CLUSTAL format seed alignment for MF_00044

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYDM_MOUSE        ----------------------MYLGFWLSRLCRGLSRPIGKTMRPIWGSLSRNLALSSQ
P90831_CAEEL      -----------------------------------------------MISARNVTAICCR
SYDM_DICDI        ----------------MNRVILKDSKIFLNVLNKPIIKNKNCLSLLNITTSSTTSIIKNQ
SYD_THETH         ------------------------------------------------------------
SYD_DEIRA         ------------------------------------------------------------
SYDND_ACIC5       ------------------------------------------------------------
SYDND_SALRD       ------------------------------------------------------------
SYDND_ANAD2       ------------------------------------------------------------
SYDND_RHOBA       ------------------------------------------------------------
SYD_AZOPC         ------------------------------------------------------------
SYD_AMOA5         ------------------------------------------------------------
SYD_FUSNN         ------------------------------------------------------------
SYDN1_SYNAS       ------------------------------------------------------------
SYDND_PSEAE       ------------------------------------------------------------
SYDND_LEGPH       ------------------------------------------------------------
SYD_XYLF2         ------------------------------------------------------------
SYD_BUCAI         ------------------------------------------------------------
SYD_BUCBP         ------------------------------------------------------------
SYD_BLOFL         ------------------------------------------------------------
SYD_BAUCH         ------------------------------------------------------------
SYDND_WOLSU       ------------------------------------------------------------
SYDND_BIFLO       ------------------------------------------------------------
SYD_LACAC         ------------------------------------------------------------
SYD_STRMU         ------------------------------------------------------------
SYD_LEUMM         ------------------------------------------------------------
SYDND_STRMU       ------------------------------------------------------------
SYDND_BDEBA       ---------------------------------------------MPLVEGPLYRFCYGE
SYDND_ENDTX       ------------------------------------------------------------
SYDND_MAGMM       ------------------------------------------------------------
SYDND_ELUMP       ------------------------------------------------------------
SYDND_PELUB       ------------------------------------------------------------
SYDND_PROA2       ------------------------------------------------------------
SYDND_RUBXD       ------------------------------------------------------------
SYDND_HERA2       ------------------------------------------------------------
SYDND_DEHM1       ------------------------------------------------------------
SYDND_OPITP       ------------------------------------------------------------
SYDND_METI4       ------------------------------------------------------------
SYDND_BRAHW       ------------------------------------------------------------
SYDND_PARUW       ------------------------------------------------------------
SYDM_ARATH        -----------------MSLLLRTLPLRPTRFLSATAISISNATNFFVVPKRTNPLPGTR
SYDND_PROM5       ------------------------------------------------------------
SYD_LEPIC         ------------------------------------------------------------
SYDND_DICT6       ------------------------------------------------------------
SYD_PSELT         ------------------------------------------------------------
SYDND_TREPA       ------------------------------------------------------------
SYDND_BORBP       ------------------------------------------------------------
SYD_UREPA         ------------------------------------------------------------
SYD_MYCPE         ------------------------------------------------------------
SYD_MYCPN         ------------------------------------------------------------
SYD_MYCCT         ------------------------------------------------------------
SYD_ONYPE         ------------------------------------------------------------
SYDM_SCHPO        ------------------------------------------------------------
SYDM_YEAST        ------------------------------------------------------------
Q6CLY6_KLULA      ------------------------------------------------------------
A3LXG1_PICST      ------------------------------------------------------------
G2Q0I6_MYCTT      ---------MALPQASLRRLGAVGQRQLGG-----LRVPLRPQLLH--------------
G2X9J7_VERDV      ---------------------------------------MLLQLPN--------------
E9E2B2_METAQ      ----------------MSQLGRCWAVSRRG-----ACNRSILALTS--------------
E4ZST8_LEPMJ      --------------MSLRHASRHVASRATC------LRSSYSEISRFCRTRQLGIVQVRV
N1QNH6_SPHMS      ----------------------MVGGGSTW------VNMAF-------------------
C5FSN6_ARTOC      ---------MSMVPVLRAAFCSSRLGNITG------RRQSYIEISNYFRGRATPCSLRL-
H6BKD8_EXODN      MSLQRPATRLCHLRQSYVEISRYVRSHIQCDSPRCRVLSTRTSLSIRHASTNIPKDTVAL
                                                                              

SYDM_MOUSE        RIPEFS---------------------SFVARTNTCGE----------LRSSHLGQEVTL
P90831_CAEEL      RILSTS---------------------SYTVRTHICDE----------LSTSNKNEKVSV
SYDM_DICDI        QINQFNKRNFTNTINNNKNENINNKILNIIERSHSCGE----------ITSKDIGKEVII
SYD_THETH         -----------------------------MRRTHYAGS----------LRETHVGEEVVL
SYD_DEIRA         ----------------------------MMKRTSLIGQ----------LGQAQQQQTVTL
SYDND_ACIC5       ----------------------MLDFLGTKQRTHTCGE----------LRAAHAGETITI
SYDND_SALRD       --------------MERSSRADLISEDSHPARTHTC----------GDLRAEDNGEAVVL
SYDND_ANAD2       --------------MPR-----FITE---LKRTHSC----------GELTKADIGKEVVL
SYDND_RHOBA       -----------------------------MLRTHTC----------GALRKSDVGSPVTL
SYD_AZOPC         -----------------------------MYRTNTC----------GELRIVNENQEVIL
SYD_AMOA5         -----------------------------MLRTHTC----------GELRLQHIGISVTL
SYD_FUSNN         ----------------------------MVYRTHNL----------GELRLKNIGEVVTL
SYDN1_SYNAS       --------------------MPNRGAHFSISRRKDFLMDFSERVFCGHLTPDHTGRRVLL
SYDND_PSEAE       -----------------------------MMRSHYCGQ----------LNESLDGQEVTL
SYDND_LEGPH       ------------------------------MRTHYCSA----------VNELSLDKQITV
SYD_XYLF2         ------------------------------MRTHFCGL----------INETLIGHTVTL
SYD_BUCAI         ------------------------------MRTKYCGN----------IRISHVNKKVKL
SYD_BUCBP         ------------------------------MRTNFCGT----------LNVSHVGKTIKL
SYD_BLOFL         ------------------------------MRTAYCGQ----------LNLSHVGLEVTL
SYD_BAUCH         ------------------------------MRTIYCGQ----------LNKSHLGQEVIL
SYDND_WOLSU       ---------------------------MYVLRTHLCTQ----------LGEGNIGEEVIL
SYDND_BIFLO       -------------------------MSQTAYRTHHATE----------VTEALVGQKVTL
SYD_LACAC         ----------------------------MEKRTDYCGN----------ITEKYIGQDVNL
SYD_STRMU         -----------------------------MKRSMYAGA----------VRSEHIGQELTL
SYD_LEUMM         -----------------------------MKRTNYAGL----------IDETYLNQTVTL
SYDND_STRMU       ------------------------------MKELFIGN----------YGLEQVGQKVTA
SYDND_BDEBA       YKNMVFDCNGTICKSGAHEQGRHMKFVKELKRTHYCGS----------LGVSQAGQKVVL
SYDND_ENDTX       -----------------------------MKRSGYCGD----------IRESSIGKEIAV
SYDND_MAGMM       -----------------------------MKRTHYCND----------VRESQIGETVVL
SYDND_ELUMP       -----------------------------MMRTNYCGD----------INKNYVNSVQVL
SYDND_PELUB       ---------------------------MNKYRTHTCSE----------LTIDSRGKDVVL
SYDND_PROA2       ----------------MSLAPGTETDLQNRFRSHFCGR----------LNTEYENKQVRL
SYDND_RUBXD       ----------------------MHGTATNPYRTHTAGE----------LRASNVGQRVRL
SYDND_HERA2       -----------------------------MLRTHTCGE----------LRRDHIDQTVTL
SYDND_DEHM1       -----------------------------MLKTHSCA-----------LTQENIGTEVTL
SYDND_OPITP       -----------------------------MHRTHHCAQ----------LTTSQLGATVSL
SYDND_METI4       ----------------------MKKSEMKGYRTHHCNE----------LNLALVGHKAKL
SYDND_BRAHW       -------------------------MRF---KSAYNGI----------LTKDDIGKEVKL
SYDND_PARUW       ----------------------MNLMMFDYRRSHTCGQ----------LRKEKVNSQVTL
SYDM_ARATH        RTFSSSPVAAASGDVVVKPVPSPPSVLRWVSRTELCGE----------LSVNDVGKRVHL
SYDND_PROM5       ------------------------------MRNKICEE----------LNKSDIGKEVNL
SYD_LEPIC         ---------------------MKHWIQENYKNRSWAGE----------LNESQEGKQIVL
SYDND_DICT6       -----------------------------MRRTHYCGE----------INIKNVGEKVSL
SYD_PSELT         -----------------------------MLRTHTCGE----------LTIKDVGKKVIL
SYDND_TREPA       -------------MYSAHTPWYDGQVMDYPRRTIACGE----------LRRCHVGTVVVL
SYDND_BORBP       -----------------------------MFKVIKCNE----------LNEKLINKKVEI
SYD_UREPA         -------------------------------MKVYCGY----------IGEEHLEKNVIL
SYD_MYCPE         ---------------------------MKTNNVVYCGN----------VDNKLVGKEVVI
SYD_MYCPN         ---------------------MNLDNAKCFKQRVFIGN----------LTSEHLNKTVTI
SYD_MYCCT         -----------------------------MKRTHTCGE----------LTLQNVDQKVIL
SYD_ONYPE         ---------------------------MKTKYSHYNNQ----------LQLAHQGKTVFL
SYDM_SCHPO        ---------------------------MVLSRLPACLL-------------PLVGTKVSI
SYDM_YEAST        --------MLARSRVCLQTITRRLADFPEANAIKKKFLFRKDTSTIKQLKGLSSGQKIVL
Q6CLY6_KLULA      ----------MLRIRNFSTVSKRLGKLPAFETVRDKFKFSSETSTIQSILQQKP-NKVVL
A3LXG1_PICST      -----------------TSLPDKELTLAKFDFPLATHSIRKVTYKLDSFLDDKS-IKVTI
G2Q0I6_MYCTT      -----------LGRFQVCTRLTHSAAQSKAAEGVTPDQKAVGQQLREEWSRYNSFPKPSG
G2X9J7_VERDV      -----------AGVARLWDDAESSTTLPTAAMPKPADK----EQLASQFRDLLFFPKMSP
E9E2B2_METAQ      -----------RNGALRFYAHQSAAAGPRAGHLNKEEL----LKTWNQFRGSNSLTKTDP
E4ZST8_LEPMJ      EGWKKGVGRCFSQSIVRSDGIEPDEQLRKTLDDFKTSLRPSWPHEGGVWTPEILE-KIPL
N1QNH6_SPHMS      --------RCRSTNAVTSP--DGPSVIPRALQDFKKTL--NFPAASCSFDDLLRDCNLLL
C5FSN6_ARTOC      --------RCALQKGSRLHSTSSLSGAVPLLEQYSKSI--DFPPASTTFGNLYKE--TKH
H6BKD8_EXODN      NAEPSDRSRQYGDRSTLTQRKILSDKQYGCLERFERSS--LLPGISTTWDSLLKYKPSTI
                                                                              

SYDM_MOUSE        CGWIQ-----------------YRRQ---NTFLV-LRDCHGLVQILIPQDE---------
P90831_CAEEL      MGWLS-----------------HKRM---DRFFV-LRDAYGSVQAKIS------------
SYDM_DICDI        YGWIN-----------------SLRNLGDNVFLV-IRDGHGKVQCYVDLKQQCILKSSV-
SYD_THETH         EGWVN-----------------RRRD-LGGLIFLDLRDREGLVQLVAHPA----------
SYD_DEIRA         QGWVS-----------------RRRD-LGGLIFLELRDRSGTVQVQVEPD----------
SYDND_ACIC5       MGWVN-----------------RRRD-HGNLIFLDLRDRYGITQVVLDKDL---------
SYDND_SALRD       KGWVD-----------------TRRD-HGGLVFVDLRDRYGLTQVVFSP-----------
SYDND_ANAD2       FGWVN-----------------NRRD-HGGAVFIDLRDRAGLTQVVFEE-----------
SYDND_RHOBA       CGWVD-----------------SKRD-HGGAVFIDLRDRYGLTQVVIGPP----------
SYD_AZOPC         CGWVQ-----------------KSRR-MSGIVFVDLRDRYGITQLIFNKK----------
SYD_AMOA5         CGWVQ-----------------KIRN-KGSLVWIDLRDRYGITQLILEEH----------
SYD_FUSNN         SGWVD-----------------TKRNVSTNLTFIDLRDREGKTQIVFNNE----------
SYDN1_SYNAS       AGWVD-----------------AFRD-HGGLLFIHLRDRNGIIQIVFSPE----------
SYDND_PSEAE       CGWVH-----------------RRRD-HGGVIFLDVRDREGLAQVVFDP-----------
SYDND_LEGPH       CGWVH-----------------NRRD-HGGVIFLDIRDRSGLLQVVYEP-----------
SYD_XYLF2         AGWTD-----------------VARN-LGGVCFIDLRDHEGIVQITVDSRAID-------
SYD_BUCAI         CGWVH-----------------KVRN-LGQFIFVDMRDYTGLVQVIFEL-----------
SYD_BUCBP         CGWVN-----------------KFRN-LKEILFIDIRDQTGIIQVLFSK-----------
SYD_BLOFL         CGWVN-----------------KYRN-FGKLIFVDLRDREGCIQVYFNSD----------
SYD_BAUCH         CGWVY-----------------RYRN-LGRLIFIELSDREGRVQVVFDL-----------
SYDND_WOLSU       CGWCN-----------------TYRD-HGGVIFIDLRDKSGIIQLVSDP-----------
SYDND_BIFLO       AGWVD-----------------RRRD-HGGVAFIDLRDSTGLVQVVIYD-----------
SYD_LACAC         YGWVQ-----------------RVRN-LGNLVFIDLRDREGLVQIVVN-K----------
SYD_STRMU         KGWVA-----------------RRRD-LGGLIFIDLRDREGIVQLVINPK----------
SYD_LEUMM         TGWVQ-----------------KRRD-FGDLIFVDLRDREGIVQLTFN------------
SYDND_STRMU       KGWVA-----------------NIRN-HGKLAFIELRDREGLLQVFVD------------
SYDND_BDEBA       MGWVD-----------------VRRD-HGSLVFIDLRDREGIVQVVLD------------
SYDND_ENDTX       CGWVH-----------------SRRD-HGGVIFIDLRDREGILQIVFQPE----------
SYDND_MAGMM       EGWIN-----------------RRRD-HGGVIFVDLRDRTGLVQVVFSPEL---------
SYDND_ELUMP       CGWVN-----------------SYRD-HGGVLFLDLRDRTGKVQVVVEPT----------
SYDND_PELUB       SGWIN-----------------KKRD-HGNLLFIDLRDNYGMTQCIIDK-----------
SYDND_PROA2       AGWIH-----------------RKRD-HGGLIFIDLRDHTGIAQLIIQP-----------
SYDND_RUBXD       AGWVH-----------------RRRD-HGGLIFVDLRDRWGITQVTFDP-----------
SYDND_HERA2       AGWVH-----------------RRRD-HGTVLFLDLRDRYGLTQVIVDPS----------
SYDND_DEHM1       AGWVH-----------------RRRD-HGGVIFIDLRDREGIVQVVFNPE----------
SYDND_OPITP       LGWVD-----------------TIRD-QGGIIFVDLRDRKGITQIQLEPH----------
SYDND_METI4       CGWVH-----------------SKRD-HGGLLFIDLRDREGITQVVFHPE----------
SYDND_BRAHW       AGWVL-----------------RRRD-HGGVIFVDLRDRTGFVQIVFNPE----------
SYDND_PARUW       SGWVN-----------------RRRD-HGGLIFIDLRDRFGLTQLVFDPI----------
SYDM_ARATH        CGWVA-----------------LHRV-HGGLTFLNLRDHTGIVQVRTLPD----------
SYDND_PROM5       CGWVD-----------------RRRD-HGGVIFIDLRDHSGFMQITINPE----------
SYD_LEPIC         FGWSF-----------------RFRD-QGGVIFIDLRDRTGIIQVVARKE----------
SYDND_DICT6       SGWVH-----------------RIRH-HGGLIFIDLRDRSGIVQLVVDPA----------
SYD_PSELT         AGWID-----------------RIRD-LGGVKFLMLRDRYGQTQIIL-------------
SYDND_TREPA       NGWVH-----------------RKRS-HGTVSFFNMRDRSGIVQVIVSQEEN--------
SYDND_BORBP       NAWVK-----------------KIRH-HGKFIFLNIRDRYEKAQVLITEEH---------
SYD_UREPA         NGWVK-----------------KVRK-MGNLVFVDLKDRFGIVQIFATKSDG--------
SYD_MYCPE         KGWIK-----------------KNRK-LGSLIFIDIYDITGIVQVVVEEENK--------
SYD_MYCPN         AGWVK-----------------RIKK-LGELNFVIVGDKTNTIQVTCKNKE---------
SYD_MYCCT         QGWVK-----------------KIRK-LGAMVFIDLKDRYGITQLVIEQEN---------
SYD_ONYPE         KGFIF-----------------RKRN-LGKTLFFDLRDVSGIVQLLVKEN----------
SYDM_SCHPO        QGWLVA----------------TSRQVSKSISFHQLRDTHGTILQLLSTDKIILQQKREP
SYDM_YEAST        NGWIE----------------QKPKRVGKNLIFGLLRDSNGDIIQLVDNK----------
Q6CLY6_KLULA      NGWID----------------AKPKKVGKNLIFGTLRDPNGEKIQLVDSQ----------
A3LXG1_PICST      NGHIN----------------RKP-RIRPELSFAEIRDSNGDCTQILLTPQ---------
G2Q0I6_MYCTT      ARDFKEG-----QTVTVHGFLARKRIKSSKLAFADI-QIDNGPAV--QI-----------
G2X9J7_VERDV      RERWKPGE----TAVTIHGFIGKIRKVSKELAFANI-ELNNG------------------
E9E2B2_METAQ      D--------------IIRGFLGKRRNVGKHLSFADL-TTSWGEVI--QI-----------
E4ZST8_LEPMJ      GSE-----------FTLVGYLGSRRDVSQKLSFTMLRNENLSWCVQLVS-----------
N1QNH6_SPHMS      NHE-----------VVLHGYLGTRRDASKTLTFAELRDMHLGSSIQLVS-----------
C5FSN6_ARTOC      GKT-----------VILHGYIGKRKKIGKNMTFVRLSDPTLSQSVQIVV-----------
H6BKD8_EXODN      SSTNDSKSNVDTDRVVVPGYITSQR-SAKQCEFFQLVDPSLKLAIQIVLPRPNINSHILG
                                                     :                        

