THKVIDLMEQIIKRAHQTQ------------------ILDKLSQFQNSLLLILNTLVIA-
SYC_ONYPE       THKVIDLMEQTIKQAHQTQ------------------ILDKLSQFQNSLLLILNILGIT-
SYC_MYCCT       TSLVLSLIDSLIKQINKNI---------------LDNISDNFNLLISSLSYILDVLGFKD
SYC_MYCMS       TSLVLSLIDLLIKQINKNI---------------VDKNLDNFNLLIGSLNYILDVLGFDN
SYC_MESFL       TSRVLTLLEDTLKDINKLS---------------TLKEFDDLFLKINSLNYILKTLGLSI
SYC_MYCGA       FANATKVIWDLIKVLNESI---------------AYKKIDENIWAYQQLIWCLEIYGI--
SYC_UREPA       FVGIVDLIHISVKKINILIK--------------ENKDMNELKLNLTQLLYMLDILGI--
SYC_MYCPE       LPNIVSFIEEKIKYSSILLR--------------NKNFEELNKLHFNLSYLLTKILGI--
SYC_MYCH2       FAKANFLIMELIKQ----------------------KENSTIRKIFLNLRFNFTKMHL--
SYC_MYCMO       FSKINFEINLQIKLFNSVV---------------DLDAANKLVECFKLLGFKFSSQNV--
SYC_MYCGE       FANAVAAIWKLIKKINTSI---------------KTKDFSVLREQLSFLEWSIDLLGI--
SYC_MYCPN       FANAITHIWKLVKQINHDV---------------SKQNLSGLKEHLSHLEWALNILGI--
                                                                            

SYC_AGRFC       --------------------------------EMDEAIVSAVDALVELRLEMLKAKNFAE
SYC_RHIEC       --------------------------------EIDEAFAAAVDALVAMRLEVLKAKNFVE
SYC_RHIME       --------------------------------ELDEAVVHEIDGRVRERLELLKAKNYAE
SYC_RHILO       --------------------------------DIDE---DGVAKAIANRLALIAAKNWTE
SYC_NITWN       --------------------------------SQEQYASSNVDELVVARLEARMRKDFKE
SYC_BARHE       KCPLFMRK--------------------------TSLDEKFIDQRIAERLRLIHNKEWTA
SYC_BARQU       ECPLFMRK--------------------------ISLNSKFIDQRIAERLRLIHNKEWAA
SYC_BRUAB       DVPIFAR---------------------------ADVDASAIAARIAERLNFINAKNWAE
SYC_BRUA2       DVPIFAR---------------------------ADVDASAIAARIAERLNFINAKNWAE
SYC_BRUME       DVPIFAR---------------------------ADVDASAIAARIAERLNFINAKNWAE
SYC_BRUSU       DVPIFAR---------------------------ADVDASAIAARIAERLNFINAKNWAE
SYC_RHOPA       RAPV------------------------DLDATAKSL--------IEARTAARANKDWKE
SYC_RHOP2       RRPVGVRINLPPA--------HAEAAVGTVEVLAKPLSKSEIEERIDARTAARARKDFKE
SYC_RHOPB       RKHVRLYAEGAFV--------AAGGGTATFSTASSSVERSDIQQLIDARAAARARKDFKE
SYC_BRADU       QWE-------------------------DRKQKASGVDAGEVERLISERTAARGRKDFKE
SYC_JANSC       --------------------------VPDWSEIAEVDLTYFAGRFSSARAEAMVTKDFTD
SYC_RUEPO       ------------------------FGVASFGFSTSVEVLEAANDLARRWMAYRDAKNFEE
SYC_RHOS4       WARPYAFEELDGRFLREGIDYQPTVGVIGWGEITD-QARETSIGLLHRWLALRRAGDFET
SYC_ANAMM       ------------------------------LDMRGLVDEGEINRLIEKRVEAKKCGDFKL
SYC_ANAPZ       -------------------------------SAEEAVDVDKIQELLERRREARNGGNYSL
SYC_EHRCJ       -------------------------------WFRVNENDQEIDKLIDERRIARANNDFKK
SYC_EHRCR       -------------------------------WFKIDDNNQEISQLIDERKKARANNDFKR
SYC_EHRRG       -------------------------------WFKVD-NDQDIIQLIHERKMAKTNGDFIK
SYC_EHRRW       -------------------------------WFKVD-NDQDIIQLIHERKMAKTNGDFRK
SYC_WOLPM       -------------------------------WFAVDVNHQEIERLIDLRKIAKKNKNYDT
SYC_WOLTR       -------------------------------WFTAGISYQEIKRLIDLRKVAKQNKDYDA
SYC_NEOSM       -----------------------------------SVSEDFIRSQLQKRADCKRQKDFVE
SYC_RICCN       ---------------------------------NSGVDELYVNELVNKRLEAKKQKNWLL
SYC_RICFE       ---------------------------------NSGVDELYINELLNKRLEAKKQKNWLL
SYC_RICPR       ---------------------------------NRDVDEFYINELINKRLKAKKQKNWLL
SYC_RICTY       ---------------------------------NNDIDKLYINELINKRLKAKKQKNWLL
SYC_RICBR       ---------------------------------NKDVDENYINNLINERLEAKKQKNWGL
SYC_PELUB       E----------------------------FKKKKSSINEDDILEMISLRNKAREDKNYKE
SYC_XANOR       SR---------------------------GTDADDD---ARITALVQERSAAKKAKDFAR
SYC_XANOM       SR---------------------------GTDADDD---ARITALVQERSAAKKAKDFAR
SYC_XANAC       SR---------------------------GTDAGDD---ARITALVEERSTAKKAKDFAR
SYC_XANC5       SR---------------------------GTDAGDD---ARITALVEERSAAKKAKDFAR
SYC_XANCP       SR---------------------------GADAGDD---ARIAALVDERSAAKKAKDFAR
SYC_XANC8       SR---------------------------GADAGDD---ARIAALVDERSAAKKAKDFAR
SYC_XYLFA       SQ---------------------------GTNESDE---THIQALIDARGAAKQARDFVR
SYC_XYLFT       SQ---------------------------GTNESDE---THIQALIDARGAAKQARDFVR
SYC_CAUVC       EG---------------------------DASDELK---AQVEDLLAKRVAARAAKDWSA
SYC_MAGSA       KG---------------------------TGAADGP-SDAEIEAAITARAEARKSRNFAE
SYC_RHORT       CG---------------------------AGTGEEEGLAARVEDLICQRKAARQARDFAR
SYC_GLUOX       QS---------------------------GVD------ASAIEKLIEERLAARKSRDFAR
SYC_SACD2       KA---------------------------TTSGSSELSAEDIEQLIVERKDAKLAKNYAR
SYC_PSYA2       QAVI-----------------------GEAAE--DGLTDEAIDSLIIERADAKTNKNFAR
SYC_PSYCK       QAVI-----------------------GEVAE--DSLTDEAIDGLIIERADAKTNKNFAR
SYC_ACIAD       KSDI-----------------------GQEVL---SLSDDEIQAMIQQRADAKKAKDFSG
