CLUSTAL format seed alignment for MF_00046

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURC_MYCLE      ------------------MNAGQLPPELQRVHMVGIGGSGMSGIARILLDRGGLVSGSDA
MURC_MYCTU      ------------------MSTEQLPPDLRRVHMVGIGGAGMSGIARILLDRGGLVSGSDA
MURC_CORGL      --------------MTTPHLDSAQDIDLSRVHLIGIGGAGMSGVARILLARGKTVTGSDA
MURC_STRCO      -------------------MAPGLPTAMDRPHFIGIGGAGMSGIAKILAQRGAEVAGSDA
MURC_DEIRA      MPQLPMTDSAPLPTPAPSSPAQPSAQPSLHYHLLGIGGIGMSAFARLLATRGHRVSGCDQ
MURC_NOSS1      -------------------MNNSVDFGGRPFHFIGIGGIGMSALAYVLAKRQLPVSGSDL
MURC_SYNY3      ---------------MRSVAVGAVDFSGRPFHFLGIGGIGMSALAYVLAKRHLPVSGSDL
MURC_AGRFC      ---------------------MKMPKAIGLVHFIGIGGIGMSGIAEVLHNLGHRVQGSDQ
MURC_RHIME      ---------------------MKMPKTIGLVHFIGIGGIGMSGIAEVLHNLGHRVQGSDQ
MURC_BRUME      ---------------------MKMPLNIGLVHFIGIGGIGMSGIAEVLHNLGYKVQGSDQ
MURC_RHILO      ---------------------MKMPQTIGLVHFIGIGGIGMSGIAEVLHNLGYKVQGSDQ
MURC_CAUVC      ----------------MIQRRRPVPFELGPVHFIGIGGIGMSGIAEIMIRIGYTVQGSDA
MURC_RICCN      ---------------MLLLELKKTNQTLETIHFIGIGGVGMSGIAEILYNLGYKVQGSDL
MURC_RICPR      ---------------MLLLELKKTNQTLGTIHFIGIGGVGMSGIAEILHNLGYKVQGSDL
MURC_BUCAI      ----------MNIKDIKKINFFISEKKNKNIHLIGIGGAGMMGIALILLKLGYKVSGSDL
MURC_BUCAP      ----------MNINKIKKNNFFK-EKKILKIHLIGIAGSGMSGIALILFNLGYKISGSDL
MURC_ECOLI      ---------MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDL
MURC_ECOL6      ---------MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDL
MURC_SALTI      ---------MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDL
MURC_SALTY      ---------MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDL
MURC_YERPE      ---------MNTQQLAKLRTIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDL
MURC_VIBCH      ------MTIKHTQDLAQIRAMVPEMRRVKAIHFIGIGGAGMSGIAEVLLNEGYQISGSDL
MURC_HAEIN      ----------MKHSHEEIRKIIPEMRRVQQIHFIGIGGAGMSGIAEILLNEGYQISGSDI
MURC_PASMU      ----MMNSKCGKAFQQRVRDMIPEMRRVRQIHFVGIGGAGMGGIAEVLLNEGYFVTGSDI
MURC_PSEAE      -------------MVKEPNGVTRTMRRIRRIHFVGIGGAGMCGIAEVLLNLGYEVSGSDL
MURC_NEIMA      ----------------------MMKNRVTNIHFVGIGGVGMSGIAEVLHNLGFKVSGSDQ
MURC_NEIMB      ----------------------MMKNRVTNIHFVGIGGVGMSGIAEVLHNLGFKVSGSDQ
MURC_RALSO      -----------------------MKHIVKNIHFVGIGGAGMSGIAEVLLNLGYRVTGSDL
MURC_XANAC      -------------MIRRLQDSGDLVRAFPRVHFVGIGGTGMSGIAEVMLTLGYEVSGSDN
MURC_XANCP      -------------MIRRLQDSGDLVRAFPRVHFVGIGGTGMSGIAEVMLTLGYEVSGSDN
MURC_XYLFA      -------------MIRRLQDNGDLIRAFPRVHFVGIGGAGMTGIAEVMLTLGYEVSGSDN
MURC_AQUAE      ----------------------MLRERIKKFHFIGIGGIGMSGIAQILLEMGYKVSGSDI
MURC_HELPY      --------------MLETPKVLLKNLQDCKIHFIGIGGIGISGLAKYLKAQGATISGSDI
MURC_HELPJ      --------------MLETPKVLLKNLQDCKIHFIGIGGIGISGLAKYLKAQGAKISGSDI
MURC_CAMJE      --------------------------MMQNIHFIGIGGIGISALARFLREKGFKISGSDL
MURC_THEMA      ----------------------------MKIHFVGIGGIGMSAVALHEFSNGNDVYGSNI
MURC_FUSNN      -------------------MIFGGIKSMEKIYFIGINGIGMSGLAKIMKCKGYDVKGADI
MURC_CLOAB      ------------------MSFDLKNDISKKIHFIGIGGVSMSGLAEILLERGFKVSGSDM
MURC_CLOPE      ------------------MSFDLLKDINKKVHFIGIGGVSMSGLAAVLLNAGYKVSGSDS
MURC_CALS4      --------------------MEIDLEKFKRIHFIGIGGISMSGLAHILLEEGHTITGSDI
MURC_STRP1      --------------------------MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDV
MURC_STRP8      --------------------------MSKTYHFIGIKGSGMSALALMLHQMGHMVQGSDV