SYDM_MOUSE        -------------------SAASVRRILCEAPVESVVRVSGTVISRPPGQENPKMPTGE-
P90831_CAEEL      -------------------ASSKLQSLLKDIPYESVVRVDGIVVDRGDNR-NSKMKTGD-
SYDM_DICDI        -------------PNIDINERNSIEENIKLFKLESIVSIKGKVIARPERMVNKNMSTGE-
SYD_THETH         ---------------------SPAYATAERVRPEWVVRAKGLVRLRPE--PNPRLATGR-
SYD_DEIRA         ---------------------SPAFAEADRLRAEYVAEIEGTFQPRPE--SQRKGGLAD-
SYDND_ACIC5       --------------------SAEAHAKAEQARPEYVICATGKVRARSQEAINPKMPTGE-
SYDND_SALRD       ------------------QDNQTAYEVAGQLRREDVISVQGTVRPRGEEAVNPDLPTGA-
SYDND_ANAD2       ------------------DVRPDVHELAGQLRLEYCVGVRGKVVSRG-GNVNPKLRTGE-
SYDND_RHOBA       ------------------EANEALIKQAGHVPNESVILIRGVVADRLEGKTNAKLETGE-
SYD_AZOPC         ------------------VNLA-LYNKALELGREWVIQIEGKVVKRFN--KNSDIPTGD-
SYD_AMOA5         ------------------ITAPEILSQVQHIGREYVIQATGSVIERSA--KNPSMPTGD-
SYD_FUSNN         ------------------LLSEKVLEEVQKLKSESVIRVIGEVKER--SNKNPNIPTGE-
SYDN1_SYNAS       ------------------AASADVYRQAASLRAEYCVAVQGEVRKRLPGTENPHIETGD-
SYDND_PSEAE       -------------------DRAETFAKADRVRSEFVVKITGKVRLRPEGARNPNMASGS-
SYDND_LEGPH       -------------------ENKEIFAIAEKLRSEFVVRVTGIVRKRPEGMINDKMETGR-
SYD_XYLF2         ------------------QNNSELFRVASGLSYEDVLQVEGVVHARH--AVNDKIKTGK-
SYD_BUCAI         -------------------KNYKIFKKALNLRNEFCIQVFGTVQKREKKNQNIKIRTGE-
SYD_BUCBP         -------------------KSELLFKKAADLRNEFCIQVLGIVQERITKNKNYTMSTGE-
SYD_BLOFL         -------------------AQKKTYVRAADLKQEFCIQLTGIVRSRPVSQINKNMSTGF-
SYD_BAUCH         -------------------THPSIFSNAAKLRNDFCIQLHGIVRTRLDKQINYNITTGE-
SYDND_WOLSU       ------------------DDSPKAHENARVVRDEFVLIAKGKVRARGTGLENPKLATGK-
SYDND_BIFLO       ------------------EDM------ARPLRSEFVIQITGEVRLRPDGNENTHLATGK-
SYD_LACAC         ------------------DSGKDLMEIANSLGNEYVIQVRGKVVKR--SEANPDMKTGQ-
SYD_STRMU         ------------------TASNTVVKSAESLRSEYVIEVTGMIVER--DQANDNLPTGC-
SYD_LEUMM         ------------------ATNADALAVAEKVRSEYVLKITGHVIERAENQINTKIKSGT-
SYDND_STRMU       -------------------SAVADFDKLHDLHKESILAVTGEIVARDERFVNPHIKSGQ-
SYDND_BDEBA       -------------------PNKAETASSKNLRGEFVLAVEGVVRARPDGMKNAKIKTGE-
SYDND_ENDTX       --------------------NKEIFEAAEKLRSEYVIAVKGWVRNRPFGTLNTNMSTGN-
SYDND_MAGMM       --------------------FAEPHAQAHTLRSEYVIRATGKVTARSEGTINPNMDTGR-
SYDND_ELUMP       ---------------------NKDFELASTARTEYVLKVTGLVRLRQTEHINPNNPTGE-
SYDND_PELUB       -------------------SNQ-NFNSLEKIQLESVIKINGKVVERTKETINTDLQTGE-
SYDND_PROA2       -------------------EKQELFQKVERLHVESVIAVQGTVVKRSEETLNSRIPSGA-
SYDND_RUBXD       -------------------ERGEVFSAAERLRPEWSVSVEGEVVRRPEGNENPELPTGE-
SYDND_HERA2       -------------------SNPEARAMLDSIKNEYVIQVTGRVRSRLEGAENANLATGA-
SYDND_DEHM1       -------------------QSAACLDIGKELRSEYVLQVKGTVSHRPAGTENSRMLSGL-
SYDND_OPITP       -------------------ENAKLAEQVKQLKPESVIGITGKVVRRPAGTENPALPTGE-
SYDND_METI4       -------------------KDPPLFAKAKQLKNEFVVKVEGKVVERPAGTKNASIPTGE-
SYDND_BRAHW       -------------------ISKEAHNDAQDLRSEYVISVEGKIRARSPEMINPKIPTGE-
SYDND_PARUW       -------------------KSPTAHLAAEKLRSEWVISVKGTVIPRQEGMTNPKLPTGE-
SYDM_ARATH        -------------------EFPEAHGLINDMRLEYVVLVEGTVRSRPNESVNKKMKTGF-
SYDND_PROM5       -------------------DGETLFKQAEILRNETVIMVNGIVNERPKDSINKNIITGE-
SYD_LEPIC         -------------------LLGDSFTLAEKVRSEYVLAVRGTLKKRDLESINPRMQTGT-
SYDND_DICT6       -------------------ISQESYNIADTLGNEWVISVEGKVRKRPEGMENPKIPTGE-
SYD_PSELT         -----------------------SQNCQINLRRESVVQIEGVVQKRPEETINKDLLTGE-
SYDND_TREPA       ---------------------ASLWSTVNRIRLECCLAVEGVVRERPPSMINRALHTGE-
SYDND_BORBP       -----------------------LLKIAEKIKLEYCIKIQGLLSKRPPNMINENMKTGS-
SYD_UREPA         -----------------------VFNELTQLSREDVINVEGLVLLRKN--PNNDLKTGR-
SYD_MYCPE         -----------------------FFNNCLQTPKESVVEVIGIVRKRSN--VNKELKTGE-
SYD_MYCPN         --------------------------QVKYLTREDLVIVKGKL---------KRLDSVR-
SYD_MYCCT         ------------------------INLINNLKNEYVIEISGIVVKRKS--VNKELITGE-
SYD_ONYPE         ---------------------NPQYDKIALIKLETVVQIKGQVIERIN--KNPDLPTGD-
SYDM_SCHPO        LVSS---------TDFSQQKSTSVMRTLSSIPPESVVQVTGKLQRRPE---HDRRPGNE-
SYDM_YEAST        -------------------------SLLKGFTLEDVVQAVGILSLKRKLSNEDAD-EYEV
Q6CLY6_KLULA      -------------------------SFLKESQVEDVVQIIGELSEKKQTQQSTVNIEYEL
A3LXG1_PICST      ------------------TTSSKLFDLLKTTTVEDAVSVTGHVQLKKMKPG-DATREWEL
G2Q0I6_MYCTT      ----------TSSFQEPDSPGHAANQALRSIALYSPVSVTGTVARLHFDTQTGQAQSPCV
G2X9J7_VERDV      -----------EFQGQICAKGIEKADALRKIQPYSAVTVTGNMTDASSPT----------
E9E2B2_METAQ      ----------CSHANG----GQEAHEKFRQVPAFAPVVVHTQPEPPAQSAGEEQNSSSS-
E4ZST8_LEPMJ      ------------STSTTEA---EAHARLRSLKNWTPVVVTGILKERQPPKQATHQGM---
N1QNH6_SPHMS      ------------TLTEGQEGSDTAHQQLRLLAEHTPVAITGTVKPRKAPRATTSPGRP--
C5FSN6_ARTOC      ------------SNS-------QVLDALKSIEPNSAVAIHGIVKSKENQPQSSEVDDK--
H6BKD8_EXODN      SAKGGAEPPQTTRKSVLENASEREDSMVGDIQAHTPVQVVGSIVARKAPPKQTTQSSRST
                                                                              

SYDM_MOUSE        ------------------IEIKVKTAELLNACKKLPFEIKDF------------VKKTEA
P90831_CAEEL      ------------------IEIDVEELTVLNKATSNIPMLPD-------------ANANER
SYDM_DICDI        ------------------IEISVDQLQLLNNCVDLPFTVEHDS-----------TAVSEE
SYD_THETH         ------------------VEVELSALEVLAEAKTP-PFPVDAGWRGEEE-----KEASEE
SYD_DEIRA         ------------------FEVIASRVKVLNAAKTP-PFELDKG-----------ESVAED
SYDND_ACIC5       ------------------IEIAATELLILNDSKVP-PFSPAEE-----------AIANEE
SYDND_SALRD       ------------------IEVSADDLAVLNTSETP-PFVVSAHE-------ERQMNTNED
SYDND_ANAD2       ------------------IEVHASDLEIFNRSEPA-PFQI-----------EDEIDTGEE
SYDND_RHOBA       ------------------IEVRSEHFEILSASETP-PFTP-----------GQSDLPGED
SYD_AZOPC         ------------------IEIIVSRLRTLNPSEVP-PFTI-----------EENTDGGDD
SYD_AMOA5         ------------------IEIEVKSLTILNTAKTP-PFLI-----------EEQTDGGEE
SYD_FUSNN         ------------------IEVFAKEIEILNACDTL-PFQISGVD----------DNLSEN
SYDN1_SYNAS       ------------------IEVFVSELTVLSESEAL-PFAISDKAMVAGASSAGADHVNED
SYDND_PSEAE       ------------------IEVLGYELEVLNQAETP-PFPLD----EYSD-------VGEE
SYDND_LEGPH       ------------------VEVIGTQLEILNQSPTP-PFLPD----DHQI-------INED
SYD_XYLF2         ------------------VEVIATKIKILNKAAPL-PFHAH----ENP---------GED
SYD_BUCAI         ------------------IEILANVLNILNTSKSL-PLNFT----QEN---------NDD
SYD_BUCBP         ------------------IEIFALELKIFNKSQPL-PIDLK----SCN---------IEE
SYD_BLOFL         ------------------IEIEAKFFLVLNVSNPL-PLDIH----QDN---------IEE
SYD_BAUCH         ------------------IEVLATNLTILNSSQPL-PLDIN----FHN---------NEE
SYDND_WOLSU       ------------------IEVILEELIIENRSLTP-PITIG----DES--------VGED
SYDND_BIFLO       ------------------IEVVAETIEILAKSDAL-PFQVSTALENESEN----KLPGED
SYD_LACAC         ------------------VEVDATEIIILNEAKNP-PFEIKDGVE-----------ISEQ
SYD_STRMU         ------------------VEMQVTQLTILNASQTP-PFEIKDKIE-----------ANDD
SYD_LEUMM         ------------------IEVDVTEAEILSTSKTP-PFYIEDDVN-----------ANEE
SYDND_STRMU       ------------------VELRAETIEIIASSKLL-PFELDNHAH-----------AGED
SYDND_BDEBA       ------------------VEVEAIRCEILNESAVP-PFQVSD-TN-----------VNEM
SYDND_ENDTX       ------------------VELVAVELKILNTSPGL-PFEISDYID-----------TSEE
SYDND_MAGMM       ------------------IEVVVEDLTILNSSLPL-PFQLDDEI-------------SEN
SYDND_ELUMP       ------------------IEVVAQEVEILNTSIQL-PFEPDNSRQ-----------INEE
SYDND_PELUB       ------------------IEVNINSFEVLGTCKEL-PMPVFSDQE-----------YAEE
SYDND_PROA2       ------------------IEVLVDDVQVESHAVAL-PFPVADELQ-----------TSEE
SYDND_RUBXD       ------------------IEVEASSLRVLNASETP-PFEIDRERP-----------VDEL
SYDND_HERA2       ------------------IELEVQSAKILNTAKTP-PILVNRDGG-----------EDEA
SYDND_DEHM1       ------------------VEVVAEGAKILNTAKTP-PFYINEEVE-----------VDES
SYDND_OPITP       ------------------VEVVASSLEIHNISDTP-PFPLDDAGGDK---------VNED
SYDND_METI4       ------------------IELEAESLEILNPSQPL-PFNLDEDIE------------NEE
SYDND_BRAHW       ------------------IEVMVEKMELLNTSETP-PFLLEDD-IDTG----------ED
SYDND_PARUW       ------------------IEIMVHEMDILSKSKTP-PFSVSDDLIEVN----------EE
SYDM_ARATH        ------------------VEVVAEHVEILNPVRTKLPFLVTTADENKDL-------IKEE
SYDND_PROM5       ------------------LELKVQDLQILNQIKNNLPFPVSVHDYEN---------TKEE
SYD_LEPIC         ------------------IEVVLDQLEILNVAKTP-PFSLDEFDEVS-----------EE
SYDND_DICT6       ------------------IEIEVEKINIEN-PSKPLPFNLWSNKE-----------IDET
SYD_PSELT         ------------------IEVFAEKVNVFSSPEKDLPFYPGETKL-----------PAEE
SYDND_TREPA       ------------------VEVHARTLYVLSENAVL-PFRVDDVVH-----------AHED
SYDND_BORBP       ------------------FEILAKNIEIISKCNEL-PFMIEDDNN-----------ASEN
SYD_UREPA         ------------------FEIHVKKILIYSKAKTP-PLIIEDETD-----------ANEE
SYD_MYCPE         ------------------FEIDLKEFKLYSKAETP-PFLIQDDTD-----------GLED
SYD_MYCPN         ------------------FEITNPTITLFAKSKTP-PLIIEDKTD-----------ALEE
SYD_MYCCT         ------------------IEVIVKDLLVINKSELT-PFVLENDVN-----------VNED
SYD_ONYPE         ------------------IEILVSHIEILSEAQTL-PLNVFQSQE-----------SLEE
SYDM_SCHPO        ------------------FELHVEDVKLLNVAKNLQLFPGDEK-------------PGMR
SYDM_YEAST        Q---------------------LEDITVLNASNKKPAQMQDFKLS-------------AI
Q6CLY6_KLULA      K---------------------IIELQKLNQANKKPSQLQDLKADD------------GA
A3LXG1_PICST      V---------------------VDNLQILNSSNLDAARLDKLKHSN-----------PEQ
G2Q0I6_MYCTT      DHENASSRPGSF------PEHVFRIDLDLQSIQPLNVFPKDIIVSK-----------GVQ
G2X9J7_VERDV      -----------------------KFDMEIESIGHLNPFPKDIIVSS-----------DAV
E9E2B2_METAQ      -----------------------KRTLYLKDIRSLNTVPKDLIVTS-----------DVQ
E4ZST8_LEPMJ      -------------------KLVGTREIAVTHVEPINEVSKDLIITE-----------ETV
N1QNH6_SPHMS      ------------------GTLITGAEVKVEKVTPLNEFPKDIIMNE-----------DTV
C5FSN6_ARTOC      -------------------DGLNTVEVELQDIQCLNEFPKDIIVTS-----------DTV
H6BKD8_EXODN      ECKREENTVQRLDPFVGSIDLISHIEIRADSISPLNSFPSETIAAY-----------DTV
                                                                              