SYC_PSEF5       QA-------------------------GAE----GRVDGAQVEALIQARLAARANKDWAE
SYC_PSEPF       QA-------------------------GAE----GRVDAAEVDALIQARLTARANKDWAE
SYC_PSE14       RA-------------------------GAE----GRVDAAQVEALIQARLAARAAKDWAE
SYC_PSEU2       RA-------------------------GAE----GRVDAAEVEALIQARLAARAAKDWAE
SYC_PSESM       RA-------------------------GAQ----GRVDAAEVEALIQARLAARAAKDWAE
SYC_PSEPK       RA-------------------------GAE----GKVDAAEVEGLIQARLKARADKNWAE
SYC_PSEAE       QA-------------------------GAE----GKVDAAEVEALIQARLEARAAKNWAE
SYC_HAHCH       QG-------------------------EGEEV--GGLSVAEIEDFIAQRNAARANKDFAE
SYC_BURMA       QHAAGA---------------------ARTGA----LEPHEIEARIAARVAAKQAKNYAE
SYC_BURPS       QHAAGA---------------------ARTGA----LEPHEIEARIAARVAAKQAKNYAE
SYC_BURP1       QHAAGA---------------------ARTGA----LEPHEIEARIAARVAAKQAKNYAE
SYC_BURTA       QQAAGA---------------------ARTGA----LEPDEIEARIAARVAAKQAKNYAE
SYC2_BURL3      QQASGA---------------------AQAGG----LAADEIEAKIAARVAAKQAKDYAE
SYC_CUPPJ       QGG--K---------------------KVDG-----PSPDEIEGLIAARKTAKAERNFAE
SYC_RALSO       QGGVGA---------------------AADG-----LDAAEVEARIEARRAAKAARDFAR
SYC_DECAR       QGG------------------------AGVGG----LDEAAVGQMIVDRAAAKKAKNFAE
SYC_AROAE       QGRMAG---------------------EPDK-----GEGVAIESMIERRALAKKSKDYAE
SYC_THIDA       QAG------------------------TSEAG----LDASEIEARIAARQAARKARDFAE
SYC_NEIG1       QGG------------------------AVSDG----LSNEEIEDLIARRKQARADKNWAE
SYC_NEIMB       QGG------------------------AASDG----LSNEEIEDLIARRKQARADKNWAE
SYC_CHRVO       QGG------------------------VGEGE----LSAEQVEALIQARKDARAAKDWAE
SYC_NITEU       QYPAH----------------------LQDGQ----YSVEEIENMIQQRLQARKERNFAQ
SYC_NITMU       Q-QAD----------------------SEDPA----FAPEKVEQLIQQRLVARANKDYRE
SYC_BORBR       QSPTRYSAA-------------AREQGAPAAA----LDAAAIEARIAERAAAKAARDFAR
SYC_BORPA       QSPTRYSAA-------------AREQGAPAAA----LDAAAIEARIAERAAAKAARDFAR
SYC_BORPE       QSPTRYSAA-------------ARGQGAPAAA----LDAAAIEARIAERAAAKAARDFAR
SYC_BORA1       QSSTRYSSA-------------GMQQGA--SQ----MDAARIEALIAERGQAKLSRDFAR
SYC_RHOFT       QAG---------------------------AT----LDAASIAALIAQRTAAKAAKNFAE
SYC_METCA       KS------------------------DAGGSG----LSDADIETRIRARLEARKAKNWAE
SYC_NITOC       RDSRQVAAI----------------PDTAAAGEEAVLSHDGIEQLVAQRTVARKNKDWAE
SYC_HYDCU       KS------------------------QPSDSD----LTDEMIEALIVERAEARKAKDFSR
SYC_LEGPL       QSGLAE------------------------------EEKLVIEQLIAERLKARAERNWTK
SYC_LEGPA       QSGLAE------------------------------EEKLVIEQLIAERLQARAERNWAK
SYC_LEGPH       QSGLAE------------------------------EEKLVIEQLIAERLQARAERNWAK
SYC_BLOFL       GYNTCIKNN-------------KQ-----------SLTVEKIRELIYMRENARKNKEWQL
SYC_BLOPB       KKITLKHNK-------------NR-------------HFEKIQKLIQCREVARKNNQWEL
SYC_BUCAI       QKKTTLN----------------------------LLTLKEIQLLIEKRNIARQSKLWQE
SYC_BUCAP       QKKLPFD----------------------------EEIIKKIESLIEKRNFARKSKLWKE
SYC_BUCBP       QNNFNCN----------------------------NSIIGKINSLIYERDKARRVKDWVR
SYC_WIGBR       NNKLKFS----------------------------KDKINKIKSIIKKRENYRKLKQWEK
SYC_COLP3       Q--GDND----------------------------NDEVAIIEALIVQRNQARIDKDWAM
SYC_PSET1       Q--GGQD----------------------------DDEVAQIEALIVKRNDARASKNWAA
SYC_IDILO       Q--G--D----------------------------DDDVAKIEALIAKRNQAREDKDWAA
SYC_ECOL6       QSGAQAD----------------------------DSEVAEIEALIQQRLDARKAKDWAA
SYC_SHIFL       QSGAQAD----------------------------DSEVAEIEALIQQRLDARKAKDWAA
SYC_ECOLI       QSGAQAD----------------------------DSEVAEIEALIQQRLDARKAKDWAA
SYC_ECO57       QSGAQAD----------------------------DSEVAEIEALIQQRLDARKAKDWAA
SYC_SHISS       QSGAQAD----------------------------DSEVAEIEALIQQRLDARKAKDWAA
SYC_SHIBS       QSGAQAD----------------------------DSEVAEIEALIQQRLDARKAKDWAG
SYC_SHIDS       QSGAQAD----------------------------DSEVAEIEALIQQRLDARKAKDWAA
SYC_SALCH       QSGAQAD----------------------------DGEVAEIEALIQQRLDARKAKDWAA
SYC_SALTY       QSGAQAD----------------------------DGEVAEIEALIQQRLDARKAKDWAA
SYC_SALPA       QSGAQAD----------------------------DGEVAEIEALIQQRLDARKAKDWAA
SYC_SALTI       QSGAQAD----------------------------DGEVAEIEALIQQRLDARKAKDWAA
SYC_PECAS       QNGAQVN----------------------------DDEVKEIEALIQQRKDARATKDWAL
SYC_YERPE       QGGAQAD----------------------------DDEVAKIEALIKQRNDARSSKNWAL
SYC_YERPS       QGGAQAD----------------------------DDEVAKIEALIKQRNDARSSKNWAL
SYC_PHOLL       HRGIQAD----------------------------DEEIAKIEALIKQRNDARKNKDWPL
SYC_SODGM       QQGAAED----------------------------N---VMIEALIQQRNDARKARQWAL
SYC_VIBVU       K-GDAGN----------------------------DDEVAEIEALIKLRNDSRAAKDWAN
SYC_VIBVY       K-GDAGN----------------------------DDEVAEIEALIKLRNDSRAAKDWAN
SYC_VIBPA       K-GNAGN----------------------------DDEVAEIEALIKLRNDSRASKDWAN