MURC_STRPN      --------------------------MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDV
MURC_LACLA      --------------------------MEKTYHFTGIKGSGMSALALMLHQMGKKVQGSDS
MURC_BACHD      ---------------------------MTTFHFIGIKGSGMSALAQVLHDMNYQVQGSDV
MURC_BACSU      ---------------------------MTVYHFVGIKGTGMSPLAQILHDNGYTVQGSDI
MURC_LISIN      ---------------------------MTIYHFVGIKGSGMSALAQILHDKGFQVQGSDV
MURC_LISMO      ---------------------------MTIYHFVGIKGSGMSALAQILHDKGFQVQGSDV
MURC_STAAM      ---------------------------MTHYHFVGIKGSGMSSLAQIMHDLGHEVQGSDI
MURC_STAAU      ---------------------------MTHYHFVGIKGSGMSSLAQIMHDLGHEVQGSDI
MURC_BORBU      --------------------MKVDFDDLNNIFFVGIKGSGACSLACFLNSKGYCVEGVDV
MURC_TREPA      ----------------MKRGTLPKDVSGIKIHMIGIKGTGMSALAELLCARGARVSGSDV
                                               .: ** * .   .*         : * : 

MURC_MYCLE      KESRVVHALRARGALIRIGHDASLLDLLP-------------------------------
MURC_MYCTU      KESRGVHALRARGALIRIGHDASSLDLLP-------------------------------
MURC_CORGL      KDSRTLLPLRAVGATIAVGHAAENLELSG-------------------------------
MURC_STRCO      KESATADALRALGATVHIGHAAEHL-----------------------------------
MURC_DEIRA      NLGAQTAGLEAQGIPVAAGHAAAHVTEEP-------------------------------
MURC_NOSS1      RPNHITRKLESIGTHIFSRQEASNLEFFGSKVSSTEIELNTQEMFP--------------
MURC_SYNY3      RRTHITDRLESVGAKIFQDQVPENLDYFQSLQVNPAVALPTGSPGSGLTLEQIAESASNG
MURC_AGRFC      ADSANVQRLRDKGIEVFVGHTADNL-----------------------------------
MURC_RHIME      ADSANVQRLREKGISISIGHKAENL-----------------------------------
MURC_BRUME      SDSANVQRLREKGIEVFVGHKAENL-----------------------------------
MURC_RHILO      ADSANVQRLRDKGIECFVGHKAENL-----------------------------------
MURC_CAUVC      KASANTERLEKLGARIFIGHDAAHV-----------------------------------
MURC_RICCN      VENYNTKRLESYGIKIFLGHAEQNI-----------------------------------
MURC_RICPR      VENYNTKRLESYGIKIFLGQAKQNI-----------------------------------
MURC_BUCAI      LESLMIKKLINLGATIYLQHSEKNI-----------------------------------
MURC_BUCAP      LENFMTKKLKNMGINIYFQHSEENI-----------------------------------
MURC_ECOLI      APNPVTQQLMNLGATIYFNHRPENV-----------------------------------
MURC_ECOL6      APNPVTQQLMNLGATIYFNHRPENV-----------------------------------
MURC_SALTI      APNPVTQQLTSLGATIFFNHRPENV-----------------------------------
MURC_SALTY      APNPVTQQLTSLGATIFFNHRPENV-----------------------------------
MURC_YERPE      APNSVTQHLTALGAQIYFHHRPENV-----------------------------------
MURC_VIBCH      AANAVTDRLADKGATIFIGHEAHNV-----------------------------------
MURC_HAEIN      ADGVVTQRLAQAGAKIYIGHAEEHI-----------------------------------
MURC_PASMU      MESAVTARLTSLGAKIAFSHAAENI-----------------------------------
MURC_PSEAE      KASAVTERLEKFGAQIFIGHQAENA-----------------------------------
MURC_NEIMA      ARNAATEHLGSLGIQVYPGHTAEHV-----------------------------------
MURC_NEIMB      ARNAATEHLGSLGIQVYPGHTAEHV-----------------------------------
MURC_RALSO      GQSAATQRLTALGATVMQGHAPEHV-----------------------------------
MURC_XANAC      ADNAATRRLAKLGARVMRGHSAANV-----------------------------------
MURC_XANCP      ADNAATRRLAKLGARVMRGHSAANV-----------------------------------
MURC_XYLFA      ADNAATRRLATLGARVMRGHSAANV-----------------------------------
MURC_AQUAE      SENKNTKLLKQKGAKIYIGHRPENL-----------------------------------
MURC_HELPY      AISPSVKYLKALGVEINIPHDPKAINNQ--------------------------------
MURC_HELPJ      AISPSVKYLKALGVEINIPHDPKAINHQ--------------------------------