SYDM_MOUSE        LRLQYRYLDLRSF-QMQYNLRLRSQMVMKMREYLCNL-HGFVDIETPTLFKRTPGGAKEF
P90831_CAEEL      TRLKYRYIDLRSD-KLQKSLRLRSEFVHNVRRFLVEK-SGFVDVETPTLFRRTPGGAAEF
SYDM_DICDI        LRLKYRYVDLRRD-KVQSNIRLRSKVAMAARNYLINQ-Q-FIEVETPTLFRPTPEGAREY
SYD_THETH         LRLKYRYLDLRRR-RMQENLRLRHRVIKAIWDFLDR--EGFVQVETPFLTKSTPEGARDF
SYD_DEIRA         IRLKYRYLDLRRP-EMQRALMLRSKAVTAVTEFLDA--EGFIQVETPMLTKSTPEGARDF
SYDND_ACIC5       VRLKYRYLDLRRP-EMQHNFEVRHKVALAVRQYLSG--QGFFEVETPFMTRSTPEGARDY
SYDND_SALRD       LRLAHRYLDLRRP-DLQENIELRHRLYQTTHRYFDA--HDFLEVETPVLMKSTPEGARDF
SYDND_ANAD2       KRLQYRYLDLRRA-PLQRTLMTRAKVNHLTRNYFTD--KGFLELETPFMVKYTPGGARNF
SYDND_RHOBA       LRLKYRFLDLRRK-EMQQALIRRSEIIKCMRDYFAE--HDFIDVETPILGRSTPEGARDY
SYD_AZOPC         LRMKYRYLDLRRT-LIRSNLELRHQMVFAIRNYLNS--HEFMEVETPVLINSTPEGARDF
SYD_AMOA5         LRMQYRYLDLRRP-PLQKNLLLRQLVAQHARAYLEQ--HHFVDVETPLLIKSTPGGARDF
SYD_FUSNN         MRLTYRYLDIRRN-KMLNNLKMRHRMIMSIRNYMDN--AGFLDVDTPVLTKSTPEGARDF
SYDN1_SYNAS       LRMQYRYLDIRRP-AMQKNLILRHRISQCVREFLDS--RGFVEVETPVLTMSTPEGARDY
SYDND_PSEAE       TRLRYRFIDLRRP-EMAAKLKLRARITSSIRRYLDD--NGFLDVETPILGRPTPEGARDY
SYDND_LEGPH       LRYKYRYIDLRRA-VMQKKLTLRHKLNSCIRNYLNE--QNFLDIETPMLTKATPEGARDY
SYD_XYLF2         IRLKYRYLDLRRP-EMQRMQRTRIKLVQALRRHLDM--HGFQDIETPILTKATPEGARDF
SYD_BUCAI         SRLKYRYLDLRSF-DILENLKIRNKITYLIRNFMTK--KNFLDIETPILTKSTPEGARDY
SYD_BUCBP         TRLKFRYLDLRHP-NMIRNIIIRNDITIIIRNFMKK--NKFLDIETPILTKSTPEGARDY
SYD_BLOFL         NRLKYRYLDLRRP-IMFHNIQTRSRVMALTHRFMEL--EGLLNIDTPVLAKSTPEGARDY
SYD_BAUCH         QRLKFRYLDLRNP-EMAQRLKLRAKITSLVRHFMEK--KGFLDIETPMLTKTTPEGARDY
SYDND_WOLSU       LRLKYRFLDLRNP-KAYDTFRLRSKAAIAARNSLDG--MGFLEVETPILTKATPEGARDY
SYDND_BIFLO       VRLKYRYLDLRRP-SMQYNLKLRSDMAKAARHALED--MDFTEVETPTFIKSTPEGARDF
SYD_LACAC         TRLKYRYLDLRRP-EVQKAIILRSKILRATHEFFDE--NGFIDIETPILGKSSPEGARDY
SYD_STRMU         TRLRYRYLDLRRP-EMLKNFKLRAKVTHVIRNYLDD--LDFIDVETPMLAKSTPEGARDY
SYD_LEUMM         LKLQYRYLDLRRP-EMQKNLRIRSKIMSSAMHFMDT--HDFINIETPVLAKSTPEGARDY
SYDND_STRMU       IRQKYRYLDLRRE-KMTANLKLRHQVTKAIRDYLNQ--ADFIDVETPYLTKSTPEGARDF
SYDND_BDEBA       LRLKYRYLDLRSA-RLSSHLITRHKVAQLVRRFLSD--NGFLEVETPILYKSTPEGARDY
SYDND_ENDTX       LRLKYRYLDLRRP-NLQKNFVMRHKISKEIRNFLNE--EGFLEIETPFLTKSTPEGARDF
SYDND_MAGMM       LRLQYRFLDLRRP-DMQRNLMFRHRIMQSVRKHLDG--SGFVEVETPMLTRSTPEGARDY
SYDND_ELUMP       TRLKYRYIDLRNP-VMLHNLTTRHKVAQAARRYFSD--NGFIEIETPILTRSTPEGARDY
SYDND_PELUB       IRLKYRFLDLRRK-KIHDNIILRSKVISFIRSEMSK--LGFLEFQTPILTSSSPEGARDF
SYDND_PROA2       LRLTYRFLDLRRE-KIHQNIVFRSQLISKVRRYLED--HGFMEIQTPILTASSPEGARDF
SYDND_RUBXD       TRLRYRYLDLRRE-RMRENILFRDRVVRYIRRYLAE--RDFVEVETPLLTKSTPEGARDY
SYDND_HERA2       LRLKYRYIELRRE-RQQHILGLRHRTIKFMRDWMDR--EGFWEIETPILMKSTPEGARDY
SYDND_DEHM1       LRLKYRYLDIRRQ-GMKNNLIIRHKTVSFMRQFLND--RGFIEIETPILIKSTPEGARDY
SYDND_OPITP       LRLTYRYLDLRRP-KMRKNLQVRHRAAKSIRDYFDA--QEFIEVETPALFKSTPEGAREY
SYDND_METI4       LRLSFRFLDLRRK-KILNCLKVRHLVSSVVREYLSR--EGFLEVETPILSKSTPEGARDF
SYDND_BRAHW       IRLKYRYLDLRRP-TVFNNLYKRFQITNAFRKHLSD--NGFIDVETPILNKSTPEGARDF
SYDND_PARUW       LRLKYRYLDIRRG-DVAKKLITRHQAMLAVRNYLNN--QGFLEISTPILGKSTPEGARDY
SYDM_ARATH        IRLRFRCLDLRRQ-QMKNNIVLRHNVVKLIRRYLEDR-HGFIEIETPILSRSTPEGARDY
SYDND_PROM5       LRLKYRYLDIRRG-KLLENLKTRHKIIKAIRNYLDN--SGFTEVETPLLTKSTPEGARDF
SYD_LEPIC         LKLKYRYLDFRRE-ELKNRMIKRHEFIFAIRNYLNK--RKFVEIETPILNKSTPEGARDF
SYDND_DICT6       VRLKYRYLDLRRD-KMQSNIIFRHNFILAIRNFLAQ--NGFIEIETPYLIVSTPEGARDF
SYD_PSELT         IRLKYRYIDLRRK-EVSDRIITRHKVTQCIRNYLSK--NGFIEVETPFLTKSTPEGARDF
SYDND_TREPA       IRLKYRYLDLRSQ-RMQERIALRSRVALAIRQFLSM--KGFIEIETPTFICSTPEGARDF
SYDND_BORBP       SKLKYRYLDLRRD-SLKNKIILRCQATHLIRNFLVK--KKFLELETPTFVKSTPEGARDF
SYD_UREPA         IRFRYRYLDLRRD-VNLKIFELRSKVYQAFRNYLYS--QDFIETETPILAKPTPEGARDF
SYD_MYCPE         LRLKYRYLDLRRP-VMQNNIINRGKIINLFRSFLVK--NNFNEIETPYLSKQTPEGARDY
SYD_MYCPN         VRLRYRYLDLRRP-VMQKRLALRHKVTLAVRNWLDQ--MGFIEVETPTLTKSTPEGARDF
SYD_MYCCT         TRLTYRYLDLRRQ-VMQNNLIIRAKINHIIRNYLTD--LNFLEVETPYFAKSTPEGARHF
SYD_ONYPE         TRLKYRYLDLRNP-EVKHFLIQRHHITQSIRQTLLK--NDFLELETLILSKSTPEGARDY
SYDM_SCHPO        IQLANRHIQLRAP-KYNSYLRQRSRLAYQVHSFFND--REFCEVETPLLFKSTPEGAREF
SYDM_YEAST        YPPEFRYLQLRN--PKYQDFLKKRSSISKEIRNSF-NNFDFTEVETPMLFKATPEGAREF
Q6CLY6_KLULA      FPPEYRYLQLRL--PKYQNNLKLRYEASKNVRTVL-DSLNFTEVETPLLFKSTPEGAREF
A3LXG1_PICST      LPPQFRYLQLRT--KFYQNALKTRSKVAMLIRNIFTENHEFTEIETPLLFKSTPEGAREF
G2Q0I6_MYCTT      FPPSARHLQVRFSDPLRTRLLVRPQIAFRLRQSLNDL--AFTEVETPVLFKSTPEGAREF
G2X9J7_VERDV      FPPEARHLQLRFHAKLKESLRFRAFLKASVGQTMSRL--GYMDVETPTLFKSTSEGAREF
E9E2B2_METAQ      FPQTKRHLQIRFHPELQARLKFRSWLKSQLNQSLLEK--RFTDVETPTLFKSTSEGAREF
E4ZST8_LEPMJ      FGPDQRHLQLRADSRLRNNIFLRDRAGRAARKVLAE--NNLVEVETPILFKSTPEGAREF
N1QNH6_SPHMS      FPAEQRHLQLRNDAELRNALAFRSRVARKIRDELGDR-HGFIEVETPLLFKSTPEGAREF
C5FSN6_ARTOC      FPPSKRHLQIRNDASLRQSLAFRAKANVALRRALEEFEPPFLEVETPILFKSTPEGAREF
H6BKD8_EXODN      FPPEMRHLQFRTDHELRRRIRLRSRVAANIRQRMLGL--GFDEIETPLLFKSTPEGAREF
                       * ::.*                               : .*  :   :. ** .:

SYDM_MOUSE        LVPSREP------GKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQP-EFT
P90831_CAEEL      VVPAPSPN----QGLAYSLPQSPQQFKQLLMVGAIDRYFQIARCYRDEGSKGDRQP-EFT
SYDM_DICDI        LVPTRHQ------GQFYSLPQSPQQYKQLLMVGGIDRYFQLARCYRDEDLRSDRQP-EFT
SYD_THETH         LVP-YRHE----PGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQP-DFT
SYD_DEIRA         LVP-SRLN----PGEFYALPQSPQLFKQLLMIAGFDRYYQLARCFRDEDLRADRQP-DFT
SYDND_ACIC5       LVP-SRVH----PGEFYALPQSPQLFKQILMISGMDRYFQIARCFRDEDLRADRQP-EFT
SYDND_SALRD       LVP-SRLH----PGRFYALPQSPQTYKQLLMVGGLDRYVQIVKCFRDEDLRADRQP-EFT
SYDND_ANAD2       LVP-SRLN----PGKFYALAESPQLFKQLYMMAGFDRYFQIVRCFRDEDLRLDRQP-EFT
SYDND_RHOBA       LVP-SRVH----PSNFYALPQSPQLYKQILMVAGFDRYVQVAKCFRDEDLRADRQP-EFT
SYD_AZOPC         IVP-SRMN----MGEFYSLPQSPQLFKQLLMIAGFDRYFQVVKCFRDEDLRTDRQP-EFT
SYD_AMOA5         VVP-SRIH----PQQFYALPQSPQIFKQLLMVAGLDRYYQIAKCFRDEDFRADRQP-EFT
SYD_FUSNN         LVP-SRTN----PGTFYALPQSPQLFKQLLMIGGVEKYFQIAKCFRDEDLRADRQP-EFT
SYDN1_SYNAS       LVP-SRIH----PRSFYALPQSPQLFKQLLMIGGMERYFQLARCFRDEDLRPNRQP-EFT
SYDND_PSEAE       LVP-SRTY----PGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQP-EFT
SYDND_LEGPH       LVP-SRVH----PGQFYALPQSPQLFKQLLMMSGFDKYYQIVRCFRDEDLRADRQP-EFT
SYD_XYLF2         LVP-ARMH----PGEFYALPQSPQLFKQILMVAGFDRYYQIARCFRDEALRADRQL-EFT
SYD_BUCAI         LVP-SRNH----YGKFYALPQSPQLFKQILMISGIDRYYQIVKCFRDEDLRSDRQP-EFT
SYD_BUCBP         IVP-SRIH----KNKYYALPQSPQLFKQLLMISGIDRYYQIAKCFRDEDLRSDRQP-EFT
SYD_BLOFL         LVP-SRLH----INKYYALPQSPQMFKQLLMIAGIDRYYQITKCFRDEDLRSDRQP-EFT
SYD_BAUCH         LVP-SRVH----KGQFYALPQSPQLFKQLLMISGFDRYYQIVKCFRDEDLRADRQP-EFT
SYDND_WOLSU       LVP-SRVH----PGEFFALPQSPQLFKQLLMISGFDRYFQIAKCFRDEDLRADRQP-EFT
SYDND_BIFLO       VVP-ARLV----PGSWYALPQSPQLLKQLLMVSGVERYYQLARCYRDEDFRADRQP-EFT
SYD_LACAC         LVP-SRIY----PGSFYALPQSPQLFKQLLMGAGFDKYYQLARCFRDEDLRGDRQP-EFT
SYD_STRMU         LVP-SRMS----RGHFYALPQSPQITKQLLMNAGFDRYYQIVKCFRDEDLRGDRQP-EFT
SYD_LEUMM         LVP-SRVF----PGSFYALPQSPQLFKQLLMGAGFDRYFQIARAFRDEDLRGDRQP-EFT
SYDND_STRMU       LVP-SRVF----KNQFYALPQSPQMLKQLLMGAGLERYYQIVRCFRDEDLRGDRQP-EFT
SYDND_BDEBA       LVP-SRVN----PGHFYALPQSPQTLKQLLMISGYDRYFQIARCFRDEDLRADRQP-EFS
SYDND_ENDTX       LVP-SRLH----HGNFFALPQSPQLFKQILMSAGFDKYYQIVRCFRDEDLRADRQP-EFT
SYDND_MAGMM       LVP-SRVN----PGDFYALPQSPQLFKQLLMMAGYDRYFQIVRCFRDEDLRADRQP-EFT
SYDND_ELUMP       LVP-SRVH----EGKFYALPQSPQMFKQTLMASGVDRYFQIARAFRDEDLRSDRQP-EHT
SYDND_PELUB       LVP-SRLN----PGKFYALPQAPQQFKQLIMVSGFDKYFQIAPCFRDEDARADRSPGEFY
SYDND_PROA2       LVP-SRLH----PGKFYALPQAPQQFKQLLMVSGFPRYFQIAPCFRDEDARADRSPGEFY
SYDND_RUBXD       LVP-SRLY----PGQFYALPQSPQQFKQLLMVAGLERYFQIARALRDEDQRGDRQP-EHT
SYDND_HERA2       LVP-SRLH----PGEFYALPQSPQQLKQLLMVSGIDKYFQIARCMRDEDLRADRQP-EFT
SYDND_DEHM1       LVP-SRLF----PGQFFALPQSPQQLKQLLMVAGMEKYYQVARCFRDEDLRADRQP-EFT
SYDND_OPITP       LVP-SRIH----PGQFYALSQSPQQFKQILMVAGVEKYFQIARCFRDEDLRADRQM-EFT
SYDND_METI4       LVP-SRLS----PGKFYALPQAPQQYKQLLMVAGIDKYFQIARCFRDEDLRSDRQP-EFT
SYDND_BRAHW       LVP-SRLN----AGDFYALPQSPQIFKQILMIGGFDRYYQIAKCFRDEDLRADRQP-EFT
SYDND_PARUW       LVP-SRVY----PGNFYALPQSPQIFKQLLMISGMDRYFQIAQCFRDEDLRADRQP-EFT
SYDM_ARATH        LVP-SRIQ----SGTFYALPQSPQLFKQMLMVSGFDKYYQIARCFRDEDLRADRQP-EFT
SYDND_PROM5       LVP-ARLS----NGDFFALPQSPQLFKQLLMVGGLDKYYQIAKCFRDEDLRADRQP-EFT
SYD_LEPIC         LVP-SRLN----PNQFYALPQSPQIFKQILMVGGMERYFQIVKCFRDEDLRADRQP-EFT
SYDND_DICT6       IIP-SRLQ----PGKFYALPQSPQLFKQILMVSGFDRYFQIARCFRDEDLRADRQP-EFT
SYD_PSELT         LVP-SRLK----PGTFYALPQSPQLFKQLLMIGGIDRYFQVVRCFRDEDLRADRQP-EFT
SYDND_TREPA       VVP-SRVC----PGRFYALPQSPQLYKQLLMVAGFDRYFQLARCYRDEDARGDRQP-EFT
SYDND_BORBP       VIP-SRIH----KGSFYALPQSPQLYKQLIMIAGFDKYFQIARCYRDEDSRGDRQP-EFT
SYD_UREPA         YVP-TRTR----K--FYALPQSPQTFKQLLMVAGFQKYFQITKCFRDEDLRSDRQP-EFT
SYD_MYCPE         LVP-TRSK----K--FFALPQSPQIYKQLLMVSGMDRYFQIARCFRDEDLRADRQP-EFT
SYD_MYCPN         LVP-ARIR----EHSFYALPQSPQIYKQLLMVGGTEKYFQIAHVYRDEDSRKDRQP-EHT
SYD_MYCCT         LVP-SRLN----KNKFYALPQSPQLFKQLLMISGIDRYYQIVRCFRDEDLRIDRQP-EFT
SYD_ONYPE         LVP-SRIY----PGNFYALPQSPQLFKQLYMIAGFERYFQVARCFRDEDLRSDRQP-EFS
SYDM_SCHPO        VVP-SRLN----PGKFYALPQSPQQYKQILMASGIGNYYQIARCFRDEDLRFDRQP-EFT
SYDM_YEAST        LVP-TRTKRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQP-EFT
Q6CLY6_KLULA      LVP-TRGK-IDGEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQP-EFT
A3LXG1_PICST      LVP-TRSP-----DKFYALPQSPQQYKQILMSSGFTRYFQIAKCFRDEDLRADRQP-EFT
G2Q0I6_MYCTT      LVP-TRRP-----GLAYALPQSPQQYKQMLMASGIRGYYQFARCFRDEDLRADRQP-EFT
G2X9J7_VERDV      LVP-TRRA-----GHAYALPQSPQQYKQVLMAAGLGGYYQFARCYRDEDHRADRQP-EFT
E9E2B2_METAQ      LVP-TRQR-----GTAYSLSQSPQQYKQVLMASGIGRYMQWARCYRDEDLRTDRQP-EFS
E4ZST8_LEPMJ      LVP-TRQK-----GLAYALPQSPQQYKQILMASGITKYFQFARCFRDEDLRADRQP-EFT
N1QNH6_SPHMS      LVP-SRSP-----GMAYALPQSPQQYKQILMASGIPRYLQIAKCFRDEDLRADRQP-EFS
C5FSN6_ARTOC      LVP-TRNR-----GLAYALPQSPQQYKQMLMASGIPRYYQFARCFRDEDLRADRQP-EFT
H6BKD8_EXODN      IVP-TRRK-----GMAYALPQSPQQYKQVLMASGISRYFQFARCFRDEDLRADRQP-EFT
                   :*             ::* ::**  **  : ..   * * .   ***  : :*.  :. 