SYC_VIBCH       Q-GSAE-----------------------------DEDAAQIEALIKLRNDSRATKDWAN
SYC_ALIF1       Q-GGSS-----------------------------NDDVAEIEALIKARNDARAAKDWAA
SYC1_PHOPR      Q-GGAG-----------------------------QDDVAEIETLVQQRLDARAAKDWAA
SYC_SHEON       K-GEGS-----------------------------DDEVAEIEALIVERNRARTEKDWPA
SYC_HAEDU       K--GEVN----------------------------IDQTAEIEALIQQRNQAKANKNWAV
SYC_MANSM       Q--GDAA----------------------------DAEVSKIEALIKRRNEARAAKDWAA
SYC_HAEIN       Q--AGSN----------------------------DDEVAKIEALIKQRNEARTAKDWSA
SYC_HAEI8       Q--AGSD----------------------------DDEVAKIEALIKQRNEARAAKDWAT
SYC_PASMU       Q--SGSD----------------------------NDEVALIEALIKQRNDARAAKDWAS
SYC_FRATH       KQGDGAD-------------------------------ASEIEKLIAERTQAKKDKNYAR
SYC_FRATT       KQGDGAD-------------------------------ASEIEKLIAERTQAKKDKNYVR
SYC_COXBU       QGAKKEA------------------------------DVQEIKKLIDQRNEARAKKDWKT
SYC_DESAG       REMRDCR------------------------AARRDVDTARVETLLLERQEARKAKDFER
SYC_DESVH       SDLKECR------------------------IRRKGIDTTKVDALLEERKSVRAAKDFAR
SYC_ANADE       SAIRDRA------------------------AARRGIDGSEVERLIAERAAARAAKDFAR
SYC_GEOMG       ERLKNRK------------------------AAELPITAEEIERLIAERIAARANRDFKR
SYC_GEOSL       ERLKSRK------------------------AAALPIEAAEIERLIEERNAARKARDFRR
SYC_PELCD       KQMNLAM------------------------LATTGYTESDIEDFIRQRQEARKNKDFAR
SYC_DESPS       QQRKEKM------------------------LSGIDITEAEIESYIQQRLDARANKDWAR
SYC_NOSS1       -----------------------EAKLDDETQTQAGLSDTDIEALIEQRQAARKNKNFSE
SYC_TRIV2       -----------------------EATPDDETLTQPGLSDTDIEALIEQRQAARKNKNFSE
SYC_SYNY3       -----------------------SINPESQSSNDNGLTDGDIEQLVAQRTQARKDKNWAE
SYC_SYNP6       -----------------------EAEPELAETNE--LDEAAIEDWIAKRHAARQAKDFAE
SYC_SYNE7       -----------------------EAEPELAETNE--LDEAAIEDWIAKRHAARQAKDFAE
SYC_THEEB       -----------------------EAKEESNPALTVELTDEEIQALIAARTAARQAKNYTE
SYC_GLOVI       -----------------------KAAEPEARQSA--LPEAEIEAQIALRRQAREERNWAE
SYC_SYNJB       PSFSEFEGS-------------KEAATNGELNF------KKIEELIAQRSAARKAKNFSE
SYC_SYNJA       PQPAQ--GS-------------EKAAANGELAKLPPLEDARIEELVAQRTAARKAKNFAE
SYC_SYNS9       ----------------------READSESSGPGDDSTNQDEIQAAIDARIAAKSAKNYAE
SYC_SYNPX       ----------------------GETSGQSN------MDDESIDATIAARKAAKAAKNYAE
SYC_PROMM       ----------------------AEKAAQPAPERNNRVDENHIQRAIATRKEAKAARDFAK
SYC_SYNSC       ----------------------SEAEAAPS------LDDGAIDVAIAARKAAKAAKDFAE
SYC_PROMA       ----------------------AELPKTRTSKQSQNLDEVLIREAIQERKDAKLSGDFAK
SYC_PROMT       ----------------------VNLNQEKP-KNNPELDTNKIEELIKNRSLAKANKDFLL
SYC_PROM9       ----------------------KEVLVKER-----KITEEEISSLINERLKAKKGKNYAK
SYC_PROMP       ----------------------KEEIIIDN-----RINEDQILSLINKRLGAKKEKDYAE
SYC_AQUAE       PECKV------------------ERVVERELEAGQVFDEKLIQILIEARNIARKEKVFKV
SYC_THEMA       -------------------------------EKKEVSSEELLKLLIEVRDVLRKEKRYDL
SYC_BACAN       ------------------------------------LLDEEIEALIQKRIEARKNRDFAL
SYC_BACHK       ------------------------------------LLDEEIEALIQKRIEARKNRDFAL
SYC_BACCZ       ------------------------------------LLDEEIEALIQKRIEARKNRDFAL
SYC_BACC1       ------------------------------------LLDEEIEALIQKRIEARKNRDFAL
SYC_BACCR       ------------------------------------LLDEEIEELIQKRIEARKNRDFAL
SYC_BACLD       ------------------------------------LLDKDIEELIEKRNEARRNRDFAT
SYC_BACSU       ------------------------------------LLDQEIEDLIEKRNEARRNRDFAL
SYC_GEOKA       ------------------------------------LLDEEIEALIQKRNEARKNRDFAL
SYC_OCEIH       ------------------------------------LLDETIEALIKERNEARKNRNFAR
SYC_BACSK       ------------------------------------LLDAEIEALIEERNVARKERNFAR
SYC_BACHD       ------------------------------------LLDEEIERLIEERNEARKAKNFQR
SYC_LISMO       ------------------------------------LDDSEVEALIEERLQARNERNFAR
SYC_LISMF       ------------------------------------LDDSEVEALIEERLQARNERNFAR
SYC_LISIN       ------------------------------------LDDSEVEALIEERLQARNERNFAR
SYC_STAAC       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAA3       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAAM       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAAN       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAAS       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAAW       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAAB       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAAR       ------------------------------------LLDEDVEKLIEERNEARKNKDFAR
SYC_STAES       ------------------------------------LLDEDIEQLIEERNEARKNKDFAR
SYC_STAEQ       ------------------------------------LLDEDIEQLIEERNEARKNKDFAR
SYC_STAHJ       ------------------------------------LLDEDIEKLIEERNEARKNKDFAR
SYC_STAS1       ------------------------------------LLDEEVEALIEERNNARKDKDFAR