MURC_CAMJE      KESKITKELEKEGVKVSIPHHKDNILNK--------------------------------
MURC_THEMA      EETERTAYLRKLGIPIFVPHSADNWYDP--------------------------------
MURC_FUSNN      CTNYVTEELLSMGIVVYNEHDEENVKGA--------------------------------
MURC_CLOAB      NGSPMIDKLKEHGAEIYLGHNEKNI-----------------------------------
MURC_CLOPE      KESEITNRLKEEGAKIYIGHSKDNL-----------------------------------
MURC_CALS4      KNSHLIERLEKEGAKINIPHMAESV-----------------------------------
MURC_STRP1      EKYYFTQRGLEQAGITILPFS---------------------------------------
MURC_STRP8      EKYYFTQRGLEQAGITILPFS---------------------------------------
MURC_STRPN      EKYYFTQRGLEQAGITILPFD---------------------------------------
MURC_LACLA      TDYFFTQRGLEQADVPLLPFD---------------------------------------
MURC_BACHD      EKRFFTQKPLEEKGIPIFPFQ---------------------------------------
MURC_BACSU      EKFIFTQTALEKRNITILPFS---------------------------------------
MURC_LISIN      DKYFFTQKALEEKQIPIMTFS---------------------------------------
MURC_LISMO      DKYFFTQKALEEKQIPIMTFS---------------------------------------
MURC_STAAM      ENYVFTEVALRNKGIKILPFD---------------------------------------
MURC_STAAU      ENYVFTEVALRNKGIKILPFD---------------------------------------
MURC_BORBU      SDKFYTDEILSNNKISYYDNIYEFSL----------------------------------
MURC_TREPA      ADVFYTDRILARLGVPVRT---PFSC----------------------------------
                                                                            

MURC_MYCLE      --------GGATAVITIRTAIPKTNPELVEARRRGIPVLLRSAVLARLMDG--CTTLMVA
MURC_MYCTU      --------GGATAVVTTHAAIPKTNPELVEARRRGIPVVLRPAVLAKLMAG--RTTLMVT
MURC_CORGL      --------ELPTVVVTSFAAIPQDNPELVRAREEGIPVIRRSDLLGELLEG--STQVLIA
MURC_STRCO      --------AADASCVVVSSAIREDNPELVRAAELGIPVVHRSDALAALMNG--LRPIAVA
MURC_DEIRA      --------FGKIDVLVASEAVPKSHPELAAARAAGVEVRPRMALLGELLAA--GPSVGVI
MURC_NOSS1      ------VGKSTLPQVVCSTAINSNNLEYQAAIELGCPILHRSDVLAALIND--YHSVAVA
MURC_SYNY3      VNGNGRYQTHCLPQVVCSTAINEGNLEYQGAIAKNCPIYHRSDILAALIAE--SRGIGVA
MURC_AGRFC      ---------GDAEVVVVSTAIKKNNPELIAAREKHLPIVRRAEMLAELMRF--RNAIAIG
MURC_RHIME      ---------GDAEVVVVSTAIKKDNPELIAAREKFLPVVRRAEMLAELMRF--RNAIAIG
MURC_BRUME      ---------GDAEVIVVSTAIKKNNPELVAAREKLLPVVRRAEMLAELMRF--RRAVAIG
MURC_RHILO      ---------GDAEVVVVSTAIKKTNPELKAAREKLLPIVRRAEMLAELMRF--RQAVAIG
MURC_CAUVC      ---------EGASAIVYSTAVKADNPEMVAGRDKRLPLVRRAEMLAELMRL--QFSVAVG
MURC_RICCN      ---------TNVSYVVISSAINPKNPEIKEALERKIPIIRRADMLAELMRL--KCSVAVS
MURC_RICPR      ---------KNVSYVVISSAINQNNPEIKEALERKIPIIRRAEMLAELMRL--KCSVAVS
MURC_BUCAI      ---------KNVDFIIKSSAISSNNKEILAAKKRNIPILLRAEMIEILMSF--KKGIAVS
MURC_BUCAP      ---------KYADFIIISSAIPSDNPEIKAAKKKNIPILLRAEMLQIFMQF--KFGIAVS
MURC_ECOLI      ---------RDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRF--RHGIAIA
MURC_ECOL6      ---------RDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRF--RHGIAIA
MURC_SALTI      ---------RDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRF--RHGIAIA
MURC_SALTY      ---------RDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRF--RHGIAIA
MURC_YERPE      ---------LDASVVVVSTAISADNPEIVAAREARIPVIRRAEMLAELMRY--RHGIAVA
MURC_VIBCH      ---------AHASVVVVSTAINEQNPEIQAAREKRIPIVRRAEMLAELMRF--RHGIAVA
MURC_HAEIN      ---------EGASVVVVSSAIKDDNPELVTSKQKRIPVIQRAQMLAEIMRF--RHGIAVA
MURC_PASMU      ---------DGASVVVVSSAIRADNVEVVAAQERRIPVIQRAQMLAEIMRF--RHGIAVA