SYDM_MOUSE        QIDIEMSFVEQ-TGIQRLVEGLLQYSWPGDKDPLV--TP---------------------
P90831_CAEEL      QVDVEMSFTTQ-NGVMQLIEDMIISAWPESLNHIKPKSP---------------------
SYDM_DICDI        QIDMELSFVNT-QMIYRIIEGLVKTLWKEAGFNID--YE---------------------
SYD_THETH         QLDLEMSFVEV-EDVLELNERLMAHVFREALGVELPLP----------------------
SYD_DEIRA         QLDMEMSFVEQ-DDVLEVQERLLAHVFRRVLDVELPLP----------------------
SYDND_ACIC5       QIDLEMTFPQQ-ETIFGVVEGFLAAAF-EAVGQQITVP----------------------
SYDND_SALRD       QIDVEMTFATE-EQVYELTEGLMADLWDTLEDTTLETP----------------------
SYDND_ANAD2       QIDVEMSFVEQ-NDVFDVMEGLVVKLWKEVLGIEIPRP----------------------
SYDND_RHOBA       QLDLEMSFVDS-EDIIGLIDGLVAKTAKQVLGKDITLP----------------------
SYD_AZOPC         QVDCEMSFVEQ-EDILSIFEGLTKHLFKTIKGLDISG-----------------------
SYD_AMOA5         QIDCELSFVTQ-ADILHIFENFTKYIFEATIQVRLDK-----------------------
SYD_FUSNN         QLDIEMSFVEK-EDVMNEIEGLAKYVFKNVTGEEANYI----------------------
SYDN1_SYNAS       QLDIEASFIDE-EFLYELIEELTVRMFA-IGGIALSRP----------------------
SYDND_PSEAE       QIDIETSFLDE-SDIIGITEKMVRQLFKEVL-DVEF-DE---------------------
SYDND_LEGPH       QLDIEMAFINE-EDILQLIEGLLKIVFKEIL-NITLPDK---------------------
SYD_XYLF2         QLDMEFAFVSE-RDVQDFVEEMIRRVFKEVA-GIELDTT---------------------
SYD_BUCAI         QIDIEVSFMSA-KKIRNLVENLIKKLWLEIR-NINL-KK---------------------
SYD_BUCBP         QIDIEVSFLNA-KKVRKIIERMITSVWNKII-NVHL-KK---------------------
SYD_BLOFL         QIDVEISFITA-KKIRELMEFFICKLWKEIL-NVEL-EV---------------------
SYD_BAUCH         QIDVEASFINA-EQICKIMEDLVRHLWREIQ-EVEL-EN---------------------
SYDND_WOLSU       QIDVEMSFCDQ-EDVMGVAEKLLGDIFSACG-HTIP-EH---------------------
SYDND_BIFLO       QLDMEMAYVDQ-EDVMAMTEKVIAAIWKSAG-YEVQ-LP---------------------
SYD_LACAC         QIDMEMSFADE-QTIQDYTEGLLKKIMKDVMGIDLKTP----------------------
SYD_STRMU         QVDLETSFLSE-QEIQEITERLIACVMKEVKGIELQLP----------------------
SYD_LEUMM         QMDVETSFMTA-DEIRELVNAWVKAMMHDVVDFDLDTAE---------------------
SYDND_STRMU       QVDLEMSFVSE-EDVRNLVEGMLKAVVKASKGIELTEA----------------------
SYDND_BDEBA       QIDMEMSYIDQ-EDIMEMNEKLLRTIWKEIKGIDVGAI----------------------
SYDND_ENDTX       QVDVEMSFVDE-EDVMVVIERMLARVFKMTLNLDIKMP----------------------
SYDND_MAGMM       QIDLEMSFVEP-NDVMELTESVVVEAFKEALGVSIPQP----------------------
SYDND_ELUMP       QIDIEMSFVTL-ADVFAAGEGMIAEVFKAAGEDAPAAP----------------------
SYDND_PELUB       QLDLEMSFVEQ-EDVFQVVEKLIVNVFKKFSEKKLMYEK---------------------
SYDND_PROA2       QVDMEMAFIEQ-DDLFEILEGMLRYLTETMSTKRITQFP---------------------
SYDND_RUBXD       QLDLEMSYTTQ-DEVLQLIEGLYTEIVERLTEKRVLFKP---------------------
SYDND_HERA2       QLDIEMSFVEQ-DDVLDVVERLMTELVANVTPHKRLVSP---------------------
SYDND_DEHM1       QLDMEMSFVDE-NDMMQLMEDLFTGLVASVRPDMKYNKK---------------------
SYDND_OPITP       QVDVEASFVTR-EDIYALFEGMLKKVWKDVL-DVDIPTP---------------------
SYDND_METI4       QIDLEASFVEV-EDIMKWVEEMIQLIFLKVL-GIELSLP---------------------
SYDND_BRAHW       QVDIETSFLNT-DEFLSIMENVTANIVKDVYGIDLPTP----------------------
SYDND_PARUW       QIDMEMSFGTP-EDLMNIVEDLIKTVFKTCSNIDVPTP----------------------
SYDM_ARATH        QLDMEMAFMPM-EDMLKLNEDLIRKVFSEIKGIQLPDP----------------------
SYDND_PROM5       QLDIEMSFVSE-EEIIAFNEKLIKHIWKNVLNINLNED----------------------
SYD_LEPIC         QLDMEFSFVSQ-EEILSEIEGLVETIYKEVFNIQLSIP----------------------
SYDND_DICT6       QLDMEMSFVEI-EDIFNIIENLFKTTLKNLMNIDITVP----------------------
SYD_PSELT         QIDIEMSFNTM-DDVLEITEGMIKHLFKEVLQVDLPGK----------------------
SYDND_TREPA       QIDLEMSFVSR-DDVMRVNEDMLRYVFRTSIGVELPTF----------------------
SYDND_BORBP       QLDLEMSFVKK-ENIFKLIENMLFLIFKNCLNIKLPKK----------------------
SYD_UREPA         QVDIELSFADE-IEIQTLIENLLKYVFKQTINVDLTTP----------------------
SYD_MYCPE         QIDIETSFLSD-LEIQSIVQEMFIYVFKEFFNIKLKTP----------------------
SYD_MYCPN         QIDLEVAFYTK-EMVMDLIQRLFVDVFRQVLNIKLKKP----------------------
SYD_MYCCT         QLDLEMSFATS-EDVMQISESLIKKILKEVKNFEIKEP----------------------
SYD_ONYPE         QIDIETSFLNQ-DEIMSLTEEIIVDLFANIWKKPLSQP----------------------
SYDM_SCHPO        QIDLEMSFVDKPHEIMEVVEDLLVRLVSFAKGITLAKP----------------------
SYDM_YEAST        QVDMEMAFANSED-VMKIIEKTVSGVWSKFSKK-RGLLTLDSKGTLVPAKKE--------
Q6CLY6_KLULA      QVDLEMAFSSGKD-VREVVEKVITSTWNKLHASGTDLHTLDRTGKIIPV-----------
A3LXG1_PICST      QVDLEMAYVNNCDQVGVVVEDLIHNVWNRIRNISTYRVNEQGYLEAIDFDSTK-------
G2Q0I6_MYCTT      QLDLEMSFATGEDVMRTVESIISDLAVFLDSDFCVVDEGEETYLAPRKSLKAKNRED---
G2X9J7_VERDV      QMDLEKSFATGETIQADVEAFMQTTWDAMREEYNRKDD-DTSFIPHRKSAPSSDEPSGGE
E9E2B2_METAQ      QLDMEWAFAGSAKVQADINDILLAALSRLRPARSYSDIRGERIPILSDILNEPAPTD---
E4ZST8_LEPMJ      QLDMEMAFAGEEDVMNTIE-LLLADLWDKMDLGSI-------------------------
N1QNH6_SPHMS      QVDLEMAFATGEDVMNVME-SVIKMLWSDLLQVDL-------------------------
C5FSN6_ARTOC      QLDMEMSFATAEDVMTTTE-ALVKKLWASVMPEPLA------------------------
H6BKD8_EXODN      QLDLEMSFAGAPQVMRTVEDIILNAVWPSVPGIAAIRKADTIKDDAESASGP--------
                  *:* * ::                                                    