SYC_LACPL       ------------------------------------LADDAIQALIDEREAARKAKDFAK
SYC_LACSS       ------------------------------------LLDTEVESLIEERQAARAAKDFAK
SYC_ENTFA       ------------------------------------LVDAQVDALIEERNQARKDRDFAR
SYC_LACAC       TG----------------------------------SNDEEIEELVSKRDEARNNKDWAT
SYC_LACJO       -------------------------------------NDDEIEKLIAQRDEARKNKDWAE
SYC_STRA1       --------------------------------------DADIESLIEQRQEARANRDFAT
SYC_STRA5       --------------------------------------DADIESLIEQRQEARANRDFAT
SYC_STRA3       --------------------------------------DADIESLIEQRQEARANRDFAT
SYC_STRPM       --------------------------------------EVDIEALIAKRQEARANRDFAI
SYC_STRP3       --------------------------------------EVDIEALIAKRQEARANRDFAT
SYC_STRP8       --------------------------------------EVDIEALIAKRQEARANRDFAT
SYC_STRP6       --------------------------------------EVDIEALIAKRQEARANRDFAT
SYC_STRP1       --------------------------------------EVDIEALIAKRQEARANRDFAT
SYC_STRT2       --------------------------------------DEDIEKLIEERQAARANKDFAT
SYC_STRT1       --------------------------------------DEDIEKLIEERQAARANKDFAT
SYC_STRMU       --------------------------------------DAEIEKLIEERQKARAARDFTK
SYC_STRPN       --------------------------------------DAEIEDLIQKRQEARANRDFAT
SYC_STRR6       --------------------------------------DAEIEDLIQKRQEARANRDFET
SYC_LACLA       --------------------------------------DSEIEAMIEARQLAREVRDFAK
SYC_CLOPE       -------------------------------------EEE-IEALIAKRQQARKDRDFAL
SYC_CLOTE       -------------------------------------EDE-IQQLIDRREKARTEKNWAL
SYC_CLOAB       -------------------------------------EDE-IQNLIEQRQNARKNKDWAL
SYC_CALS4       -------------------------------------EDEEILRLIEERQKARKEKNWKL
SYC_SYMTH       -------------------------------------LDAEIEALIAARQEARKARNFAE
SYC_CARHZ       GE----------------------------------DITPFVELLIEVRARLKKEKKYDL
SYC_MOOTA       DE----------------------------------LLSGLMDLILQVRQEARQRRDWAT
SYC_FUSNN       N-----------------------------------ISADLIELILELRRNAREEKNWAL
SYC_DEHM1       SA----------------------------------DAAPFIDMLIELRKDLRLAKQYQL
SYC_DEHMC       GT----------------------------------DVAPFIELLIELRKDLRVAKQYQL
SYC_BDEBA       ------------------------IKLDDMLLKKMNLERSAVDALVAERGEARAAKDFAK
SYC_COREF       QTD-DSAAH--------------------------EALEVLVHAELERRATARAEKDWAV
SYC_CORGL       DAGADGKAD--------------------------KALDVLISSELERRATARAEKNWAV
SYC_CORDI       SAASDSSTN--------------------------AALDVLVQAELQRRTEARAAKDWAT
SYC_CORJK       STKAAAGGSDVA----------------------MGALDVLVKAELERRAEARAAKDWAT
SYC_MYCBO       RDETSAALA---------------------------AVDVLVQAELQNREKAREQRNWAL
SYC_MYCTU       RDETSAALA---------------------------AVDVLVQAELQNREKAREQRNWAL
SYC_MYCPA       RDETSAALA---------------------------AVDVLVRAELQNREKAREQRNWAL
SYC_MYCLE       RDETSAALA---------------------------AVDVLVAAELESRQMAREQRNWVL
SYC_NOCFA       KQDDSVAQT---------------------------ALDVLVRAELDRRQQARADKDWAT
SYC_STRAW       EGDRGEDLHG--------------------------VVDTLVRMVLDQREAARARKDWAT
SYC_THEFY       SDDSG--LHD--------------------------VVDSLVSVVLEQRQEARKRKDYAT
SYC_LEIXX       TGSSAA----------------------------EQALGTLVERLLHNRQEARQVRDFVA
SYC_CUTAK       VAGSDDRL--------------------------EPVVDGLVHAMLEQRAEARARKDWAT
SYC_BIFLO       AGGAADGTAESPE---------------------HAALEALIAEQLNARAEARKAKDFAK
SYC1_TROW8      TSGAQDNSK------------------------------ALLQVLLEARDRARSKGDFYT
SYC1_TROWT      TSGAQDNSK------------------------------ALLQVLLEARDRARSKGDFYT
SYC_FRACC       GAEFRP------------------------------ALDGAMQVVLDLRSAARARRDYAE
SYC_RHOBA       TSGGDEADAE--------------------------LLDSVVHLLINLRKEARERKDYAT
SYC_BACFR       GSSDGREAA----------------------------YGKVVDMLLEQRVKAKANKDWAT
SYC_BACFN       GSSDGREAA----------------------------YGKVVDMLLEQRVKAKANKDWAT
SYC_BACTN       GSSDGREAA----------------------------YGKVVDMLLEQRMKAKANKDWAT
SYC_PORGI       ASSAGGSEA----------------------------FGKAMDLLLSIRAEAKARKDWAT
SYC_CHLCH       SNGN-SMQR----------------------------LDKVMQIMLELRHNARKQKDFAT
SYC_PELLD       HDGGRSAET----------------------------LDEVMGVLMELRSEARKNKDFAT
SYC_CHLTE       GESGESAQT----------------------------LNDVMAVLLELRKEARASKDFAT
SYC_THET2       RVS---GPL----------------------------LEGLIALLLELREEARRAKDYEK
SYC_THET8       RVS---GPL----------------------------LEGLIALLLELREEARRAKDYEK
SYC_DEIRA       SVAQDDASV----------------------------IDALMDLVLKARQNYRLQKQYAE
SYC_BORBU       DENMK--------------------------------------ALIEERRIAKCEKNFKR
SYC_BORBP       DENMK--------------------------------------ILLEERRIAKCEKNFKR
SYC_TREDE       IDESE------------------------------------ILKLIEERASAKLDKNYKL
SYC_TREPA       DTLPQRPLP----------------------------SEEWIGQLVRARAHARQTRDFPR