MURC_PSEAE      ---------DGADVLVVSSAINRANPEVASALERRIPVVPRAEMLAELMRY--RHGIAVA
MURC_NEIMA      ---------NGADVVVTSTAVKKENPEVVAALEQQIPVIPRALMLAELMRF--RDGIAIA
MURC_NEIMB      ---------NGADVVVTSTAVKKENPEVVAALEQQIPVIPRALMLAELMRF--RDGIAIA
MURC_RALSO      ---------VGANAVVVSTAVRGDNPEVLAARAKRIPIVPRAVMLAELMRL--KQGIAIA
MURC_XANAC      ---------LGTDCVVVSSAIREDNPELMEARSQRIPIMPRAAMLAELMRF--RRGIAVA
MURC_XANCP      ---------LGTDCVVVSSAIREDNPELMEARSQRIPIMPRAAMLAELMRF--RRGIAVA
MURC_XYLFA      ---------LGTDCVVVSSAIREDNPELMEARSQRIPIMPRAAMLAELMRF--RHGIAVA
MURC_AQUAE      ---------GDAQVVVYSSAVKPDNPEIQEAKRRNIPVIPRGEMLAELFKL--KEGIAVS
MURC_HELPY      ------------DVIIHSAIIKEDNKEIQRAKELEIPILSRKDALYSILK--DKRVFSVC
MURC_HELPJ      ------------DVIIHSAIIKEDNTEIQRAKELEIPILSRKDALYSILK--DKRVFSVC
MURC_CAMJE      ------------DLVIYSAAIKEENPEFKYAKELGIKCLSRKEALPLILE--DKRVFAVA
MURC_THEMA      ------------DLVIKTPAVRDDNPEIVRARMERVPIENRLHYFRDTLKREKKEEFAVT
MURC_FUSNN      ------------DYVIASTAIKESNPELSYAKNNGIEILKRGELLAKLLN--RETGIAVA
MURC_CLOAB      ---------NNVDIVVYTAAIPEDNPELIYARKNNISLMTRAEFLGSLMKG-HKYNIAIS
MURC_CLOPE      ---------QDVDVVVYTAAIPSDNPEIIKAKEDNLILMDRAEFLGQIMKG-HKFNVAVA
MURC_CALS4      ---------IGADLVVYTAAIHDDNVEYQKAKELGIPIIDRATLLGLIMKK-YKFGVAVA
MURC_STRP1      ----EDNITPDMELIVGNAFR-ENNKEVAYALRHQIPFKRYHDFLGDFMKS--FISFAVA
MURC_STRP8      ----EDNITPDMELIVGNAFR-ENNKEVAYALRHQIPFKRYHDFLGDFMKS--FISFAVA
MURC_STRPN      ----EKNLDGDMEIIAGNAFRPDNNVEIAYADQNGISYKRYHEFLGSFMRD--FVSMGVA
MURC_LACLA      ----EKNIKPEFELIAGNAFRDDNNVEIAFAHKNGFPFKRYHEFLGHFMED--FTSIGVA
MURC_BACHD      ----KENIKEGQQVVVSAAYS-DEHEEVVAAKEQGLEIQSYPTFLGEFIQR--FTSIAVT
MURC_BACSU      ----AENIKPGMTVIAGNAFP-DTHPEIEKAMSEGIPVIRYHKFLGDYMKK--FTSVAVT
MURC_LISIN      ----ADNIKEGLTIIAGNAFP-DTHEEIERANELNLPVIRYHKFLGQLIDG--YTSIAIT
MURC_LISMO      ----ADNIQEGLTIIAGNAFP-DTHEEIERALELGLSVIRYHKFLGQLIDG--YTSIAIT
MURC_STAAM      ----ANNIKEDMVVIQGNAFA-SSHEEIVRAHQLKLDVVSYNDFLGQIIDQ--YTSVAVT
MURC_STAAU      ----ANNIKEDMVVIQGNAFA-SSHEEKARAHQMKLDVVSYNDFLGQIIDQ--YTSVAVT
MURC_BORBU      ----KQLDRSFDLIVYSSAYNKDGLQVLLEAKELNIPILSYPEALGELSRK--YYSIGIA
MURC_TREPA      ----QNLADAPDVVIHSAAYVPEENDELAEAYRRGIPTLTYPEALGDISCA--RFSCGIA
                              :               .             :             : 

MURC_MYCLE      GTHGKTTTTSMLVVALQHCGCDPSFVVGGELAVVGTNAHHG-LGACFVAEADESDGSLLE
MURC_MYCTU      GTHGKTTTTSMLIVALQHCGLDPSFAVGGELGEAGTNAHHG-SGDCFVAEADESDGSLLQ
MURC_CORGL      GTHGKTSTTSMSVVAMQAAGMDPSFAIGGQLNKAGTNAHHG-TGEVFIAEADESDASLLR
MURC_STRCO      GTHGKTTTTSMLAVSLSELDLGPSYAIGGDLDAPGSNALHG-EGEIFVAEADESDRSFHK
MURC_DEIRA      GTHGKTTTTSMIAVAMYGAGLDPSAFVGGNVPEFGGNARTG-TG-PFVAEVDESDRGFAL
MURC_NOSS1      GTHGKTTTSSMIGYMLLEAGLDPTIIVGGEVNAWEGNARLG-QSSYLVAEADESDGSLVK
MURC_SYNY3      GTHGKTTTSSLIGYVLKEAGLDPTIVVGGEVDAWQGNAYLG-SGEYLVAEVDESDGSLTK
MURC_AGRFC      GTHGKTTTTSMVATLLEAGNLDPTVINGGIINAYGTNARMG-EGEWMVVEADESDGTFLK
MURC_RHIME      GTHGKTTTTSMVAALLDAGGLDPTVINGGIINAYGTNARMG-AGEWMVVEADESDGTFLK
MURC_BRUME      GTHGKTTTTSLVAALLDAGHLDPTVINGGIINAYGTNARMG-DGDWMVVEADESDGTFLK
MURC_RHILO      GTHGKTTTTSMVATLLEAGGLDPTVINGGIINAYGTNARMG-DGEWMVVEADESDGTFLK
MURC_CAUVC      GTHGKTTTTSMVAALLDAGGLDPTVVNGGIINAYGTNAKVG-EGDWIVVEADESDGSFLK
MURC_RICCN      GSHGKTTTTSLVACLFEAAGLCPTVINGGIINNKSTNAYLG-SSNYLIAEADESDATFIH
MURC_RICPR      GSHGKTTTTSLIACLFEAAGLCPTVINGGIINNKSTNAYLG-SSNYLIAEADESDATFIH
MURC_BUCAI      GTHGKTTTTSMIADIFIDSGLDPTVINGGLIKSINSYAKLG-SSSYFITEADESDASFLY
MURC_BUCAP      GTHGKTTTTSMIFDILNQNKLDPTVINGGLIKSINSHAKLG-FSKYFIAEADESDGSFLC