SYDM_MOUSE        -------------FPSMTFAEALATYGTDKPDTRFGMK---IVDVSDVFR--NTELRFLQ
P90831_CAEEL      -------------FPRIPYSDAMRLYGIDKPDMRIPWQ---IDDVD------NDIFEFLQ
SYDM_DICDI        -------------FPFYTYEQVLSTYGIDKPDTRYDMK---LVDITDCFNKDETNINLFK
SYD_THETH         -------------FPRLSYEEAMERYGSDKPDLRFGLE---LKEVGPLFRQS--GFRVFQ
SYD_DEIRA         -------------FPRMSYFDAMDRYGSDKPDLRFDSA---FTDVTGLFRGG--EFAAFA
SYDND_ACIC5       -------------FPRMTYDKAIELYGIDKPDLRL-PP---MTDVRSVFSDE--ELQSLK
SYDND_SALRD       -------------FPRMTYDEALRTYGTDKPDLRFDLE---LHDVSDCFAGS--GFRVFD
SYDND_ANAD2       -------------FQRMPFEESMAKYGNDKPDLRFDMPHVVLTDLVRQHDGG--GVPLMH
SYDND_RHOBA       -------------LPRMTYEEAMRRFGSDAPDLRFGLE---IVDVTSVAAKT--DFRVFR
SYD_AZOPC         -------------FSRLSYADAIRFYGSDKPDIRFGMQ---LVEIKDITIGR--GFDVFD
SYD_AMOA5         -------------FPCITYAEAMQKYGTDKPDIRFGMR---LIELTELVKNS--EFPLFK
SYD_FUSNN         -------------FQRMPYAEAMDRFGSDKPDLRFGVE---LKDLSDIINNS--SFNAFS
SYDN1_SYNAS       -------------FPRMTYAEAMDTTGSDRPDLRFGLR---MADVTGVFSRT--SYSIFK
SYDND_PSEAE       -------------FPHMPFEEAMRRYGSDKPDLRIPLE---LVDVADQLKEV--EFKVFS
SYDND_LEGPH       -------------LPRMSYKEAMTRYGSDKPDLRNPLE---LIDIADLVKDC--DFNVFA
SYD_XYLF2         -------------FPRMTWKEAMRRFGSDKPDMRINLE---LIDVAALVADS--TFTPFT
SYD_BUCAI         -------------FPQISFHEAMKKYGSDKPDLRNPIE---IIDVSNIFKDK--KFISFF
SYD_BUCBP         -------------FQKLSFYDAIKMYGTDKPDLRNPIQ---LIDVTNIIHVK--NNINAI
SYD_BLOFL         -------------FSQFSYAEVISRFGSDSPDLRNPIE---MKDVSSIFQSL--GNKLFI
SYD_BAUCH         -------------FQYMSYTAAMYRFGSDKPDLRNPIE---IVDVVDLVKNT--TCTIL-
SYDND_WOLSU       -------------FPHLTYDRAMEEYGSDKPDLRFEMP---LVEVIDLFGDS--NNEIFA
SYDND_BIFLO       -------------LPRITWKDAMDKYGSDKPDLRFGNP---LVELTEYFKNT--PFRVF-
SYD_LACAC         -------------IKRMSWTDSMNKYGCDKPDTRYGML---IHDLSSIFK-D-SDFKVFS
SYD_STRMU         -------------LPQISYDTAMNNYGSDKPDTRFEMT---LQDLTDLVK-N-IDFKVFS
SYD_LEUMM         -------------IPTLTWQESMDRFGTDKPDLRIAYE---IKDLSETVK-N-SEFGVFA
SYDND_STRMU       -------------FPIISYAQAMRRFGSDKPDTRFAME---LKDLTELSRGN-TSLFLQK
SYDND_BDEBA       --------------PRMTYQEAMDRYGIDKPDTRFGVE---IKDLKSIVT-G-SGFKVFD
SYDND_ENDTX       -------------FERMPYSEAMLRFGSDKPDTRFEVE---IKDFSRELK-N-SGFSVFS
SYDND_MAGMM       -------------VRRITYAEAMDKYGLDAPDMRITME---LKDLTEVMK-S-SEFKVFR
SYDND_ELUMP       -------------FEQMEYADVMAKYGSDKPDIRYEID---ITDIGGIFT-N-SNFKVVS
SYDND_PELUB       -------------FPRIPYEESMLKYGSDKPDLRNPLI---ISDLSNIFIRDDVTFEIFK
SYDND_PROA2       -------------FPRLSYRDVMNRFGSDKPDLRVPLE---MQDVTELFVGS--SFKVFA
SYDND_RUBXD       -------------FPRLTYAEAMERFGSDKPDLRFGLE---LRDVSDLARSS--EFKVFR
SYDND_HERA2       -------------FPRLTYADAIEYYGSDKPDLRYDLK---FVNVGEIVKDS--QFGVFT
SYDND_DEHM1       -------------FPRISFADAMEKYGCDKPDLRFGME---LADITDIGASS--AFGVFK
SYDND_OPITP       -------------FPRMAFHDAMNRYGVDKPDVRFALE---LADFSELFKNS--AFKVFQ
SYDND_METI4       -------------FVRLTYSEALDNYGSDKPDLRIEWQ---IQDVGTVFKNT--QFKLFR
SYDND_BRAHW       -------------FPRLNYYDAMEMYGSDKPDTRFELK---LINVEDAVRGC--DFAVFK
SYDND_PARUW       -------------FKRLSHAICMEEYGCDRPDLRFGMK---LHNLNHLAAQT--TFSVFL
SYDM_ARATH        -------------FPRLTYADAMDRYGSDRPDTRFDLE---LKDVSNVFTES--SFRVFT
SYDND_PROM5       -------------FPRMSWQEAMDNYGTDRPDTRYGML---LKNLGEILGNI--GFNIFT
SYD_LEPIC         -------------FPRMTYNTAMEEYGSDKPDLRFGMK---LVDVSEIVKDC--DFNVFA
SYDND_DICT6       -------------FPRITYEEAMNTYGSDKPDLRYDLK---ISDVTEIFKNL--PLEFIR
SYD_PSELT         -------------LDRLTYNECMNKYGSDKPDRRIGME---FFDLSKHFKTC--EYHAIN
SYDND_TREPA       -------------FPRLTYAQALDQYGTDKPDMRFKPV---LQNADFMGMLG--TFTPFE
SYDND_BORBP       -------------FKKITYKTAMNKYGSDKPDTRFELT---LQDISRNLKNS--EFNVFK
SYD_UREPA         -------------FMRMSYEQAINDYGSDKPDLRFDLK---IKTLNTYFENSK--TLFFQ
SYD_MYCPE         -------------FTRMSYSDAIEYYGSDKPDIRFENK---IMNLTNYFKDTN--FKIFK
SYD_MYCPN         -------------FPVLKFAEAFNRFGSDKPDLRYGFE---LEDCTDLFQDS---PNQFT
SYD_MYCCT         -------------LLRLSYKDAIDLYGSDKPDLRYELK---IHTLNDIFKNSD--IKMFL
SYD_ONYPE         -------------FLRLTYQQAFELYGSDKPDLRNPLK---ITDFTTFFDTTTCPQNMFS
SYDM_SCHPO        -------------FQHITYQHAIDKYGSDKPDIRFELP---LKNITSLLPKQ--DPLIST
SYDM_YEAST        --------NGTVSIFRMTYEQAMTSYGIDKPDLRAPDLKIINLGEFNAFSHLNK-KFPVF
Q6CLY6_KLULA      --------SGTEKIINLTYQQVMTQYGIDKPDLRYPDLKLMDLSEFKAYGYTNK-EFPVF
A3LXG1_PICST      -------PNSSLHFGKLKYIDALCKYGIDKPDLR-SKLEFVNLSELFIPSSTNNGQFPVL
G2Q0I6_MYCTT      --SAPGSRYMMPPFPRMSYEEVMTRFGIDKPDLRIPFELHRVDHILP-RSFVSMITHLEN
G2X9J7_VERDV      PVSYKEYPAISTPFRRMKYQECMDLYGSDKPDLRIPNRIERVDAHLS-PNFVSMITDLER
E9E2B2_METAQ      -------EPPAHKFTTLTFAESIAAYGSDKPDLRIPNKIHALEDTEPYRDFISMITHLSD
E4ZST8_LEPMJ      ----------PTKFQRMTYEEAMSSYGSDKPDLR---------YEAK-ANLIGKITPLQD
N1QNH6_SPHMS      ----------PEKFARMTYHEAMSRYGSDKPDLRLGCEIRRIEYMLP-VDLIQKIGPLDF
C5FSN6_ARTOC      ----------PEPFPRMSYHMAMSLYGSDKPDTRFDMRLRRVDQYLP-GDFISKITSLNS
H6BKD8_EXODN      -------DSDGLTFPRVSYHEVMARYGSDKPDTRLGSEISRIDDWLP-SNMKGMLTSLED
                                        :   * * ** *                          

SYDM_MOUSE        DALAKPQG-----TVKAICVHDGAKYLRKEDIEFIRKFAVHHFSQ--EVLPIFLNAKKN-
P90831_CAEEL      KDIDDDTW-----RSRILVCRGAGKTTISNSMKNEWKRLIQMNENG-KNFAICHPSQKR-
SYDM_DICDI        NALSQASN-----NFKESKPVIKCIKLDQVLPTLKSKHLDQITTESNSIITVQIKSNNE-
SYD_THETH         EAESVKA---------LALPKA----LSRKEVAELEEVAK---RHKAQGLAWARVEEGG-
SYD_DEIRA         SAPSVKV---------LVAPE-----LTRKQIDELERVAK---QNGAGGLAWLRRDGEG-
SYDND_ACIC5       IEPGMPI---------VAIVIPNKSAMSNTQKKAFGKEVE---EQVGAELAYLDVERLR-
SYDND_SALRD       SIVDDGG------HIVALRVPGEG-DRGRAAMDRLEDHVTDE--IGAAGLIYFQLPSDGS
SYDND_ANAD2       EAVKAKG------IVKAMRVPASA-NFSRTEIDKLEEYVKG---MGAKGLARAKVG-EGG
SYDND_RHOBA       GTADAGN------FVRGINVKDSALKFSRRQIDELTAFVQQD--FGAKGLAWFRVEDDGT
SYD_AZOPC         ESE----------YVGAICAEGCA-FYTRKQLDELTDFVKHP-QIGAAGLIYVRYSFDGS
SYD_AMOA5         QAK----------LIAGICVKGCA-DYTRKQLDDLTEYIKKL-NLVTSGLVYVKYLADGS
SYD_FUSNN         STVQNGG------LVKAVVAPNANEKFSRKVI-SEYEEYVKT-YFGAKGLAYIKLTADGI
SYDN1_SYNAS       QILQRGG------SIKGINIKGQSEKLSKNVLQNEYAKEIAP-SFGAKGMTWMRAEEGKL
SYDND_PSEAE       ---GPAND---PKGRVAALRVPGAASMPRSQIDDYTKFVG---IYGAKGLAYIKVNERAK
SYDND_LEGPH       ---SAAND---NSGRVVALKLPNGCDLSRKDLDNYGQFVT---IYGAKGLAYIKVNDLSA
SYD_XYLF2         ---NAVAH---PNGRVAALRIPRGAVLSRKQIDEYAAYTA---KYGATGLAYAKLAPTGE
SYD_BUCAI         -NLNPQ-----KNNRIALLCISKGAHLSRKKIDDYTKYVQ---RFDAKKLFYMKIKECK-
SYD_BUCBP         -TLPNKKT---QQNIVIAMCIPRGMSLNINYINSYHHLVQ---KYTKNKLFNVEVLNHC-
SYD_BLOFL         CNAGCVDT---IDTQVIVMNVPSGFKLTRNEIDKYSDYAK---KSGIQQFLWMKIQMNDC
SYD_BAUCH         --ADIAKD---IKNRVVALRVPNGAKLSLNDIKKYEKYIQ---TYGIKFIIWMKVYQGK-
SYDND_WOLSU       -KIAQDSK---KNRFKALKVKGGDLFFTRKTLGVLEEFVK---KFGAAGLAYIQVKEEG-
SYDND_BIFLO       -----------QAPYVGAVVFKGGAATPRRQFDAWQDWAR---QRGAKGLAYVVFGENGE
SYD_LACAC         GAIADGG------FVKGIAVKNGAKEYSRKKIDKKADFIK---RFHAKGLAWVKFE----
SYD_STRMU         QAPA----------VKAIVAKNAANSYSRKAIDKLTDIVK---PFGAKGLAWVKYN----
SYD_LEUMM         NAIKGGG------VVKALAVPGGADHYSRKDIDKLTKYIE---RFGAKGLAWMKVA----
SYDND_STRMU       GLKKENG------VVMGICAKNAAKAFTNRQMATLKQLVM---DFGVAGFATATIE----
SYDND_BDEBA       DVLARGG------IVRGIAAPKGG-SYSRGQLDKLTDMAK---RAGAKGLVWIKSEA---
SYDND_ENDTX       SVISKGG------IVRGLCIPKGAS-FSRSEIAGLTKFVG---EYGAKGLVWMKIT----
SYDND_MAGMM       QAATLEGRGNEHGLVKVLKVPGGGS-LTRKQIDTYTEFVG---IYGAKGLAYIKVNGPWQ
SYDND_ELUMP       DALANGG------VVRAIKAKYGAKHINRSTCDKLTDLAK---ASGAKGLVWLKYS----
SYDND_PELUB       KLVKSGS------KVRCIVTKNTKDKPRS-FFDNIDKWAK---EQGASGLAYFTIEKEEN
SYDND_PROA2       SNTKEGS------CIKAMVLKGRGTESRQ-FYDKAEKRAR---ELGAPGLAYVQYREE--
SYDND_RUBXD       NAVEAGG------SVRGLAAGGLGDLSRR-ELDGLTEVAR---EGGARGLAHLRAEGK--
SYDND_HERA2       GALSSGG------KVQAIRLPGCGSYSRK-QIDDLQEVAK---IGGAKGMAWMAIEADGS
SYDND_DEHM1       NVAAQGG------AIKAISAPGCGGYNKS-QQEELINLAK---KYGAAGLVPISLGAESG
SYDND_OPITP       STVAGGG------VVKALNAKGLADLTQG-ELKSMEDTAK---SLGAKGLAFIKVEGG--
SYDND_METI4       DVIEKGG------VIKALNAKGRAPMVNSSALEELVGIAT---SMGAKGLAHIRVENQ--
SYDND_BRAHW       NALDNKF------IIRCLNAK-GGEKLSRKDIDDFTKYVG---IFGAKGLAWMRVTDK--
SYDND_PARUW       DQIRENG------LVKGFCIK-GGADFSRKTIDEYTEFVG---RLGVKGLAWIKRQEN--
SYDM_ARATH        EALESGG------IIKVLCVPLGAKKYSNSALKKG-DIYNEAMKSGAKGLPFLKVLDNG-
SYDND_PROM5       KAIQMGG------AIKSITIKNGNSSISNVRIKPGGDIFKVAQEAGAGGLAFIRVKGD--
SYD_LEPIC         GAVKNGG------TVKVVCVP-GGSIISRKEIEDYTAWLNRDYK--AKGLAYMKHGTE--
SYDND_DICT6       STLEKNG------VIKGIILKNIVP--SRREWSIIENKVR---ELKGKGIMWFTYTDGE-
SYD_PSELT         AELSSGG------VVKGFVVRDFANKMSRKLADELNEIAK---SLGGGGILWFSFDSPES
SYDND_TREPA       EVVAQGG------SIRALVLPGKARCYSRRQIEALESIAR---AHEAHHLFWLKATGGG-
SYDND_BORBP       ETLKNKG------SIKILIVKDEADKFSRAKINNLEEIAK---LYKTQGLYFAKIENNK-
SYD_UREPA         KALLNNQS--------IRAILVPNINLNKKQVQTLEKFAK---DKGAKGLSWISIKDEK-
SYD_MYCPE         SIYESKNR--------ISAVFVED-NIVKQDIKKLEKLAQ---DNKAKGLAYLYIENGK-
SYD_MYCPN         NLINAGGI--------VGGIQLPNLYLDEVSFKALRKLAK---DN-GVSLEFYSDKASS-
SYD_MYCCT         DSQ--NKY--------IRAVCIDQ-LLTKKQLEELNQQAK---QFHFNSIAFIKVENNA-
SYD_ONYPE         GNIKGFK-------------VSKTAVLTRRKLDEYQLFFSK--HFNLKLFSFVKKNDK--
SYDM_SCHPO        EILVYND----------LSHSLSNAESRKLCEAVGENVVVTSIREHSQLQTWVKKLPQ--
SYDM_YEAST        EVIILRSAFSN----MEEYKERWSFLTNNSNYNYRVPIVLPIENDEQANSNWFENFHA--
Q6CLY6_KLULA      EVIVLRKAFET----VEEFHRDWSYLSNKDNYNYRAPIVVPIESDE-LGTSWFTKFLP--
A3LXG1_PICST      EACILKKAFEP----SKGKYKLPRSLIDPLSYTRRKPIVIPIQDEN-DATNWYKKFIE--
G2Q0I6_MYCTT      PIVEGFRFRPS----SGEGSEVSMSGFVDELMRTLP-PALAQNPDGAPVALVVDSSKP--
G2X9J7_VERDV      PIVDAWVFRPH----EDAD-RKEVHEFMQIFLQNLH-KSHSLNPDGAPQALMYDTSKP--
E9E2B2_METAQ      PLIEAFTFPLK----DCSP--SDARKFVIKFMDNLP-PALANNPDGKPQILIHDSRQP--
E4ZST8_LEPMJ      PIVEAVKIPV------SSD-PKTTRKFVSSFLDSPDGKNFLENPNGQPGIFIGDLSQP--
N1QNH6_SPHMS      PIVEVMKIPI------SDD-TQQTRKFVNTFMDSPEAQPFIQNPEGQPGIFIVDSRKP--
C5FSN6_ARTOC      PSIDAFKVKG------NGC-PKETMRVLNSFMNTSEGKYFLDNPDGAPGVFAIDSSKP--
H6BKD8_EXODN      PIVEMIKIDM------HGCSPSESGQFIRSFLDAPSSSGYANNPDGIPGVSVYDPSKP--
                                                                              