SYC_NOVAD       EIDEAG-----------------------------------IEALLDARKAARAEKDFAR
SYC_ZYMMO       SLQENN-----------------------------------VLALLEERQLKRKEKDFAA
SYC1_BURL3      DVPEH------------------------------------VRALLGERARARAEKDWAQ
SYC_SALRD       SENGLAPAH----------------------------LSDSIDTLLEDREAARADGEYAR
SYC_CHLTR       P--DIPEE---------------------------------VLLLVEQREAARKVKNWQE
SYC_CHLTA       P--DIPEE---------------------------------VLLLVEQREAARKVKNWQE
SYC_CHLMU       A--DIPED---------------------------------VLLLVKEREAARKVKNWKE
SYC_CHLCV       DL-EIPDH---------------------------------VKQLVEEREVARSEKNWKQ
SYC_CHLFF       TQ-EIPDE---------------------------------VMQLVEKREVARREKNWAQ
SYC_CHLAB       SL-EIPSE---------------------------------VARLVEEREIARKEKNWKQ
SYC_CHLPN       SV-CIPET---------------------------------VMQLVAEREEARKTKNWAM
SYC_PARUW       REESIPVD---------------------------------LQEAFAKRQQARQEKNWTL
SYC_LEPIN       KKDLLDSE---------------------------------IDSLIEERQIARKNKDFAR
SYC_LEPIC       KKDLLDSE---------------------------------IDSLIEERQIARKNKDFAR
SYC_CAMJE       QWGVSKE------------------------------EREEIEKLILERTEAKKNKDFNT
SYC_CAMJR       QWGVSKE------------------------------EREEIEKLILERTEAKKNKDFNT
SYC_HELPY       QLGVSES------------------------------EKQEIENKIEERKRAKERKDFLK
SYC_HELPJ       QLGVSES------------------------------EKQEIENKIEERKRAKEQKDFLK
SYC_HELHP       QLGLDEK------------------------------TKQEIESKIAKRQEAKAQKNYAL
SYC_WOLSU       QMGVSPE------------------------------EKEKIEELIKERAEAKKAKDFAR
SYC_SULDN       QFGVNEE------------------------------TKTEIAKLIEKRAEAKKSKDFAA
SYC_AYWBP       --------------------------------IPFNKPTKKDLQTYFLWQDARKCRDFIQ
SYC_ONYPE       --------------------------------IPFNKPTKTDLQTYFLWQDARKYRDFAQ
SYC_MYCCT       --------------------------------VFNYKFKKEIKELFLKWQQLVKDKEFDK
SYC_MYCMS       --------------------------------VFNYKFDNKTKELFLKWQELVKNKEFNK
SYC_MESFL       --------------------------------NINTFVSDEEQNLFLLWKKIVSEKDFEK
SYC_MYCGA       --------------------------------VPDMIHNEQIIDQINQWSELLNNKDYEK
SYC_UREPA       --------------------------------NFVDLHNDENLALLNTWKNYVDKKDYVK
SYC_MYCPE       --------------------------------IHVNLFDDEAIELLNKWNKLKQEKNFSE
SYC_MYCH2       --------------------------------------NPESQEKIKNWNKLIMDKNYSE
SYC_MYCMO       --------------------------------------SQKDLDLFLKWKIEKTNKNFKI
SYC_MYCGE       --------------------------------SFKSIHTKLNVRLIKEWSILHKQKAMDK
SYC_MYCPN       --------------------------------GFKSIHTKLNVQLIKKWASLRKNGQLDK
                                                                            

SYC_AGRFC       ADRLRDELSEKGIQLKDGKDKETGERTTTWELKR----------
SYC_RHIEC       ADRIRDELGAKGIQLKDGKDPETGERVTTWEVKR----------
SYC_RHIME       ADGIRADLLARGIQLKDGKDPETGERVTTWEVKRSQV-------
SYC_RHILO       ADRIRDELLAQGVQLKDGKDPVTGERITTWEVKR----------
SYC_NITWN       SDRIRDELAAMGVVLKDGKD-ADGKPVTTWEIAR----------
SYC_BARHE       ADTIRDKLAAEGIVLKDIKDPQTGERTTMWEIKRF---------
SYC_BARQU       ADTIRDELAAKGVILKDGKDPQTGERTTMWEMRRL---------
SYC_BRUAB       ADRIRDELLQEGVQLKDSKDPATGERITTWDVVG----------
SYC_BRUA2       ADRIRDELLQEGVQLKDSKDPATGERITTWDVVG----------
SYC_BRUME       ADRIRDELLQEGVQLKDSKDPATGERITTWDVVG----------
SYC_BRUSU       ADRIRDELLQEGVQLKDSKDPATGERITTWDVVG----------
SYC_RHOPA       SDRIRDELAAMGVVLKDGKDAD-GKSVTTWELAR----------
SYC_RHOP2       SDRIRDELAAMGIAIKDGKDAD-GKPVTTWEIAR----------
SYC_RHOPB       SDRIRDQLAAMGVVLKDGKDAD-GKPTTTWEIAR----------
SYC_BRADU       SDRIRDQLAAMGVAIKDSKEG------TTWEFSR----------
SYC_JANSC       VDALKSALTAAGVEVRMSKD-GVELVPGPTFDPA----KLEDL-
SYC_RUEPO       ADRLKKSALLAGVDLSVSKE-GGIQVPSATINGSPTVDELEALK
SYC_RHOS4       ADRLKTDAMRLGVELRAQKSPNGVTGGLAKLADRVDVSALEGLL
SYC_ANAMM       ADEIRESLSNMGIGISDGKDGSTRWHRKN---------------
SYC_ANAPZ       ADEIRDQLHSMGIVIKDDKDGVTRWSRA----------------
SYC_EHRCJ       ADDIRQLLLSKGIVLSDNKDGTTHWYKK----------------
SYC_EHRCR       ADDIRQLLLNRGIVLSDNKDGTTHWYKK----------------
SYC_EHRRG       ADRIRQILLDKGIVLSDNKDGTTLWYRS----------------
SYC_EHRRW       ADRIRQILLDKGIVLSDNKDGTTLWYRS----------------
SYC_WOLPM       ADKIRDQLKQMGITISDNEDGTTTW-------------------
SYC_WOLTR       ADKIRDQLKQMGVTISDNEDGTTTW-------------------
SYC_NEOSM       ADRIRFALAKMGVLIRDHKHAPTDWVSL----------------
SYC_RICCN       ADQIRNQLLEEKIILEDRPDGTTIWRKE----------------
SYC_RICFE       ADQIRNQLLEEKIILEDKPDGTTIWRKE----------------
SYC_RICPR       ADKIRNQLLEKKIILEDKSNYITIWRKE----------------
SYC_RICTY       ADKIRNQLLEKKIILEDKSDCTTIWRKE----------------
SYC_RICBR       ADQIRNKLLNEKIILEDKPNGTTIWRKE----------------
SYC_PELUB       ADIIRNKLLDKGVLIEDK-DGKTIWKLK----------------
SYC_XANOR       ADAIRKQLADEGIVLEDTPQGVRWKRA-----------------
SYC_XANOM       ADAIRKQLADEGIVLEDTPQGVRWKRA-----------------