MURC_ECOLI      GTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLG-HGRYLIAEADESDASFLH
MURC_ECOL6      GTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLG-HGRYLIAEADESDASFLH
MURC_SALTI      GTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLG-HSRYLIAEADESDASFLH
MURC_SALTY      GTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLG-HSRYLIAEADESDASFLH
MURC_YERPE      GTHGKTTTTAMLSSIYAEAGLDPTFVNGGLVKAAGTHARLG-SSRYLIAEADESDASFLH
MURC_VIBCH      GTHGKTTTTALVTQIYSEAGLDPTFVNGGLVKSAGTNARLG-SSRILIAEADESDASFLH
MURC_HAEIN      GTHGKTTTTAMISMIYTQAKLDPTFVNGGLVKSAGKNAHLG-ASRYLIAEADESDASFLH
MURC_PASMU      GTHGKTTTTAMISMIYAEAGLDPTFVNGGLVKSAGTNAHLG-CSRYLIAEADESDASFLH
MURC_PSEAE      GTHGKTTTTSLIASVFAAGGLDPTFVIGGRLNAAGTNAQLG-ASRYLVAEADESDASFLH
MURC_NEIMA      GTHGKTTTTSLTASILGAAGLDPTFVIGGKLNAAGTNARLG-KGEYIVAEADESDASFLH
MURC_NEIMB      GTHGKTTTTSLTASILGAAGLDPTFVIGGKLNAAGTNARLG-KGEYIVAEADESDASFLH
MURC_RALSO      GTHGKTTTTSLVASVLAEGGLDPTFVIGGRLNSAGANARLG-TGDFIVAEADESDASFLN
MURC_XANAC      GTHGKTTTTSLAAAVLSEGGLDPTFVIGGQLLAAGANAKLG-GGQWLVAEADESDGSFLR
MURC_XANCP      GTHGKTTTTSLAAAVLSEGGLDPTFVIGGQLLAAGANAKLG-GGQWLVAEADESDGSFLR
MURC_XYLFA      GTHGKTTTTSLIAAVLSEGGLDPTFVIGGQLLAAGANAKLG-AGQWLVVEADESDGSFLR
MURC_AQUAE      GSHGKTTTTSMIAEILINAGLEPTVIIGGRLKRLGTNAKLG-RGELLVSEADESDGSFLK
MURC_HELPY      GAHGKSSITAMLSAICPSF----GAIIGAHSKEFDSNVRES-ANDSLVFEADESDSSFLF
MURC_HELPJ      GAHGKSSITAMLSAICPAF----GAIIGAHSKEFDSNVRES-ADMSLVFEADESDSSFLF
MURC_CAMJE      GAHGKSTTSSILASLLDDA----SVIIGAILKEFGSNMIYK-ESQNLVFEADESDSSFLN
MURC_THEMA      GTDGKTTTTAMVAHVLKHLRKSPTVFLGGIMDSLEHGNYEK-GNGPVVYELDESEEFFSE
MURC_FUSNN      GTHGKTTTSSMLSAVMLSK--DPTIVVGGILPEIKSNAKPG-KSEYFIAEADESDNSFLF
MURC_CLOAB      GTHGKTTTTSMVSHIALTEDVDPTILVGGNLDIINGNVLAG-KSDYFITEACEYKASFLE
MURC_CLOPE      GTHGKTTTTSMISHVALSADLDPTILVGGDLDIIHGNFRVG-NSEYFITEACEYKQSFLR
MURC_CALS4      GSHGKTTTTSLISVILDRAGYDPTVLVGGEIDAIGGNVRVG-KSEYFVTEACEYTDSFLK
MURC_STRP1      GAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANA-------QYFVFESDEYERHFMP
MURC_STRP8      GAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANA-------QYFVFESDEYERHFMP
MURC_STRPN      GAHGKTSTTGMLSHVLSHITDTSFLIGDGTGRGSANA-------KYFVFESDEYERHFMP
MURC_LACLA      GAHGKTSTTGMLAHVMSNIVDTSYLIGDGTGRGIEGS-------EYFVFESDEYERHFMP
MURC_BACHD      GSHGKTSTTGLLSHVLGSHCPTSFLIGDGTGKGAADS-------HYFVFEACEYRRHFLN
MURC_BACSU      GAHGKTSTTGLLAHVIQNAKPTSFLIGDGTGQGNENS-------EYFVFEACEYRRHFLS
MURC_LISIN      GSHGKTSTTGLLSHVVGAIRPTSYLIGDGTGSGTKDA-------KYFALEACEYQRHFLA
MURC_LISMO      GSHGKTSTTGLLSHVVGAIRPTSYLIGDGTGSGTKDA-------EYFALEACEYQRHFLA
MURC_STAAM      GAHGKTSTTGLLSHVMNGDKKTSFLIGDGTGMGLPES-------DYFAFEACEYRRHFLS
MURC_STAAU      GAHGKTSTTGLLSHVMNGDKKTSFLIGDGTGMGLPES-------DYFAFEACEYRRHFLS
MURC_BORBU      GSHGKTTTTAFLGVLFNKLGLNPNVIVGSSVKDFKDNSAIAGISNIFIVETCEYKKHFLN
MURC_TREPA      GVHGKTTTTAMIAQMVKELRLDASVLVGSAVSGNNDSCVVLNGDTFFIAETCEYRRHFLH
                * .**::  .:                ..                 .  *  *    :  

MURC_MYCLE      YTPNVAVVTNIDSDHL--DFYGSVDAYIRVFDSFVERFALGGALVVCNDDPGAAA--LAR
MURC_MYCTU      YTPHVAVITNIESDHL--DFYGSVEAYVAVFDSFVERIVPGGALVVCTDDPGGAA--LAQ
MURC_CORGL      YKPNVAVVTNVEPDHL--DFFKTPEAYFQVFDDFAGRITPNGKLVVCLNDPHAAE--LGE
MURC_STRCO      YAPEVAIVLNVELDHH--ANYASMDEIYESFETFAGKIVPGGTLVIAADHEGARE--LTR
MURC_DEIRA      LGCETAVFTNAEDDHVGGELATYWSTVEEQHAGFARFVAQSGRVLFCADWPGLDT--LCS
MURC_NOSS1      HAPEIGIITNIELDHP--DHYDTLEEVVDIFQTFAKGCKTLIGSVDCETVRELLR--NAS