SYDM_MOUSE        ---------WSSPFAKFIMEEERLELARSMEIQ-------EEDIVLLTAGEHEKACSLLG
P90831_CAEEL      ---------WFKPFDN-------QKLIDQFGLI-------DEDVLIVCWGNSE-------
SYDM_DICDI        ---------WKSLISKSISEQEKTLITERMNLK-------EGDVLLISVGPRFQVESTLG
SYD_THETH         ----------FSGGVAKFLEPVREALLQATEAR-------PGDTLLFVAGPRK-------
SYD_DEIRA         ----------FTGGISKFVGGIAPQLIEQTGVA-------QGGTLLFAAGEWK-------
SYDND_ACIC5       ----------TSPQFALLADRIDAAAAAHCKLER-----VEPDHRLVVISPRL-------
SYDND_SALRD       GIE-------QNLSSDALPHEYGRAAAEQVGAE-------AGDLVLTLAGHS--------
SYDND_ANAD2       EWT-------QSPLAKTITPALRQAINEACEAK-------PGDLLLFQFGKE--------
SYDND_RHOBA       LW---------SPIAKNFDEEHLAEIKALMGGE-------PGDLLMFLADTW--------
SYD_AZOPC         LK---------SSVDKFYSTVDLQKWIDRVGAK-------QGDLVLILYGEK--------
SYD_AMOA5         FN---------SPVSKFYDVEQLTLWAKQMHAV-------PGDLLLILAGEI--------
SYD_FUSNN         AS----------PIAKFLSEEEMKAIIEKTEAK-------TGDVIFIVADKK--------
SYDN1_SYNAS       ES----------NIVQFFSADELEALKRVFQVE-------DGDVLIMVADPSC-------
SYDND_PSEAE       ----GVEG-LQSPIVKFIPEANLNVILDRVGAV-------DGDIVFFGADKAK-------
SYDND_LEGPH       ----GMAG-LQSPILKFLSETAVHSILNRVEAQ-------TGDVIFFGADKAH-------
SYD_XYLF2         ---------ITSPIAKFFSEDAFAALLSHIGAE-------KGDIVFFGAGNYN-------
SYD_BUCAI         ----LGCLGIHSSIKNILDEIILKEIIEKSQSK-------NGDILFLIADQEH-------
SYD_BUCBP         ----PIKEQKKTSFHKKPSSDLTFQLISKTSAK-------HGDMIFYLSEKSP-------
SYD_BLOFL         ----KEITAIDGPIINLLNKNFLQLLMAQVKIE-------NNDILFFGFNNDKN------
SYD_BAUCH         ----DGVKTTQSSITKYLLPEDIMSIIERTGAC-------DGDILFFAAGNNN-------
SYDND_WOLSU       ---------LKGPLVKFMSERSLSLLLERLNPE-------VGDIIFFGAGEKK-------
SYDND_BIFLO       ---------LKGPVAKNLSDEERNGLREAVGAE-------EGDAVFFAAGSRE-------
SYD_LACAC         ------DGEFSGPVARFLTDENKEALKKEFDLE-------GGELVVFVADKWK-------
SYD_STRMU         ------DGKIGGPIAKFLTT-IEDELIERLQLE-------ANDLVFFVADDLE-------
SYD_LEUMM         ------PEGLTGPIAKFFDDEAQAALIASADAQ-------VGDLLLFGAGRAD-------
SYDND_STRMU       ------KGQVTGSLKSTFKD-HNTELLELFEAE-------DGDMIFFVTGSLK-------
SYDND_BDEBA       ------DGTLSSSVSKFFSPEKLAEMFKACGGE-------AGDCALVVADDYD-------
SYDND_ENDTX       ------DTGADSNIVKYFKEYEIRVFISKLNAK-------SGDLIVFLADEEK-------
SYDND_MAGMM       ------EDGWQSPIVKFLGDAEKQAIQEATQAQ-------VGDLLFFGADKAS-------
SYDND_ELUMP       ------DDKFEGPSAKFFTEEELASLQHTLSVE-------KDDMVFIGADKEK-------
SYDND_PELUB       I-------SARGPVGKFFSKEALEEIMKITGAE-------IGDSIFFACGKIN-------
SYDND_PROA2       --------GPKGPIVKFLSEAELSALQERLAIE-------TGDVVFFGAGKWE-------
SYDND_RUBXD       --------ALKGPVAKFFSAEEQAALREALGAR-------PGDWMFFVADRDP-------
SYDND_HERA2       ---------VRSPIAKFFEQAQLDQLKSATAAE-------AGDLIVYVADKPA-------
SYDND_DEHM1       ELKDLTMEMVKSVSAKYLTLEEIKTIAERSGAK-------PGGLILIVAGARK-------
SYDND_OPITP       --------EWKSPIVKFFTEPEKAELTKRLNIE-------EGDIIFFAAAPWE-------
SYDND_METI4       --------EWKSPIVKFFSSEERKELERLLRME-------PSDLVLFSAGPRE-------
SYDND_BRAHW       --------GLESNIVKFFSEENQKKILEVTKAE-------KGDLLFFVADTPK-------
SYDND_PARUW       --------GLNSSIVKFFPESIHQQLIEEMEME-------VGDIIFMIANTPS-------
SYDM_ARATH        ------EIEGIAALVSSLDSAGKINFVKQCGAA-------PGDLILFGVGPVT-------
SYDND_PROM5       ------ELETIGAIKNNLNKDHISNILKITEAE-------DGDLILLGAGSTK-------
SYD_LEPIC         --------GLESTITKRFKKEELEAISKACGSK-------EGDMLFFGADERE-------
SYDND_DICT6       ---------LKSSISKYLDENTKNKLIENLNLR-------EGDSFFCIAGEWK-------
SYD_PSELT         ---------IKGAGAKYLQKNY-NSVAKELSIN-------YNDVCVLSAGKID-------
SYDND_TREPA       ---------LEGGIARFFAGVE-SEVRRRLSAQ-------DEDLLLFVADCRH-------
SYDND_BORBP       ---------FSGGIAKFLKTEE-QQLIKTYSLE-------NNDIIFFTANKKW-------
SYD_UREPA         ---------IIDGSLLSIQEDHIIYKTIFKDFNL-----ST-GSILLVADTFD-------
SYD_MYCPE         ---------MSSGSIANVIESEIIEK-ICKDNKL-----SN-GTLFFVADKYE-------
SYD_MYCPN         ---------LKQP----------------LDLPL-----AG-TILLVAHKSKT-------
SYD_MYCCT         ---------WSGSLASQLTEVQ--KKQLIEEFNI-----QNKATIILNIGKYE-------
SYD_ONYPE         ---------IIGGISQFIKDDS------FLKNE---------EICFVVSGTKD-------
SYDM_SCHPO        ----------LRQLPIVAEELNQKLQIGINSIVF-----MTNRPKYLVSGTTP-------
SYDM_YEAST        -----------IATFENP-----HLITKFLKLK-------KGDIVCGCTREPNHSI----
Q6CLY6_KLULA      -----------IAAFENP-----KLITKFLNLR-------KGDIIIGSTREPSRRL----
A3LXG1_PICST      -----------KKVFSEAATFSEHKLQASLDLE-------AGDILAFSTR--AELP----
G2Q0I6_MYCTT      -----------LRGLSPLGFEGAGALESGEAP--GFGDLEDGDVVVFQARQDKS------
G2X9J7_VERDV      -----------LEGFSALGPDGLKTLQDAASPESGLSTLENGDVVVFQARQDRP------
E9E2B2_METAQ      -----------LCGFSSLGFEYESVLDKLSQG----QGINDGDLVVFQAREKPPGQ----
E4ZST8_LEPMJ      -----------MQGLGPLGYQYVMEGPEALAV-------ENGELLVLQARPNAP------
N1QNH6_SPHMS      -----------LQGLQPFGFEAAEQLEETLSL-------EDGDLVVIQARKDAP------
C5FSN6_ARTOC      -----------MSGLSPAGFEAAWELERLFEL-------EHGDLLFFQPRKDEP------
H6BKD8_EXODN      -----------LCGLSSFGYEGASKLEEDFEP-------EPGDIFIVQSRVKAP------
                                                                              

SYDM_MOUSE        ------------------KLRLECADLLEMRGAVLR---DPAVFSFLWVVDFPLFLAKEE
P90831_CAEEL      ------------------------GVYWTLEVCGLR---SKSNVTAHWIVDFPLFSFEEG
SYDM_DICDI        ------------------KTRIYCANLLKELNLLKL---DPQQFNFLWVVDFPLFTPSDY
SYD_THETH         -VAATA----------LGAVRLRAADLLGLKREG---------FRFLWVVDFPLLEWDE-
SYD_DEIRA         -KAVTA----------LGAVRLALRDLFDLAAGGPQ-------FHVSWVVDFPQLEFDE-
SYDND_ACIC5       -GAAAVSRDTSWVYKRAGQLRLELGKRFAAEHKAFEKKGTAADYQFLWVTDFPFFEWDE-
SYDND_SALRD       PTVFEQ----------AGALRLHMGEELGLRPPA-D---EGDD-AFLWVTDFPLMEYDE-
SYDND_ANAD2       SVVHTV----------MANLRVHLAKRMGLIPEY-G---SGGAWRFLWVVNPPLFEYDE-
SYDND_RHOBA       EVTCKG----------LSGLRKRLAVELKLYED--------GELNCSWVTEFPMFEKDE-
SYD_AZOPC         RETQKQ----------LSRLRLEMGSRLGLRDK--------KQFGCLWVIDFPLFEYDN-
SYD_AMOA5         EATQIA----------LGSLRLKLRDELHLVSK--------DKFAPLWVVDFPLLEWNE-
SYD_FUSNN         KVVHSA----------LGALRLRIGKDLELINK--------DDFKFLWVVDFPMFDYDE-
SYDN1_SYNAS       AIVNSA----------LGQLRLHLGNRLGLIPE--------GVFYPVWITEFPLFEPTD-
SYDND_PSEAE       -IVCDA----------LGALRIKVGHDLKLLT--------RE-WAPMWVVDFPMFEEN--
SYDND_LEGPH       -VVNES----------MGALRNKLGHDRNLIN--------SG-WQLLWVVDWPMFELDP-
SYD_XYLF2         -KVSDF----------MGALRLKAGKDFALIT--------AD-WRPLWVTDFPMFEWDE-
SYD_BUCAI         -IVNKS----------LGMLRLKIGIDLNITK--------KNRWEPLWIVNFPMFDKD--
SYD_BUCBP         -LVYEI----------MGKLRIELGKDLNLID--------YNSWKPLWITNFPLFKKN--
SYD_BLOFL         LSTTRM----------LSALRSKLGYDLNLVK--------QDSWKPLWIVDFPMFKKN--
SYD_BAUCH         -IINNV----------MGALRIKLGCDLKLNR--------ENSWAPLWIVDFPMFEKD--
SYDND_WOLSU       -SVWDY----------MGRLRLEVAKQMGLID--------PNQLCFLWVVNFPMFEKDE-
SYDND_BIFLO       -SAQLL----------LGAVRVELASREGLLD--------PKKFAFTWVVDFPLFKPTDD
SYD_LACAC         -VVCDS----------LDHLRREFAKETGIIP-------KGV-YDFVWVVDWPLFEYDE-
SYD_STRMU         -IANGS----------LGALRNHLAKELNLID-------HSK-FNFLWVVDWPMFEWSE-
SYD_LEUMM         -VVSAT----------LDYLRRETAKALDLID-------QTNPWAFAWIVDWPLFEYSE-
SYDND_STRMU       -RVQEA----------LGGLRVRLAKDLELID-------NDK-LNFLWVVDWPLLEWNE-
SYDND_BDEBA       -TACAA----------LSTLRLHLGRELNLID-------NSK-YKFLWVVDFPLLEYSP-
SYDND_ENDTX       -TVAQG----------LGALRLKVGRESGLID-------KNK-FNFLWVVDFPLMEWDK-
SYDND_MAGMM       -VVNES----------LGRLRVKLGKELEMLC-------DEK-FAFVWVTDFPLLDWDN-
SYDND_ELUMP       -VVSPV----------MGAIRKELIKLLCLKP-------NKK-WAFLWVKHFPLLEFVP-
SYDND_PELUB       -DVEKI----------TSLARDKIAKDLKLID--------ENTFAFCWVVDYPMFEKNE-
SYDND_PROA2       -KTCKI----------MGGIREYFS-DLFELD--------RDELSFCWIVDFPLYEFDE-
SYDND_RUBXD       -VVFES----------LNRLRLHLRDRLGLAD--------RDALAFCWITDFPLFEYNE-
SYDND_HERA2       -VVAAS----------LDKVRREMAKRLDLAD--------KDLMHFAWVIDFPMFEYNA-
SYDND_DEHM1       -MVNSV----------LGEMRNHLAAKLDLCD--------KNELSFAFVVDFPLFQWDE-
SYDND_OPITP       -KACAI----------LGRLRLESAAFLQKRGKLTI---RHDDWQFLWVIDFPLMTYDE-
SYDND_METI4       -QACLI----------LGKIRLHLAEMTQG-----I---PGNQWKFAWITDFPLFEYSP-
SYDND_BRAHW       -VTFDA----------LGNLRLRVAEKLNLID--------KDKLNFLWVVEFPLFEYDH-
SYDND_PARUW       -KTNQA----------LDHLRRKIARDRNLVD--------PHHYEFLWVTDFPLFSWNE-
SYDM_ARATH        -SVNKT----------LDRLRLFVAHDMDLID--------HSKHSILWVTDFPMFEWNE-
SYDND_PROM5       -IVNQS----------LDRVRQYIAKDLNLLENQ-K---AQSQWNFLWITDFPMFEMNE-
SYD_LEPIC         -IVNHS----------LGALRLKLSERFETPK--------ENEINITWIVDFPMFEWNK-
SYDND_DICT6       -EVVKI----------LGTLRLEIAELFNIEK--------KEGLYFLWVTDFPLFEYDE-
SYD_PSELT         -IVNTV----------LGEVRKILGERYFSDL--------RKGFDIFWVTDFPMFEYSE-
SYDND_TREPA       RVCCVA----------LGAVRSALIRDESFPE--------KELFSFVWIVDFPLFEWNP-
SYDND_BORBP       ETACKA----------MGQIRIKIANDLGLID--------ENKFEFLWVYDFPLFEYDE-
SYD_UREPA         -IASQA----------LGLVRINLASILNLKKPN--------IFKFVWIIDWPLYEYDN-
SYD_MYCPE         -ITQQA----------LGAIRKEFVNISKKIKMNE-------EFAFLWVVDWPLFEYSE-
SYD_MYCPN         -QAWTA----------LGAIRNELKYHLNLVKPN--------QYSFCWIVDFPLYEFDE-
SYD_MYCCT         -EISQL----------MGAIRISLAKMFNLETKD--------DFKLLWVVDFPLFEFSE-
SYD_ONYPE         -IMHKA----------LGIFRTKLALDLSLVD--------TTQEALLWIVDFPLFETTQE
SYDM_SCHPO        ----------------LGKLRLLLHELLVKKKALPEL--DKDLLKFVWVVDFPLFSPTEE
SYDM_YEAST        FENPTPLGRLRQLVLQS---EHGKNIYHAVNKD-----------VASWIVDFPLFSPVII
Q6CLY6_KLULA      FENPTPLGRARQLITQS---KRGKELFRKTDAS-----------VAAWVVDFPLFAPVEE
A3LXG1_PICST      YENPTPLGKFRQLAINEFPEKWNREIYDKSSGTISEVKDTSAIFVGSWVVEFPLFSPVEI
G2Q0I6_MYCTT      FQGGSTALGTFRNLVYQAAVSKGLLPKD-------------RSFKFLWVTNFPMFTPDNE
G2X9J7_VERDV      HQGGSTKLGEVRIALYHAAIEAQLLERD-------------DSFQFLWVTDFPMFTPNEE
E9E2B2_METAQ      YCLGSTKIGDIRKALWTGLVEEGYMEKPKLGDP--------ESLQFVWVTEFPMFKPVEE
E4ZST8_LEPMJ      LSGGSTALGNLRLALYKAAISQDLIEAPAADD-----------FRFLWITDFPLFTPSND
N1QNH6_SPHMS      FTGGATPMGNLRLALHKAAVRHNYIAAPPSG------------FAFTWITDFPLFSPTAE
C5FSN6_ARTOC      FSGGSTRAGELRLAMHRFMVEKEF-HSPPVG------------FNFHWITGFPLFSPSVD
H6BKD8_EXODN      FTGGSTVLGNLRRDIHQSAVSQGLIPAPVGF-------------SALWVIDFPLFSPTDQ
                                                                 ::   *       