SYC_XANAC       ADAIRKQLAEEGIVLEDTPQGVRWKRA-----------------
SYC_XANC5       ADAIRKQLAEEGIVLEDTPQGVRWKRA-----------------
SYC_XANCP       ADAIRQQLADEGIVLEDTAQGVRWKRA-----------------
SYC_XANC8       ADAIRQQLADEGIVLEDTAQGVRWKRA-----------------
SYC_XYLFA       ADAIRAQLAAEGIVLEDTPHGVRWMKQHT---------------
SYC_XYLFT       ADAIRAQLAAEGIVLEDTPQGVRWMKQHT---------------
SYC_CAUVC       ADAIRGELDALGVVVMDGPAGATWRMKD----------------
SYC_MAGSA       ADRIRQDLAARGVVLEDGAGGTTWKRG-----------------
SYC_RHORT       ADAIRDELTQAGIVLEDGPNGTTWRKA-----------------
SYC_GLUOX       ADAIRAQLAADGITLEDGPGGTTWRKA-----------------
SYC_SACD2       ADEIRKELTEKGIALEDSASGTSWKRI-----------------
SYC_PSYA2       ADEIRIQLKDAGIELEDSRAG-TTWRRA----------------
SYC_PSYCK       ADEIRVQLKEAGIELEDSRAG-TTWRRA----------------
SYC_ACIAD       ADAIRQALLDQGVVLEDTRQG-TLWRRAD---------------
SYC_PSEF5       SDRIRDQITAMGVILEDGKGG-TTWRLAD---------------
SYC_PSEPF       SDRIRDQLTAMGVVLEDGKGG-TTWRLAD---------------
SYC_PSE14       SDRIRDQITAMGVLLEDGKGG-TTWRLAD---------------
SYC_PSEU2       SDRIRDRITAMGVLLEDGKGG-TTWRLAD---------------
SYC_PSESM       SDRIRDQITAMGVLLEDGKGG-TTWRLGD---------------
SYC_PSEPK       SDRIRDQLTAMGVVLEDSKGT-TTWRLAD---------------
SYC_PSEAE       SDRIRDQLTAMGVVLEDGKGG-TTWRLAD---------------
SYC_HAHCH       SDRIRDLLKEKGVLLNDSREG-TSWQRA----------------
SYC_BURMA       ADRIRAELLEAGIALEDKPGGSTEWRRV----------------
SYC_BURPS       ADRIRAELLEAGIALEDKPGGSTEWRRV----------------
SYC_BURP1       ADRIRAELLEAGIALEDKPGGSTEWRRV----------------
SYC_BURTA       ADRIRAELLEAGIALEDKPGGSTEWRRV----------------
SYC2_BURL3      ADRIRAELLETGIALEDKPGGSTEWRRV----------------
SYC_CUPPJ       ADRIRADLLAAGIVLEDKPGGATEWRRA----------------
SYC_RALSO       ADGIRADLLAAGIVLEDKPGGVTEWRRA----------------
SYC_DECAR       ADRIRDELKAAGIILDDSPQG-TTWRRA----------------
SYC_AROAE       ADRIRAQLLASGIVLEDTPHG-TVWRRA----------------
SYC_THIDA       SDRIRDELAAAGIVLEDGPGG-TTWRRQ----------------
SYC_NEIG1       SDRIRDLLNEHKIILEDSAGG-TTWRRG----------------
SYC_NEIMB       SDRIRDLLNEHKIILEDNAGG-TTWRRG----------------
SYC_CHRVO       SDRIRDELTAKGIVLEDGAGG-TIWRRA----------------
SYC_NITEU       ADTLRQQLAEAGIILEDSPQG-TTWRRE----------------
SYC_NITMU       ADRIRKELMEANIILEDGPHG-TTWRRATGLSTL----------
SYC_BORBR       ADAIRAELRAAGVELDDKPGGLTQWRRA----------------
SYC_BORPA       ADAIRAELRAAGVELDDKPGGLTQWRRA----------------
SYC_BORPE       ADAIRAELRAAGIELDDKPGGLTQWRRA----------------
SYC_BORA1       ADAIRAELRAAGIELDDKPGGMTQWRRA----------------
SYC_RHOFT       ADRIRQDLLARGIVLKDSAAGTVWEVVA----------------
SYC_METCA       SDRIRDELKAQGIILEDSAAG-TTWRRE----------------
SYC_NITOC       ADRIRGILKDQGITLEDTAAG-TLWRRG----------------
SYC_HYDCU       SDEIRDELLAQGIELLDSAEG-TSWRKI----------------
SYC_LEGPL       ADQIRADLLSKGIELEDGATG-TTWRRIAE--------------
SYC_LEGPA       ADQIRADLLSKGIELEDGATG-TTWRRIAE--------------
SYC_LEGPH       ADQIRADLLSKGIELEDGATG-TTWRRIAE--------------
SYC_BLOFL       SDKIRKRLTEIGIILEDKPTG-KTIWRYN---------------
SYC_BLOPB       ADSIRKKLTVMGITLEDGPTG-ITKWHFK---------------
SYC_BUCAI       ADNIRKKLMSLDIILEDLPDK-TIWRKNKKS-------------
SYC_BUCAP       ADKLRDKLIKLNVILEDLPEK-TLWRFKR---------------
SYC_BUCBP       ADRIRKELLELGIVLEDTSFN-TFWRSLQ---------------
SYC_WIGBR       ADEERKKLKYIGVCLEDTIQG-TKWFKL----------------
SYC_COLP3       ADDARDKLNAMNIVLEDSAGK-TTWRKA----------------
SYC_PSET1       ADEARDALSALGVILEDSAGK-TTWRKA----------------
SYC_IDILO       ADEARDELTNMGIVLEDGAEG-TRWRRA----------------
SYC_ECOL6       ADAARDRLNEMGIVLEDGPQG-TTWRRK----------------
SYC_SHIFL       ADAARDRLNEMGIVLEDGPQG-TTWRRK----------------
SYC_ECOLI       ADAARDRLNEMGIVLEDGPQG-TTWRRK----------------
SYC_ECO57       ADAARDRLNEMGIVLEDGPQG-TTWRRK----------------
SYC_SHISS       ADAARDRLNEMGIVLEDGPQG-TTWRRK----------------
SYC_SHIBS       GRCGT---------------------------------------
SYC_SHIDS       ADAARDRLNEMGIVLEDGPQG-TTWRRK----------------
SYC_SALCH       ADAARDRLAEMGIILEDGPQG-TTWRRK----------------
SYC_SALTY       ADAARDRLAEMGIILEDGPQG-TTWRRK----------------
SYC_SALPA       ADAARDRLTEMGIILEDGPQG-TTWRRK----------------
SYC_SALTI       ADAARDRLTEMGIILEDGPQG-TTWRRK----------------
SYC_PECAS       ADQARDRLNEMGIVLEDGPQG-TIWRRK----------------
SYC_YERPE       ADAARDQLNELGIVLEDGPQG-TTWRRK----------------
SYC_YERPS       ADAARDQLNDLGIVLEDGPQG-TTWRRK----------------
SYC_PHOLL       ADSARNQLNEMGIELEDGPQG-TSWRRK----------------
SYC_SODGM       ADEARDKLTALGIVLEDGPQG-TTWRRC----------------
SYC_VIBVU       ADMARDKLNEMGIVLEDGPEG-TTWRRK----------------
SYC_VIBVY       ADMARDKLNEMGIVLEDGPDG-TTWRRK----------------
SYC_VIBPA       ADMARDKLTEMGIVLEDGPEG-TTWRRK----------------
SYC_VIBCH       ADLARDKLNEMGIVLEDGPNG-TTWRRK----------------
SYC_ALIF1       ADAARDAIAALNIVLEDGPEG-TTWRRK----------------