MURC_SYNY3      HHPEIGIVTNIELDHP--DHYSTLAEVVEIFRTFESHCQTLIGCLDCGVVRQHL------
MURC_AGRFC      LPADVAVITNIDPEHLD-HYGN-FDAVRAAFRQFVENVPFYGFGVMCLDHPEVQA--LVG
MURC_RHIME      LPADIAVVTNIDPEHLD-HYGS-FDAVRAAFRQFVENVPFYGFGVLCLDHPEVQS--MVG
MURC_BRUME      LPADIAVVTNIDPEHLD-HYGN-FDAVRAAFRQFVENVPFYGFGVMCLDHPEVQA--LVS
MURC_RHILO      LPADIAVVTNIDPEHLD-HYGS-FDKVREAFRQFVENVPFYGFGVMCTDHPEVQA--LVG
MURC_CAUVC      LKSTVAIVTNIDAEHLD-HWGD-FDAVKKGFQDFIQNIPFYGFAAVCTDHPEVQA--LTS
MURC_RICCN      IPSTIAIITNIDPEHLD-YYRD-FETLIGAFRSFITNLPFYGFAVCCIDHKIVRK--LVD
MURC_RICPR      IPSTIAIITNIDPEHLD-YYQD-FEILIGAFRSFITNLPFYGFAVCCIDHKIVRK--LVD
MURC_BUCAI      LNPNIIIVTNIEPDHID-HYDNSFKKLKQTFLIFLKKITLYGTAIVCIDNNAICD--ILT
MURC_BUCAP      LNPTTAIITNIEPDHID-NYNGEFKLLKKTFLDFLNKIPSYGIAILCTDNKAILN--ILP
MURC_ECOLI      LQPMVAIVTNIEADHMD-TYQGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRE--LLP
MURC_ECOL6      LQPMVAIVTNIEADHMD-TYQGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRE--LLP
MURC_SALTI      LQPMVAIVTNIEADHMD-TYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRE--LLP
MURC_SALTY      LQPMVAIVTNIEADHMD-TYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRE--LLP
MURC_YERPE      LQPMVAIVTNIEADHMD-TYQGDFENLKQTFINFLHNLPFYGRAVMCIDDPVVRE--LLP
MURC_VIBCH      LQPMVTIVTNIEADHMD-TYGGDFENLKQTFIDFLHNLPFYGQAILCIDDPVIRE--LIP
MURC_HAEIN      LQPMVSVVTNMEPDHMD-TYEGDFEKMKATYVKFLHNLPFYGLAVMCADDPVLME--LVP
MURC_PASMU      LQPMVSVVTNIEPDHME-TYHGSFEEMKHTYVNFLHNLPFYGLAVLCADDDVLTE--LTP
MURC_PSEAE      LQPMVAVVTNIDADHMA-TYGGDFNKLKKTFVEFLHNLPFYGLAVMCVDDPVVRE--ILP
MURC_NEIMA      LTPIMSVVTNIDEDHMD-TYGHSVEKLHQAFIDFIHRMPFYGKAFLCIDSEHVRA--ILP
MURC_NEIMB      LTPIMSVVTNIDEDHMD-TYGHSVEKLHQAFIDFIHRMPFYGKAFLCIDSEHVRA--ILP
MURC_RALSO      LFPVIEVITNIDADHMD-TYGHDFARLKQAFIEFTHRLPFYGIAVLCVDDPNVRE--ILP
MURC_XANAC      LNPLMAVITNIDADHLE-NYGNDFARVQAAFAEFLQRLPFYGLALLCIDDPEVAA--LAG
MURC_XANCP      LNPLMAVITNIDADHLE-NYGNDFARVQAAFAEFLQRLPFYGLALLCIDDPEVAA--LAG
MURC_XYLFA      LNPLVAVVTNIDADHLE-NYGNDFSRIKDAFTEFLQRLPFYGLALLCLDDPEVAE--LAG
MURC_AQUAE      LQPAVAVITNVDKEHLD-FYEN-FERVKEAFEQFMNSVPFYGFAVVNLDDPTLAQ--LVK
MURC_HELPY      SNPYAAIVPNTEPEHLE-HYGHDLERFFFAYEYFLDHAQKRVIYKEDPFLKNYSK--NA-
MURC_HELPJ      SNPFCAIVPNTEPEHLE-HYDHDLERFFFAYKYFLDHAQKRVIYKEDPFLKNYSK--DA-
MURC_CAMJE      SNPYLAIVTNAEAEHLD-HYGNEVSKLHHAYTQFLDVAKIRVINAEDEFLKNYKN--ES-
MURC_THEMA      FSPNYLIITNARGDHLE-NYGNSLTRYRSAFEKISRNTDLVVTFAEDELTSHLGD--VT-
MURC_FUSNN      MNPKYAVITNIDADHLD-VHGNLDNIKKSFIKFICHTQKEAIICLDCENLKEVVT--RLP
MURC_CLOAB      FYPYIGVILNIDADHLD--YYKNIDDIENTFAKFVNLIPKEGYLIANADDKRVAR--VAS
MURC_CLOPE      FFPYVGIILNIDADHLD--FYKDINHIKDTFKQFVRLIPNDGYIIGNADDEKVME--VLE
MURC_CALS4      FYPYIAVILNVDSDHLD--YFKNIDNIKQSFRQFASLVPSDGFVVACKDDANTMH--VIK
MURC_STRP1      YHPEYSIITNIDFDHPD--YFTGIADVRNAFNDYAKQVKKALFVYGEDDE-------LKK
MURC_STRP8      YHPEYSIITNIDFDHPD--YFTGIADVRNAFNDYAKQVKKALFVYGEDDE-------LKK
MURC_STRPN      YHPEYSIITNIDFDHPD--YFTSLEDVFNAFNDYAKQITKGLFVYGEDAE-------LRK
MURC_LACLA      YHPEYTIMTNIDFDHPD--YFEGIEDVTSAFQDYANNIKKGIFAYGEDVN-------LRK
MURC_BACHD      YRPDYCIMTNIDFDHPD--YFDDINDVFSAFQEMAMQVKKAIVACGDDEQ-------LQG
MURC_BACSU      YQPDYAIMTNIDFDHPD--YFSSIDDVFDAFQEMALQVNKGIIACGDDEH-------LPK
MURC_LISIN      YKPTYAIMTNIDWDHPD--YFKSVDDVFNAFETLGKQVKKAVFALGDDVE-------LRK
MURC_LISMO      YKPTYAIMTNIDWDHPD--YFKSVDDVFNAFETLGKQVKKAVFALGDDAE-------LRK
MURC_STAAM      YKPDYAIMTNIDFDHPD--YFKDINDVFDAFQEMAHNVKKGIIAWGDDEH-------LRK