SYDM_MOUSE        S---------------PTELESAHHPFTAPNSSDIHLLYTEPE--------KVRGQHYDL
P90831_CAEEL      ------------------QLVSTHHPFTAPLEKDIDILYSNDID----KLLQITGQHYDL
SYDM_DICDI        MN-------------EQSALLSTHHPFTAPHPEDIDLLLNPLSTPS--DYSKIRGQHYDI
SYD_THETH         ---------------EEEAWTYMHHPFTSPHPEDLPLLEKD--------PGRVRALAYDL
SYD_DEIRA         ---------------DSQSWTYMHHPFTAPHPGDVALFGTER-------QGEMRAQAYDL
SYDND_ACIC5       ---------------QSHTWTFAHHPFTSPHQDDLIAGRLESD------QAAVRALAYDV
SYDND_SALRD       ---------------EAGRPVSMHHPFTAPHPDDLD-RLDED-------PTQVQARAYDL
SYDND_ANAD2       ---------------ESGQWAAAHHAFTRPHDSDLQ-FLESD-------PGKVNCYRYDL
SYDND_RHOBA       ---------------EAGRYVAMHHPFTAPLEEDLP-LLKES-------PEKCRAQAYDL
SYD_AZOPC         ---------------VLNRFFAKHHPFTSPKQEDVC-LLETN-------PEFVRANAFDM
SYD_AMOA5         ---------------ESQRYVSRHHPFTSPKQEDIE-LLSTK-------PETVRANAYDL
SYD_FUSNN         ---------------EEQRYKAEHHPFTSIKAEDLDKFLAGQ-------TEDIRTNTYDL
SYDN1_SYNAS       ---------------E-GGVTSSHHPFTAPDRTDFDPGNIEE-------LLSLRSRAYDL
SYDND_PSEAE       ---------------DDGSLSALHHPFTSPK--CTPAELEA-------NPGAALSRAYDM
SYDND_LEGPH       ---------------QSNKLQPMHHPFTSPQE-LSAEALRS-------KPTQTLAKAYDI
SYD_XYLF2         ---------------EAQRYVALHHPFTAPAAINDIDELRT-------HARTALSRGYDM
SYD_BUCAI         ---------------IQGNLSSVHHPFTAVKN-MDREILKN-------SPDLAISDSYDL
SYD_BUCBP         ---------------ELNQYISTHHPFTAPKY-MKIDTSIT-------NYEEIVADSYDL
SYD_BLOFL         ---------------TSGKLVSMHHMFTAPKD-NDLICLKR-------NPELAVSEAYDI
SYD_BAUCH         ---------------DEGNLHAVHHPFTAPKN-IDIPTLLQ-------YPLKAKANAYDM
SYDND_WOLSU       -----------------GKVKALHHPFTMPK-----NLDCE-------DVEEISSIAYDV
SYDND_BIFLO       PDDDD-------VAVGHSKWTSMHHPFTMPSK-DWIDKFDK-------DPEHAMSDSYDI
SYD_LACAC         ---------------GLGRWVAAHHPFTMPDDEGVKLLTT--------DPHKAHARSYDI
SYD_STRMU         ---------------EENRYTSAHHPFTLPQEDTVAELEG--------DLSKVRAVAYDI
SYD_LEUMM         ---------------DFDRWIAAHHPFTMPNEEDLHYLNDGE------DPHKAHAQSYDL
SYDND_STRMU       ---------------DLNRYQAMHHPFTQGAFEDGSDWKE--------NPEKMMSRAYDI
SYDND_BDEBA       ---------------DEKRWVARHHPFTSPKDEFAQDLVNNNEA----AYGKMLAKAYDL
SYDND_ENDTX       ---------------EEQRWQALHHPFTLPKDADSLTKENAGRA---------KAKAYDV
SYDND_MAGMM       ---------------EARRNTAVHHPFTAPHPDDIIYLENADGASVEHPLEKVRSLAYDL
SYDND_ELUMP       ---------------EENRWDAAHNPFTAPLEKDIPLLDTDPGK--------VKSYQFDL
SYDND_PELUB       ---------------VTNKIEFSHNPFSMP-QGDLKDIDFD-------NPLNIKAYQYDI
SYDND_PROA2       ---------------KESRIDFSHNPFSMP-QGEMDALDTM-------NPLDILAYQYDI
SYDND_RUBXD       ---------------EEGRIEPMHHMFTMP-REEDIPLLDT-------DPLAVTGQLYDL
SYDND_HERA2       ---------------ESGEWDAAHHPFCMVNPADVEKMQRG-------EFEGVRAASYDL
SYDND_DEHM1       ---------------EGKRWDSVHHPFTAPLESDLPLMDT--------DPARVGSRAYDV
SYDND_OPITP       ---------------AENRYVATHHPFTAPVPDDTQYLD-S-------DPKKVRGQHYDV
SYDND_METI4       ---------------LEQKWNSVHHPFTRPHPEDLTKLNEG-------KYDAIRALAYDI
SYDND_BRAHW       ---------------KEKRISATHHPFTAPVPEDVAILES--------EPLKVRSDTYDL
SYDND_PARUW       ---------------EEKRLQSEHHPFTSPHLEDLHLMET--------NPLKMRSSGYDI
SYDM_ARATH        ---------------PEQRLEALHHPFTAPKPE---DMDD---------LPSARALAYDM
SYDND_PROM5       ---------------EEKRFEALHHPFCSPKNV---KFEDKKELT--KKIETSTAYAYDL
SYD_LEPIC         ---------------DHKRWDALHHPFTSPSDESIPFFESMETLQ--KNAGNATAKAYDL
SYDND_DICT6       ---------------EERRIVAEHHPFTSPKDEDIPLL-DTD-------PLKVKAKCYDL
SYD_PSELT         ---------------EENRFVAQHHPFTMPNLDDLKKYKNSD-------LSKIRAQSYDI
SYDND_TREPA       ---------------AENKWDPAHHMFSAPQEQYLETLEQD--------PGSVKGDLYDL
SYDND_BORBP       ---------------NTKTYTPAHHMFSLPKKRYIASLEKI--------PNKTIGEIYDL
SYD_UREPA         ---------------EAQRFVAAHHPFTMPTLETLNTFDVN--------KKDARGRSYDI
SYD_MYCPE         ---------------EEKRYVSAHHPFTMPTAETLDTFDKD--------PANAKAIAYDL
SYD_MYCPN         ---------------KEQKWVSAHNMFSNPQPQWLVNFENH--------KAEALSEQYDL
SYD_MYCCT         ---------------QENRYVAAHHPFTSPKEESLADFDTN--------KKDALACAYDL
SYD_ONYPE         DLPQPDLTL--ENSNTSNRLYSLHHPFTAPCDIAILKSNPQ----------KALAKTYDL
SYDM_SCHPO        ---------------KNQSITSTHHPFTAPHWDDVHLLEKK--------PLSVRGLHYDI
SYDM_YEAST        EDKSGKKEKLAYPEYEKDRLCSTHHPFTMVKL-KDYEKLEKT-------PEKCLGRHYDL
Q6CLY6_KLULA      TAEKGS----HYPVYTENAFSSTHHPFTMVNL-RDYNKLESD-------PLSCHGEHYDL
A3LXG1_PICST      SSSSNN----DFPEYDFTSFESTHHPFTMAKH-EDYDLLETA-------PLKVRGEHYDL
G2Q0I6_MYCTT      TDPGQG---------GQAGFSATHHPFTAPLTDEDVELLATD-------PLKARADHYDL
G2X9J7_VERDV      VDVGQG---------GSSGFSATHHPFTAPLTAEDLELLFTD-------PLKAKADHYDL
E9E2B2_METAQ      GEPGQG---------GAAGISAAHHPFTAPLSEKDLEILFTD-------PLQARSAAYDL
E4ZST8_LEPMJ      SDPGQG---------GTAGFSSTHHPFTAPKTPADVELLLTA-------PEKAKAAHYDI
N1QNH6_SPHMS      NEPGQG---------GAAGIAATHHPFTAPKTPEDVDLLVTD-------PLQVTADHYDL
C5FSN6_ARTOC      SEPGQG---------GTAGIASTHHPFTAPRTAEDAALLLTD-------PIKAIADHYDL
H6BKD8_EXODN      SEPGQG---------GMAGICSTHHPFTAPKPGQDLSKLFSD-------PLAIIGDHYDL
                                         *: *                              :*:

SYDM_MOUSE        VLNGNEIGGGSVRIHDAQLQRYILETLLKED----VKLLSHLLQALDYGAPPHGGIALGL
P90831_CAEEL      VINGVEMGGGSIRIENSEIQRHVLK-VLGEP----TDEMEHLLNALSHGAPPHGGFALGL
SYDM_DICDI        VINGVELGGGSIRIHNSDVQLRVLEKVLKLEPH-MVQRFNHLLTALSMGCPPHGGIALGF
SYD_THETH         VLNGVEVGGGSIRIHDPRLQARVF-RLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGL
SYD_DEIRA         VMNGFEIGGGSVRIHDPEVQAKMF-QAIGFSEEAAREKFGFFLDALEYGTPPHGGIAWGF
SYDND_ACIC5       VLNGTELGSGSIRIHRQDVQQQIF-RALGMSDDEAKERFGFFLEALQYGTPPHGGIALGL
SYDND_SALRD       VLNGNEIGGGSIRIHNHETQMQVF-DVLGIDEEEAQDRFGFLLDALRYGAPPHGGIALGL
SYDND_ANAD2       VLNGFEIGGGSIRLHDPEVQARVF-KAMGITDEEARSKFGFLLDALKMGAPPHGGIALGM
SYDND_RHOBA       VINGSEAGGGTIRIHDSKVQSQVF-ELLGMDEETARDRFGFLLDALRFGAPPHGGIALGV
SYD_AZOPC         VINGIEIGGGSIRIHNYELQKKIF-ALLGFSESYTQSQFGFFVDAFKYGAPPHGGIALGL
SYD_AMOA5         VINGMEIGGGSIRIHDRALQEQIF-NVLGFSEEEARQQFGFLTDAFEYGAPPHGGIAFGF
SYD_FUSNN         VLNGSEIGGGSIRIFNPQIQSMVF-DRLGLSQEEAKAKFGFFLDAFKYGAPPHGGLAFGI
SYDN1_SYNAS       VVNGEELGGGSIRINDREVQRRIF-AALGLTEEDVKNKFGFFLRAFDFAAPPHGGLALGM
SYDND_PSEAE       VLNGTELGGGSIRIHDKSMQQAVF-RVLGIDEAEQEEKFGFLLDALKYGAPPHGGLAFGL
SYDND_LEGPH       VINGYEIGGGSIRIHQPELQKTVF-DLIGIDEQEAHEKFGFLLDALQYGAPPHGGIALGI
SYD_XYLF2         VLNGNEIGGGSIRIHRPEMQRAVF-ELLGITEDEARAKFGFLLDALNYGAPPHGGIAFGI
SYD_BUCAI         IINGYEIGGGSVRIHDVNMQKQVF-DIIGIKKSMQNEKFGFLIEALKYGAPPHAGIALGL
SYD_BUCBP         VINGYEIGSGSVRIHDLELQKTVF-NILGINTVLQKNNFNFFLNALKYGTPPHAGIALGL
SYD_BLOFL         VINGCEVGSGSVRIHSYKLQQAMF-DILGITRENQQKKFGCLMNALKYGAPPHAGIALGL
SYD_BAUCH         VINGYEVGSGSVRIHCAELQQTIF-SILGMTRNEQSSKFGFFIDALKYGAPPHAGFAFGL
SYDND_WOLSU       VLNGVELGGGSIRIHQEAIQKRVF-DLLGIAPEEAQEKFDFLLEALKFGAPPHGGFAIGF
SYDND_BIFLO       VCNGEEMGGGSVRIHRDDIQARVL-DVLGITKEEADEKFGFLLEAFKYGAPPHAGLALGW
SYD_LACAC         VMNGDEMGGGSIRIHKRSIQEDMF-KALGFTKKRAYEQFGYLMDAFDMGFPPHAGLAIGL
SYD_STRMU         VLNGYELGGGSLRINQRETQERMF-KALGFTKESAQKQFGFLLEAMDYGFPPHGGLALGL
SYD_LEUMM         VLNGYELGSGSIRIHRMDIQEKML-KALGFTPEKAHEAFGFLLEGMEYGFPPMGGIALGL
SYDND_STRMU       VLNGYEIGGGSLRIHKRSAQEAMF-ELLGMKKEDYERDFGFFLEALEYGFPPHGGLALGL
SYDND_BDEBA       VCNGYEMGGGSIRIYRNEIQQAMF-RLLGMSEEETQHKFGFFLEALKYGTPPHGGIAWGM
SYDND_ENDTX       VLNGIELGGGSIRIHKSGIQKKIF-NILDISDESAEKKFGFLLKALTYGAPPHGGAALGF
SYDND_MAGMM       VLNGTEVGGGSIRIHDTMLQRRML-ELLEIGEEEAEGKFGFLLRALQYGAPPHGGLALGL
SYDND_ELUMP       VLNGVELASGSIRNHRRDLQEKIL-NLMKHSPEQAALRFGMLLNALEAGAPPHGGFGMGL
SYDND_PELUB       VCNGIELSSGAIRNHVPELMYKLF-SIAGYQKEQVDEKFSGMINALSYGAPPHGGIAPGI
SYDND_PROA2       VCNGIELSSGAIRNHRPDIMYRAF-EIAGYSKEEVDKRFGHMIEAFKMGAPPHGGIAPGL
SYDND_RUBXD       VANGVELASGSIRIHRPDLQQKVF-SIIGIDEEEAERRFGTLLRAFRYGAPPHGGIAPGI
SYDND_HERA2       VCNGYELASGSIRIHDRSIQQYIF-DRLPYSPEEIQKRFGHMLEAFEYGAPPHGGMAPGI
SYDND_DEHM1       VCNGYEIAGGSIRIHQADLQRKVF-HLLGYNNEQIDERFGHLLEAFEFGAPPHGGVAPGI
SYDND_OPITP       VLNGMELGGGSIRIHQPVLQKKVFEDVLKIPQDVVESRFGYMLKAFTYGAPPHGGIAFGL
SYDND_METI4       VLNGVELGGGSLRIYEKELQEKVF-SILGIGKERQELLFGHLLKAFQYGAPPHGGIALGL
SYDND_BRAHW       VLNGNEIGGGGQRIYDSKVQAIIF-KLLGIDEEKAKLRFGFLLDALKYGAPPMCGMAYGI
SYDND_PARUW       VLNGYEIGGGSQRIHNSDLQQKIF-ERLKFSPEELETKFGFFLEALNYGTPPHLGIALGL
SYDM_ARATH        VYNGVEIGGGSLRIYKRDVQEKVL-EIIGISPEEAESKFGYLLEALDMGAPPHGGIAYGL
SYDND_PROM5       VLNGLELGGGSLRIHQAEMQKEVL-RTVGLTDHQIDEKFGFLIEALEMGAPPHGGIAFGL
SYD_LEPIC         VMNGVEIGGGSIRIHSKEIQNKVF-QVLGINEEEAKEKFGFLLEALEFGAPPHGGLAFGI
SYDND_DICT6       VLNGTELGSGSIRIHKKEIQEKVF-NILNITPEDAKKKFGFLLEAFEYGAPPHGGIALGI
SYD_PSELT         VINGFEVGSGSIRIHDAELQREIF-KLMRLTEEEVKLKFGFLLEAFQYGAPPHGGIALGL
SYDND_TREPA       VLNGYELASGSIRIHDTQLQKRIF-KIVGLDPEEAGEKFGFLTEAFKYGAPPHGGIAHGL
SYDND_BORBP       VLNGVELGSGSIRIHNKELQQRIF-NIIGFQKEKSEDRFGFFLKALEYGAPNHGGIAIGI
SYD_UREPA         VLNGYELGGGSVRIIDQQIQRRMF-KSINMSDEEANLKFGFLLTAFEYGVPPHCGIALGL
SYD_MYCPE         VLNGFEIGGGSLRIYNSELQTRMF-KFLGLNDSQVKEKFGFIINAFKYGVPPHGGIAFGI
SYD_MYCPN         VLNGFELGSGSIRIHDPEVQTRLM-QSLGVDPQ----QFGFVMEAYQYGAPVHAGMGLGL
SYD_MYCCT         VMNGFEIGGGSQRITNSEIQQRMF-DAVELNQKQVEANFGWFMNAYKYGAPYHAGIAWGL
SYD_ONYPE         VWNGYEVGGGSLRINNPQTQELIF-SLLGFSQEEVQTRFGFLVEALKYGTPPHGGLALGL
SYDM_SCHPO        VVNGIELGGGSIRIHNPDIQRFVLKDVLKLPENR-YATFEHLIRVLSSGCPPHGGIALGF
SYDM_YEAST        VVNGVELGGGSTRIHDPRLQDYIFEDILKIDNA--YELFGHLLNAFDMGTPPHAGFAIGF
Q6CLY6_KLULA      VVNGVELGGGSTRIHDPELQNYIFHEILNIKNP--EDLFGHLLNAFKMGTPPHAGFAIGF
A3LXG1_PICST      VINGVEVGGGSRRIHDAELQKFVFKNILNITNY--NDLFGHLLHALSMGCPPHAGLALGF
G2Q0I6_MYCTT      VVNGVELGGGSRRIHVARMQEYVMREILKMTDAG-VAQFSHLLEALRAGCPPHAGFALGF
G2X9J7_VERDV      VLNGVELGGGSRRIHVAAMQEFIFRDILQMTKPK-MAEFSHLLKALRAGCPPHAGFALGF
E9E2B2_METAQ      VLNGIEIGGGSERIHVADVQEFIMRDVLKMTDQR-IKDFSHLFDALRAGCPPHAGFALGF
E4ZST8_LEPMJ      VLNGVELGGGSRRIHNAAVQEFIFRDILKMKYER-IEDFRHLLDVLRSGCPPHAGIALGW
N1QNH6_SPHMS      VVNGVELGGGSRRIHNAAMQEYILREVLRMSDER-MQDFTHLIEVLRAGCPPHAGMALGF
C5FSN6_ARTOC      VVNGVELGGGSRRIHSAAVQELILRDILKVPPSR-LQSFSHLLECLRAGCPPHAGIALGF
H6BKD8_EXODN      VINGVEVGGGSRRIHLAEMQELVFREILRMKPER-VEDFRHLLNALKSGCPPHAGFALGF
                  : ** * ..*  *          :              :  .      . *   * . * 