SYC1_PHOPR      ADAARDKLLAMKIILEDGPQG-TTWRRK----------------
SYC_SHEON       ADVARNRLNELGVVLEDGPSG-TTWRKK----------------
SYC_HAEDU       ADQVRGKLKAMNILLEDTPTG-TVWRKA----------------
SYC_MANSM       ADAARNELTAMGVVLEDGAKG-TTWRKL----------------
SYC_HAEIN       ADSARNELTAMGIVLEDGPNG-TTWRKQ----------------
SYC_HAEI8       ADAARNELIAMGIVLEDGPNG-TTWRKQ----------------
SYC_PASMU       ADAARNKLAEMGVVLEDNVNG-TTWRKQ----------------
SYC_FRATH       ADEIRNQLQQQGIILEDSATG-TTWKKG----------------
SYC_FRATT       ADEIRNQLQQQGIILEDSATG-TTWKKG----------------
SYC_COXBU       ADQIRDQLTDLGVAIEDSSDG-TSWRQE----------------
SYC_DESAG       SDAIREELARMGVEVQDTPAG-AAWDIA----------------
SYC_DESVH       ADAIRDELAALGIEVRDTPSG-AVWDVL----------------
SYC_ANADE       SDAIRDGLLARGVVLMDGPQG-TTWKVE----------------
SYC_GEOMG       ADEIRDSLAAKGIMLLDSPQG-TTWKVK----------------
SYC_GEOSL       ADEIRDTLAAQGILLLDSAQG-TTWKVK----------------
SYC_PELCD       ADEIRDELAAKGIQLLDGPQG-TAWKAR----------------
SYC_DESPS       SDEIRDILLEKGITLKDGADG-TGWSVHRAN-------------
SYC_NOSS1       SDRIRNELQAQGVTLIDSPQG-TRWHRS----------------
SYC_TRIV2       SDRIRNELQAQGVTLIDSPQG-TRWHRS----------------
SYC_SYNY3       GDRLRDVLQEAGITLVDKPGGLTEWFR-----------------
SYC_SYNP6       ADRIRHYLADLGITLIDQAGGITRWSRT----------------
SYC_SYNE7       ADRIRHYLADLGITLIDQAGGITRWSRT----------------
SYC_THEEB       SDRLRDLLLAQGVKLVDQKDGTTHWFRVPSAP------------
SYC_GLOVI       ADRIRKQLLDQGIVLIDHKEKPTTWRHADP--------------
SYC_SYNJB       ADRIRDQLKALGITLIDQKDGTTRWLRE----------------
SYC_SYNJA       ADRIREQLKALGITLIDQKDGTTRWLRQ----------------
SYC_SYNS9       ADRIRDELKAQGIELIDKPGGITEWIRR----------------
SYC_SYNPX       ADRIRNELTAQGIELIDKPGGITEWIRS----------------
SYC_PROMM       ADLIRDELRAQGIELIDKPGGLTDWISS----------------
SYC_SYNSC       ADRIRDELAAQGVELIDKPGGVTEWIRA----------------
SYC_PROMA       ADKIREELNLKGVQLIDKKDGVTEWIQS----------------
SYC_PROMT       ADKIRADLKNIGIDLIDKPKGVTEWKQLSD--------------
SYC_PROM9       ADEIRNLLKEKGIELIDQSKEITTWIRV----------------
SYC_PROMP       ADKIRNLLKEKGVELIDQSPELTTWVRI----------------
SYC_AQUAE       ADYIRDKLKELGIVLEDTPAG-TKWKKREGA-------------
SYC_THEMA       SDRIRDRLREIGIILKDTPSG-TEYTVE----------------
SYC_BACAN       SDQIRDDLKDRNIILEDTAQG-TRWKRG----------------
SYC_BACHK       SDQIRDDLKDRNIILEDTAQG-TRWKRG----------------
SYC_BACCZ       SDQIRDDLKDRNIILEDTAQG-TRWKRG----------------
SYC_BACC1       SDQIRDDLKDRNIILEDTAQG-TRWKRG----------------
SYC_BACCR       SDQIRDDLKERNIILEDTAQG-TRWKRG----------------
SYC_BACLD       SDQIRDQLKSMNIILEDTPQG-TRWKRGES--------------
SYC_BACSU       SDQIRDQLKSMNIILEDTAQG-TRWKRGE---------------
SYC_GEOKA       ADRIRDELRAKNIILEDTPQG-TRWKRG----------------
SYC_OCEIH       ADEIRDMLKEKGIVLEDTPQG-VRWKRGK---------------
SYC_BACSK       ADEIRDLLKEKNIVLEDTPQG-VRWKRGS---------------
SYC_BACHD       ADDIRDQLKAEGIILEDTPQG-VRWKRGS---------------
SYC_LISMO       ADEIRDILKEKNIILEDTAQG-TRFRRG----------------
SYC_LISMF       ADEIRDILKEKNIILEDTAQG-TRFRRG----------------
SYC_LISIN       ADEIRDILKEKDIILEDTAQG-TRFRRG----------------
SYC_STAAC       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAA3       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAAM       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAAN       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAAS       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAAW       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAAB       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAAR       ADEIRDMLKSQNIILEDTPQG-VRFKRG----------------
SYC_STAES       ADEIRDMLKARHIILEDTPQG-VRFKRG----------------
SYC_STAEQ       ADEIRDMLKARHIILEDTPQG-VRFKRG----------------
SYC_STAHJ       ADEIRDMLKEQNIILEDTPQG-VRFKRG----------------
SYC_STAS1       ADEIRDQLKEQNIILEDTPQG-VRFKRG----------------
SYC_LACPL       ADQIRDDLKVQGIMLEDTPQG-VRFRKE----------------
SYC_LACSS       SDAIRDQLKAQGIILEDTPQG-MRWRRA----------------
SYC_ENTFA       SDEIRDLLKEQGIVLEDTPQG-TRWRRSE---------------
SYC_LACAC       SDQIRDQLKEMGITIQDTPQG-TRWTRD----------------
SYC_LACJO       SDRLRDELQAKGIVIEDTPQG-TRWHRA----------------
SYC_STRA1       ADRIRDELAKQGIKLLDTKDG-VRWTRD----------------
SYC_STRA5       ADRIRDELAKQGIKLLDTKDG-VRWTRD----------------
SYC_STRA3       ADRIRDELAKQGIKLLDTKDG-VRWTRD----------------
SYC_STRPM       ADAIRDQLAAQGIKLLDTKDG-VRWLRD----------------
SYC_STRP3       ADAIRDQLAAQGIKLLDTKDG-VRWLRD----------------
SYC_STRP8       ADAIRDQLAAQGIKLLDTKDG-VRWLRD----------------
SYC_STRP6       ADAIRDQLAAQGIKLLDTKDG-VRWLRD----------------
SYC_STRP1       ADAIRDQLAVQGIKLLDTKDG-VRWLRD----------------
SYC_STRT2       ADRIRDELAAQGIKLLDTKEG-VRWTRD----------------
SYC_STRT1       ADRIRDELAAQGIKLLDTKEG-VRWTRD----------------
SYC_STRMU       ADAIRDDLAAQGIKLLDTKDG-VRWMRD----------------
SYC_STRPN       ADQIRDQLVTQGIKLLDTKDG-VRWTRD----------------