MURC_STAAU      YKPDYAIMTNIDFDHPD--YFKDINDVFDAFQEMAHNVKKGIIAWGDDEH-------LRK
MURC_BORBU      FSPNMLILTNVDYEHVD--FFKNYEALEEAFLQYINNLKKNGILIINSDDN--NLLKIKR
MURC_TREPA      FHPQKIVLTSVEHDHQD--YYSSYEDILAAYFHYIDRLPQFGELFYCVDDQGVREVVQLA
                      :. .   :*                                             

MURC_MYCLE      RTAELGIRVLRYGSDDRI----GETLAARLLSWEQQGTGAVAHIQLAGQPNSR-----VM
MURC_MYCTU      RATELGIRVLRYGSVP------GETMAATLVSWQQQGVGAVAHIRLASELATAQGP-RVM
MURC_CORGL      RSVRKGIKTVGYGTADAVQAHPEVPAMATIVDSQVVAEGTRATINIDGQEVSV-------
MURC_STRCO      RLAGRVRTVTYGESED---------ADVRILSVVPQGLKSEVTVVLDGAELTF-------
MURC_DEIRA      GAREQLTYGQSAGADY------------RAVNVRPDESGTTFDVEFRGERLGE------A
MURC_NOSS1      GDRQQPTITYSLHQDT--------EADYTVTNIDYRADGTTALVWEKGKALGV------L
MURC_SYNY3      ----SPTITYSLENHP--------EADYQARQIKRQAHGNEVEVWERGVCLGT------M
MURC_AGRFC      RIEDRKVITYGENPQ----------ADVRFSNVRIDGTRSIFDVEIRRRRTGKIFSFKDL
MURC_RHIME      KIEDRKVVTYGENPQ----------ADVRFHNIRMDGATSIFDIEIRRRRTGQVIEIKDL
MURC_BRUME      RIEDRRIITYGSNPQ----------AEVRFVNQRMDGAASLFDVVIRSR-KGEATEIKDL
MURC_RHILO      RIEDRRVITYGENAQ----------ADVRFTNHRMAGATSEFDVVIRDRKTGSQSTISGL
MURC_CAUVC      RIENRRLVTYGTNPQ----------AEVRVSNIEMGPEGATFDIIVSPR-AGEAVRYDGL
MURC_RICCN      DITERKIVTYGIDSED---------AHIIAFNINTDIASSTFDVKISLPNVLGTTIIEKI
MURC_RICPR      DITERKIITYGIDSED---------AHIIAFNINTDIASSTFDVKISLPNVLGTTIIEKI
MURC_BUCAI      NL-KCKIITYGFNKN----------ADVRIFLYKQNNFIGHFYIILKN---NKK---LNI
MURC_BUCAP      KI-KCKVITYGFNKS----------AEFRITSYKQSDFISNFTLIRKKQ--LNN---LEI
MURC_ECOLI      RV-GRQTTTYGFSED----------ADVRVEDYQQIGPQGHFTLLRQDK--EP----MRV
MURC_ECOL6      RV-GRQTTTYGFSED----------ADVRVEDYQQIGPQGHFTLLRQDK--EP----MRV
MURC_SALTI      RV-GRQTTTYGFSED----------ADVRVEDYQQIGPQGHFTLLRQGM--PD----LHV
MURC_SALTY      RV-GRQTTTYGFSED----------ADVRVEDYQQIGPQGHFTLLRQGM--PD----LHV
MURC_YERPE      RV-GRHITTYGFSDD----------ADVQIASYRQEGPQGHFTLRRQDK--PL----IEV
MURC_VIBCH      RV-SRQVITYGFSED----------ADVRIENYRQNGQQGQFTVVRKGK--AN----LDI
MURC_HAEIN      KV-GRQVITYGFSEQ----------ADYRIEDYEQTGFQGHYTVICPNN--ER----INV
MURC_PASMU      KV-GRQVITYGFSEK----------ADYRIEDYQQTGFQGHYTVITPSG--ER----IDV
MURC_PSEAE      QI-ARPTVTYGLSED----------ADVRAINIRQEGMRTWFTVLRPER--EP----LDV
MURC_NEIMA      KV-SKPYATYGLDDT----------ADIYATDIENVGAQMKFTVHVQMK--GHEQGSFEV
MURC_NEIMB      KV-SKPYATYGLDDT----------ADIYATDIENVGAQMKFTVHVQMK--GHEQGSFEV
MURC_RALSO      FV-SKPVVRYGFAED----------AQVRAVNARAVDGRMEFTVIRQLN--GHAEPPLSI
MURC_XANAC      KT-PRHVMSYGMSEN----------ADVRAEDVVQDGPCMRFTLRLPEG--TT----TPV
MURC_XANCP      KT-PRHVMSYGMSEN----------ADVRAEDVVQDGPRMRFTLRLPEG--TT----TPV
MURC_XYLFA      KA-RRHVMTYGIDAA----------ADVRAEDVVQDGARMCFTLCLPEG--KV----IPV
MURC_AQUAE      KS-HERVITYGINSP----------ALVRAKNLYLKEGRYEFGVEFKGK--EL----GRI
MURC_HELPY      -----------IVLE----------KKDIYNIQYILKDGEPYTSFELKDL------GAFL
MURC_HELPJ      -----------IVLE----------KKDIYNIQYILKDGEPYTSFELKNL------GAFL
MURC_CAMJE      -----------IKLYP---------SKDIKNCTMCIENFKPFTSFELKDL------GEFK
MURC_THEMA      -----------FGVKK---------GTYTLEMRSASRAEQKAMVEKNGKR------YLEL
MURC_FUSNN      EE--KTVTTYSIKDES---------ANIFAKNIKIEDRKTIFELYINKEL------IGEF
MURC_CLOAB      NA-TCNVVSFGID-N----------GDIRAKNISFNESGFSSFDVYKSSE----L-LFNI
MURC_CLOPE      VA-KCNVLTYGIN-N----------GDIQARNIEFNEKGCATFDVFRNEE----K-LLSL
MURC_CALS4      GL-EKNIVTYGINEK----------SDWQAKDITYDEKGCASFNVYYRGK----F-IGHF
MURC_STRP1      IEAPAPIYYYGFEE----------GNDFIAYDITRTTNGSDFKVKHQGEV------IGQF