SYDM_MOUSE        DRLVCLVTGA----PSIRDVIAFPKSYRGQDLMSNAPDSVSPEELKPYHIHVLWPADSEE
P90831_CAEEL      DRFVAMLTSDGNPLTPVRDVIAFPKTKNGKDLMSDAPATLSQKQLERYGISLLPNAVE--
SYDM_DICDI        DRLCSLLVNS----NSIRDVIAFPKTSGGKELMTSSPATVTKSELDELFLIQK-------
SYD_THETH         DRLLALMTGS----PSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP-----
SYD_DEIRA         DRLLMLMSGA----GSIREVIAFPKNNRGADLMAQAPSPVEDAQLAEVGVQVRGE-----
SYDND_ACIC5       DRIVMILAGA----SSLREVIAFPKTAKAIDLMVDAPTPVSDAQLRELHIRPTKQ-----
SYDND_SALRD       DRLVMLLAGA----DSLRDVIAFPKTQSGKEPMVKSPDWVDPEQLETLALRLDLPPDVEP
SYDND_ANAD2       DRLVMLLTGA----ESLRDVVAWPKTQKGTDLMTGAPGDVDARQLRELYVKSTYEPK---
SYDND_RHOBA       DRWVMLFAGL----ENIREVIAFPKTQKAADMMTGAPGEVDADQLNELHLRTVSAKT---
SYD_AZOPC         DRFVATFAGL----DSIRDCIAFPKNNSGRDTMVGAPSIISRERLSELNLIVEGWQ----
SYD_AMOA5         DRLCAIIGRE----DSIRPFIAFPKNNAGRDVMMKAPSTITEQQISELGIILSK------
SYD_FUSNN         DRWLMVMLKE----ESIRDVIPFPKTNKGQCLMTEAPNTVDEKQLEELFIKSTYEK----
SYDN1_SYNAS       DRVVSMILQT----PSIREVIAFPKNRSAACPLTGAPSEVKREQLAELGLLNLGDKDVLP
SYDND_PSEAE       DRLVMLMTGA----SSIREVIAFPKTQSAGDVMTQAPGSVDGKALRELHIRLREQPKAE-
SYDND_LEGPH       DRLAMLLTDS----TSIRDVIAFPKTQTASCPLTSAPSPAGNAQLTELGIRLAPTITTK-
SYD_XYLF2         DRIAALIAGT----ESIRDVIPFPKTTGAQCLMTDAPSPISEEQLSEIHVITKKLTP---
SYD_BUCAI         DRIVMLLTNS----KNIRDVIAFPKTTSATCLMTNSPSTVDNLLLQELAIKHLKK-----
SYD_BUCBP         DRITMLLTNS----HNLRDVIAFPKTTTGSCLTTGAPSKIIHF-----------------
SYD_BLOFL         DRLVMLLTKS----NNIRDVIAFPKTTGAMDLMIDAPD----------------------
SYD_BAUCH         DRLVMLLTST----ENIRDVIAFPKTTTAIDLMTEAPSIGNTIALKELSIEILDKNKI--
SYDND_WOLSU       DRLIMLLTQS----PSIRDVIAFPKTQKATCPLTSAPSPVSSEQLKELHIRIKEKTQTH-
SYDND_BIFLO       DRTVSILAGA----DSIRDVIAFPKAGGGRDPLTGAPAPISDEQRAETGVDYDPDADEN-
SYD_LACAC         DRFAMMLAGK----DNIRDVLAFPKNASASEPMMHAPAPVADQQLADLGIEVEKQYEDSV
SYD_STRMU         DRFVMLLAGK----ENIREVIAFPKNNKASDPMTQAPSLVSDKQLDELYLQVNK---NAV
SYD_LEUMM         DRLAMLLAGQ----ENIREVIAFPKNSRATEPMTEAPTRVEGKQLNELGLFVPEAE----
SYDND_STRMU       DRLVMILAEE----GNIREVIAFPKNGQGADAMLESPSLVADQQLAELRLALRD------
SYDND_BDEBA       DRLVMLLCET----DAIREVIAFPKTAKATDLMSDCPSEVNRDQLAEVGVRLSTLAEKHL
SYDND_ENDTX       DRLCALISGE----DSIREVIAFPKTQKAVDPLSNAPAAVSDNHLKELGLQQIEN-----
SYDND_MAGMM       DRLVTLMLGL----DSIRDVIAFPKTQKATCLMTEAPSKVDGAQLKELHLRSTFKPKTAE
SYDND_ELUMP       DRLAALLCKE----ESIREVIAFPKTATAYCPLTESPNVVEDIQLKELHIKIK-------
SYDND_PELUB       DRIVMLLANE----KNIREVTMFPMNQNAQDLMMNAPSNVNEEQLKELGLALKLKK----
SYDND_PROA2       DRLVMILRDE----HNIREVIAFPMNQQAQDLMMSAPSDVSRLQLRELHLKLDLPVETAE
SYDND_RUBXD       DRLVMLLRDE----PNIREVMAFPKTQAARDEMMDAPSPVSEEQLRELHISLCLPPEERR
SYDND_HERA2       DRLVMLLADT----DNIRDVIAFPKTQRAEDLMMNAPSSVDAKQLRELGLRLADGVEPRG
SYDND_DEHM1       DRFVMLLAGE----TSIREVIPFPKNQAAQDLLFGAPSVVDDKQIRDLHIRIQTEKE---
SYDND_OPITP       DRMVALLCGT----TSIRDVIAFPKTQKGQDLMAQSPTPVTPRQLKDLHIQTVMPE----
SYDND_METI4       DRFVMLLTGS----ESLREVIAFPKNRHGVDLLTQSPSEVDYQQLKELNIQLSFPSIKIE
SYDND_BRAHW       DRVVMLLQKQ----DSIREVIAFPKTQKGQCLMSGCPSTVDADQLEELHLSIEE------
SYDND_PARUW       DRIIMILTQT----ENIRDVIAFPKTQKASDLMIECPSPVANEQLKELEIRVPDSQFSWT
SYDM_ARATH        DRMVMMLGGA----SSIRDVIAFPKTTTAQCALTRTPSEVDPKQLQDLSIRTK-------
SYDND_PROM5       DRITMLILGV----DSIRETIAFPKNQQAKCLLTNAPSNVSKSQLKELDIEITIDE----
SYD_LEPIC         DRMLMLLTGG----KSIRDVIAFPKTQKGLCLMSECPSPVEEKQLQELKIKLAKV-----
SYDND_DICT6       DRIIAILTKS----NSLRDVIAFPKTQSGTCLLTGAPSEVDSKQLEEVHIRVVYPEEKRK
SYD_PSELT         DRLTAIICGV----PTIREVIAFPKTSSGICPLTGAPDVVNQKQLDELKIILGGDHCE--
SYDND_TREPA       DRLVMLMTGS----ESIRDVIAFPKNTLAASPLDNCPSVLDKRQLDELHLTVHV------
SYDND_BORBP       DRLIMLMTKS----TSIKDVILFPKNSFATSPLDDSPSKISNEQLKELGINIVTDDA---
SYD_UREPA         DRLMMILVNS----EYIRDVVAFPKNNNGVDMMLDAPSNMNDEDLKELGLKIKND-----
SYD_MYCPE         ERILMIMLNT----NSIRDVIAFPKNSSGVDLLFETPSDVSNESLKELGIKLEK------
SYD_MYCPN         DRLMMIINNV----DNIREVMAFPKNAQGIEMHTNAPDQVDIKDITTIWSKHPVK-----
SYD_MYCCT         DRISMILTDS----NSIRDVIAFPKNSLGIDMMSNAPDLVSDKQLDELNIKTVE------
SYD_ONYPE         DRLVMLFTKT----NNIKDVIAFPKTQSAKDLMLEAPSAVDQEQLNTLKLKFKCNCN---
SYDM_SCHPO        DRLAALLTNA----PGIREVIAFPKTSSGADLLIGSPSAIPEEMLKDYNVAITRQTQNRN
SYDM_YEAST        DRMCAMICET----ESIRDVIAFPKSITGADLVVKSPSVIPESILEPYNIKYSNSKK---
Q6CLY6_KLULA      DRMCAMLCGS----ESIRDVIAFPKSISGVDKVVGSPSTVPASTLDEYNIVSK-------
A3LXG1_PICST      DRLCAMLLGS----ASIRDVIAFPKNQSGFDPVVESPTSVSESTLNQYYITTKLNS----
G2Q0I6_MYCTT      DRLVAVLTYT----DSVRDVIAFPKSMKGEDLTVKSPGRVTKEQLETYHLTTFPGKN---
G2X9J7_VERDV      DRFAAVLSGS----SSVRDVIAFPKNNKGVDEFAGGPGKISDEQLTTYHLQLRKK-----
E9E2B2_METAQ      DRLVALLTDT----STVRDVIAFPKTMKGEDPFVRSPSKLNNEQLAPYGLQLMSKSK---
E4ZST8_LEPMJ      DRLMAVMTGT----ESVRDVIVFPKSGKGEDLLVKSPNCVTREQWDTYHLSVKE------
N1QNH6_SPHMS      DRLIAVMLGK----ESVRDAIAFPKSGKGEDVLVKSPARMTAEQLETYHLQLK-------
C5FSN6_ARTOC      DRLIAVMRGT----QSVRNVIAFPKGNRGEDPIVNTPSPMTEESLRTYHLQLRGSSQS--
H6BKD8_EXODN      DRLMAMLTDT----PSVRDVIAFPKHTDGQDRFVGSPSELTEEQLATYHLAIVDRDLDEP
                  :*    .         ::    :*    .       *                       

SYDM_MOUSE        ESASATPSKHLSS-----------------------------------------------
P90831_CAEEL      ------------------------------------------------------------
SYDM_DICDI        ------------------------------------------------------------
SYD_THETH         ------------------------------------------------------------
SYD_DEIRA         ------------------------------------------------------------
SYDND_ACIC5       ------------------------------------------------------------
SYDND_SALRD       PARIAQRKRLAS------------------------------------------------
SYDND_ANAD2       ------------------------------------------------------------
SYDND_RHOBA       ------------------------------------------------------------
SYD_AZOPC         ------------------------------------------------------------
SYD_AMOA5         ------------------------------------------------------------
SYD_FUSNN         ------------------------------------------------------------
SYDN1_SYNAS       GDAEKEDRIDHLSWVSRIGIAEGERPVMESILAQAEELAAQVGDLAGNEEPVRSVAPVAN
SYDND_PSEAE       ------------------------------------------------------------
SYDND_LEGPH       ------------------------------------------------------------
SYD_XYLF2         ------------------------------------------------------------
SYD_BUCAI         ------------------------------------------------------------
SYD_BUCBP         ------------------------------------------------------------
SYD_BLOFL         ------------------------------------------------------------
SYD_BAUCH         ------------------------------------------------------------
SYDND_WOLSU       ------------------------------------------------------------
SYDND_BIFLO       ------------------------------------------------------------
SYD_LACAC         KATEERLEKMAAEDAEENSTWDK-------------------------------------
SYD_STRMU         KNNEQE------------------------------------------------------
SYD_LEUMM         ------------------------------------------------------------
SYDND_STRMU       ------------------------------------------------------------
SYDND_BDEBA       EDLKKS------------------------------------------------------
SYDND_ENDTX       ------------------------------------------------------------
SYDND_MAGMM       ------------------------------------------------------------
SYDND_ELUMP       ------------------------------------------------------------
SYDND_PELUB       ------------------------------------------------------------
SYDND_PROA2       QEPG--------------------------------------------------------
SYDND_RUBXD       NP----------------------------------------------------------
SYDND_HERA2       ------------------------------------------------------------
SYDND_DEHM1       ------------------------------------------------------------
SYDND_OPITP       ------------------------------------------------------------
SYDND_METI4       P-----------------------------------------------------------
SYDND_BRAHW       ------------------------------------------------------------
SYDND_PARUW       ------------------------------------------------------------
SYDM_ARATH        ------------------------------------------------------------
SYDND_PROM5       ------------------------------------------------------------
SYD_LEPIC         ------------------------------------------------------------
SYDND_DICT6       EEE---------------------------------------------------------
SYD_PSELT         ------------------------------------------------------------
SYDND_TREPA       ------------------------------------------------------------
SYDND_BORBP       ------------------------------------------------------------
SYD_UREPA         ------------------------------------------------------------
SYD_MYCPE         ------------------------------------------------------------
SYD_MYCPN         ------------------------------------------------------------
SYD_MYCCT         ------------------------------------------------------------
SYD_ONYPE         ------------------------------------------------------------
SYDM_SCHPO        ------------------------------------------------------------
SYDM_YEAST        ------------------------------------------------------------
Q6CLY6_KLULA      ------------------------------------------------------------
A3LXG1_PICST      ------------------------------------------------------------
G2Q0I6_MYCTT      ------------------------------------------------------------
G2X9J7_VERDV      ------------------------------------------------------------
E9E2B2_METAQ      ------------------------------------------------------------
E4ZST8_LEPMJ      ------------------------------------------------------------
N1QNH6_SPHMS      ------------------------------------------------------------
C5FSN6_ARTOC      ------------------------------------------------------------
H6BKD8_EXODN      RPQISLKA----------------------------------------------------
                                                                              

SYDM_MOUSE        --------------------------------------
P90831_CAEEL      --------------------------------------
SYDM_DICDI        --------------------------------------
SYD_THETH         --------------------------------------
SYD_DEIRA         --------------------------------------
SYDND_ACIC5       --------------------------------------
SYDND_SALRD       --------------------------------------
SYDND_ANAD2       --------------------------------------
SYDND_RHOBA       --------------------------------------
SYD_AZOPC         --------------------------------------
SYD_AMOA5         --------------------------------------
SYD_FUSNN         --------------------------------------
SYDN1_SYNAS       RVREGLEAVRLSFSGTGRLLKNAPAVKGDYFKVAGILD
SYDND_PSEAE       --------------------------------------
SYDND_LEGPH       --------------------------------------
SYD_XYLF2         --------------------------------------
SYD_BUCAI         --------------------------------------
SYD_BUCBP         --------------------------------------
SYD_BLOFL         --------------------------------------
SYD_BAUCH         --------------------------------------
SYDND_WOLSU       --------------------------------------
SYDND_BIFLO       --------------------------------------
SYD_LACAC         --------------------------------------
SYD_STRMU         --------------------------------------
SYD_LEUMM         --------------------------------------
SYDND_STRMU       --------------------------------------
SYDND_BDEBA       --------------------------------------
SYDND_ENDTX       --------------------------------------
SYDND_MAGMM       --------------------------------------
SYDND_ELUMP       --------------------------------------
SYDND_PELUB       --------------------------------------
SYDND_PROA2       --------------------------------------
SYDND_RUBXD       --------------------------------------
SYDND_HERA2       --------------------------------------
SYDND_DEHM1       --------------------------------------
SYDND_OPITP       --------------------------------------
SYDND_METI4       --------------------------------------
SYDND_BRAHW       --------------------------------------
SYDND_PARUW       --------------------------------------
SYDM_ARATH        --------------------------------------
SYDND_PROM5       --------------------------------------
SYD_LEPIC         --------------------------------------
SYDND_DICT6       --------------------------------------
SYD_PSELT         --------------------------------------
SYDND_TREPA       --------------------------------------
SYDND_BORBP       --------------------------------------
SYD_UREPA         --------------------------------------
SYD_MYCPE         --------------------------------------
SYD_MYCPN         --------------------------------------
SYD_MYCCT         --------------------------------------
SYD_ONYPE         --------------------------------------
SYDM_SCHPO        --------------------------------------
SYDM_YEAST        --------------------------------------
Q6CLY6_KLULA      --------------------------------------
A3LXG1_PICST      --------------------------------------
G2Q0I6_MYCTT      --------------------------------------
G2X9J7_VERDV      --------------------------------------
E9E2B2_METAQ      --------------------------------------
E4ZST8_LEPMJ      --------------------------------------
N1QNH6_SPHMS      --------------------------------------
C5FSN6_ARTOC      --------------------------------------
H6BKD8_EXODN      --------------------------------------