SYC_STRR6       ADQIRDQLVTQGIKLLDTKDG-VRWTRD----------------
SYC_LACLA       SDEIRDALKAQGIVLEDTKDG-VRWHRE----------------
SYC_CLOPE       ADKIRDELKDRGIVLEDTPQG-VRWKMI----------------
SYC_CLOTE       ADEIRDGLKERGILLEDTPQG-VRWKRI----------------
SYC_CLOAB       ADKIRDDLKERGIVLEDTPEG-IRWKFIDK--------------
SYC_CALS4       ADEIRDKLKERGIILEDTPEG-VRWKRIR---------------
SYC_SYMTH       ADRIRDQLRAMGIILEDTPQG-VRWRRA----------------
SYC_CARHZ       ADFIRDELKKQGIILEDTPKG-VRWKRV----------------
SYC_MOOTA       ADTIRDRLKELGIVLEDTPRG-PRWKRS----------------
SYC_FUSNN       SDKIRDRLLELGIKIKDGKDK-TTWTM-----------------
SYC_DEHM1       ADKIRTSLDAAGILLEDSAGG-TIWKIKTK--------------
SYC_DEHMC       ADKIRTSLDTAGILLEDSAGG-TVWKVKK---------------
SYC_BDEBA       SDELRAKITALGISVSDTPEG-SFWEVTK---------------
SYC_COREF       ADEVRDRLAAAGIEVVDTADGVSWKLQ-----------------
SYC_CORGL       ADEVRDRLADAGIEVVDTADGATWKLQ-----------------
SYC_CORDI       ADEVRDRLHAAGITVTDTPDGPTWALNN----------------
SYC_CORJK       ADEVRDRLAEAGIEVTDTADGAKWSLKG----------------
SYC_MYCBO       ADEIRGRLKRAGIEVTDTADGPQWSLLGGDTK------------
SYC_MYCTU       ADEIRGRLKRAGIEVTDTADGPQWSLLGGDTK------------
SYC_MYCPA       ADEIRNRLKQAGIEVTDTADGPQWTL-GGDGK------------
SYC_MYCLE       ADQIRDRLKDAGIEVTDTVNGPQWELLAGDKQVDAR--------
SYC_NOCFA       ADAVRDRLHAAGIDVTDTPNGPEWSLRTARGKAN----------
SYC_STRAW       ADAIRDQLNQSGLVIEDSPQGPRWTLGPR---------------
SYC_THEFY       ADRIRDQLAEMGIAVEDTPQGPRWELKRS---------------
SYC_LEIXX       ADRIREELTGAGITIEDTPTGCHWSIEA----------------
SYC_CUTAK       ADAIRDTLTNLGLTIEDTPAGAHWSLS-----------------
SYC_BIFLO       ADQIRDALTEAGIAIEDGPQGSTWSLK-----------------
SYC1_TROW8      SDLLRELLAEADISVSDGHVSYGSPRG-----------------
SYC1_TROWT      SDLLRELLAEADISVSDGHVSYGSPRG-----------------
SYC_FRACC       ADAIRSRLAAAGLIVEDTPEGQRWHLA-----------------
SYC_RHOBA       GDAIRDRLADLGVALLDKKEGTSWERKS----------------
SYC_BACFR       SDLIRNELTALGFEIKDTKDGFEWKLNK----------------
SYC_BACFN       SDLIRNELTALGFEIKDTKDGFEWKLNK----------------
SYC_BACTN       SDEIRNTLTALGFEVKDTKDGFEWRLNK----------------
SYC_PORGI       SDKIRDELTALGFTIKDTKDGAEWKLN-----------------
SYC_CHLCH       SDKIRDMLLAAGIEIKDTKEGAVWSVKG----------------
SYC_PELLD       SDLIRDHLLAAGIEIKDTREGASWSKTRH---------------
SYC_CHLTE       SDKIRDLLMERGIEIKDTREGATWSKKKA---------------
SYC_THET2       SDLIRERLRALGVIVEDTKEGPRWRLER----------------
SYC_THET8       SDLIRERLRALGVIVEDTKEGPRWRLER----------------
SYC_DEIRA       ADELRETLGKAGITVEDTKDGARWKR------------------
SYC_BORBU       ADEIRDFFAKKGFVLVDTKEGTKVKRG-----------------
SYC_BORBP       ADEIRDFFAKKGFVLIDTKEGTKVKRG-----------------
SYC_TREDE       ADEIRDKLKGMGIILEDQAGKTTWKKL-----------------
SYC_TREPA       ADEIRRQLKAEGIELEDTHLGTIWKRV-----------------
SYC_NOVAD       SDALRDQIAAKGVEVMDGDPLGWEWKLA----------------
SYC_ZYMMO       SDAIRNRLSEAGIDVLDGDPLGWEWRPEWNA-------------
SYC1_BURL3      ADRIREALSAEGWRVEDTPEGQRLFGMAMGASEPDVPPQ-----
SYC_SALRD       ADAIRDTLEALGIEVMDTPDGTEWERREQVG-------------
SYC_CHLTR       ADRLRDEILSRSFAIEDGKTGMKVKKL-----------------
SYC_CHLTA       ADRLRDEILSRGFAIEDGKTGMKVKKL-----------------
SYC_CHLMU       ADRLRDEIISRGFAIEDGKTGMKVKKI-----------------
SYC_CHLCV       ADALRDQVASLGYSIEDAKSGPKVKKL-----------------
SYC_CHLFF       ADAFRDQVASLGYLIEDSKSGPKVKKL-----------------
SYC_CHLAB       ADVLRNQIASFGYVVEDTKSGPKVKKY-----------------
SYC_CHLPN       ADTLRDEILAAGFLVEDSKSGPKVKPL-----------------
SYC_PARUW       SDELRDFIHQRGYLIEDTPQGTRLKKQ-----------------
SYC_LEPIN       SDAIRDQLLAQGILIEDTKEGIRWRKK-----------------
SYC_LEPIC       SDAIRDQLLAQGILIEDTKEGIRWRKK-----------------
SYC_CAMJE       ADAIREQLNSKKITLLDTPNGTIWEKINA---------------
SYC_CAMJR       ADAIREQLNSKKITLLDTPNGTIWEKINA---------------
SYC_HELPY       ADSIREELLKQKIALMDTPQGTIWEKFF----------------
SYC_HELPJ       ADSIREELLQQKIALMDTPQGTIWEKLF----------------
SYC_HELHP       ADKLRDELKSQGIEIMDTPQGSTWEKI-----------------
SYC_WOLSU       ADEIRKSLSDQGIALLDTPSGTLWERA-----------------
SYC_SULDN       SDMLRDKILAYGVNLMDTPQGSFWEKI-----------------
SYC_AYWBP       ADILRKQLLDKGFI------------------------------
SYC_ONYPE       ADILRKQLLDKGFI------------------------------
SYC_MYCCT       ADLIRKDLIEQGIL------------------------------
SYC_MYCMS       ADLIRNKLIEQGIL------------------------------
SYC_MESFL       ADEIRKVLISKGIL------------------------------
SYC_MYCGA       ADSIRNKLINKKVL------------------------------
SYC_UREPA       ADELRKQLINIGIL------------------------------
SYC_MYCPE       SDKYRKLLMEKKLL------------------------------
SYC_MYCH2       ADKIRKELWKIFKNS-----------------------------
SYC_MYCMO       SDKLFLELKEKKLV------------------------------
SYC_MYCGE       ADQIRKKLIKKMLL------------------------------
SYC_MYCPN       ADEVRQKLIKKGLL------------------------------