MURC_STRP8      IEAPAPIYYYGFEE----------GNDFIAYDITRTTNGSDFKVKHQGEV------IGQF
MURC_STRPN      ITSDAPIYYYGFEAE---------GNDFVASDLLRSITGSTFTVHFRGQN------LGQF
MURC_LACLA      LTAKAPIYYYGFEA----------NDDYRAENLVRSTRGSSFDAYFRGEK------IGHF
MURC_BACHD      IHANVPVVYYGFNE----------DNDFQARNIEVTSEGTHFQVFVRNNH------YGDF
MURC_BACSU      IHANVPVVYYGTGE----------ENDFQARNIVKSTEGTTFDVFVRNTF------YDTF
MURC_LISIN      LSLDVPIIYFGFGS----------ENEFQAKNVKKETTGTKFDVYHRDEF------LASF
MURC_LISMO      LTLDIPIIYFGFGE----------ENEFQAKNVIKETTGTKFDVYHREEF------LSSF
MURC_STAAM      IEADVPIYYYGFKD----------SDDIYAQNIQITDKGTAFDVYVDGEF------YDHF
MURC_STAAU      IEADVPIYYYGFKD----------SDDIYAQNIQITDKGTAFDVYVDGEF------YDHF
MURC_BORBU      QINRKDISIFSYGS-----------GDLSDFQISNIAVRSEYFCFSFLGL------LNVE
MURC_TREPA      FFSRPDLVYVPYGE-----------RAWGDYGVSIHGVQDRKISFSLRGF------AGEF
                                                                            

MURC_MYCLE      RLPVPGRHMALNALGALLAAIEIGAS---------TDEVLDGLAGFRGVRRRFELVGTSG
MURC_MYCTU      RLSVPGRHMALNALGALLAAVQIGAP---------ADEVLDGLAGFEGVRRRFELVGTCG
MURC_CORGL      ILQIPGDHMVLNGAAALLAGYLVGGD---------VDKLVEGLSDFSGVRRRFEFHGAIE
MURC_STRCO      AVSVPGRHYAHNAVAALAAGAALGVP---------AAELAPALAAYTGVKRRLQLKGEAA
MURC_DEIRA      RVSLPGTHNVLNGLAALAVTHLYGGD---------FDRAARALADFHGPGRRWEIKGERG
MURC_NOSS1      KLKLLSRHNLSNALAAVAVGRLVGLE---------FGEIAKGIAGFEGARRRFEFRGEVD
MURC_SYNY3      TVTLPGDHNISNALAAVAVGRLLGLD---------FPVIAQAIASFNGAKRRFECKGYCN
MURC_AGRFC      VLPMPGRHNVSNATAAIAVANRLGIS---------EADIKKGLASFAGVKRRFTLTGEA-
MURC_RHIME      RLPMPGRHNVSNATAAVAVAQRLGIK---------PEDIARGLATFGGVKRRFTLTGEW-
MURC_BRUME      RLPMPGLHNVSNATAAIAVAHELGIS---------SDDIRRGLGSFGGVKRRFTHTGSW-
MURC_RHILO      RLPMPGRHNVSNATAAIAVAHELGLS---------GEAIKKGLSSFAGVKRRFTHTGSW-
MURC_CAUVC      KMPMAGHHNVLNATAAVAVARELGVD---------AEAIAKGLAGFGGVKRRFTTTGVA-
MURC_RICCN      TIPTPGRHNILNSLAAIAVGIELDFG---------IKAIKNGFNNFKGVKRRFTKVAEY-
MURC_RICPR      TIPTPGRHNILNSLAAIAVGIELDFG---------IKAIKNGFNNFKGVKRRFTKVAEY-
MURC_BUCAI      ILNIPGKHNALNAAAAIALAIHEGIN---------NDLMIASLKNFQGTCRRFEFLGFLS
MURC_BUCAP      ILNLPGEHNALNATAAIAFATYQKIP---------DEKIYQSLKNFKGTSRRFEYVGKLF
MURC_ECOLI      TLNAPGRHNALNAAAAVAVATEEGID---------DEAILRALESFQGTGRRFDFLGEFP
MURC_ECOL6      TLNAPGRHNALNAAAAVAVATEEGID---------DEAILRALESFQGTGRRFDFLGEFP
MURC_SALTI      TLNAPGRHNALNAAAAVAVATEEGID---------DDAILRALESFQGTGRRFDFLGEFP
MURC_SALTY      TLNAPGRHNALNAAAAVAVATEEGIA---------DDAILRALESFQGTGRRFDFLGEFP
MURC_YERPE      TLNAPGRHNALNAAAAVAVATEEGIE---------DEDILRALVGFQGTGRRFDFLGNFP
MURC_VIBCH      TLNIPGRHNALNAAAAIAVATEDDIR---------DEAILRAMANTQGTGRRFDHLGEF-
MURC_HAEIN      LLNVPGKHNALNATAALAVAKEEGIA---------NEAILEALADFQGAGRRFDQLGEFI
MURC_PASMU      LLNVPGRHNALNATAALVVAKEEGIG---------NEAILAALADFQGAGRRFDQLGQFI
MURC_PSEAE      SVNMPGLHNVLNSLATIVIATDEGIS---------DEAIVQGLSGFQGVGRRFQVYGELQ
MURC_NEIMA      VLNMPGRHNVLNALAAIGVALEVGAS---------VEAIQKGLLGFEGVGRRFQKYGDIK
MURC_NEIMB      VLNMPGRHNVLNALAAIGVALEVGAS---------VEAIQKGLLGFEGVGRRFQKYGDIK
MURC_RALSO      TLNLPGMHNVQNALAAIAIATELEVP---------DEAIVKALAEFNGVGRRFQRYGEVP
MURC_XANAC      TLALPGRHNVLNALAAAAIGWQLGVA---------PDTIARALENFAGIGRRFNDLGEVT
MURC_XANCP      TLALPGRHNVLNALAAAAIGWQLGVA---------PDTIARALENFAGIGRRFNDLGEVT
MURC_XYLFA      TLALPGRHNVLNALAASAVGWQLGVP---------PEVIGRALKSFVGIGRRFNDLGDVA
MURC_AQUAE      HLGIAGIHNVYNALAATGVALELGVS---------FEVIKKSLEEFRNAERRLELKGYYK
MURC_HELPY      VWGLGEHNATNASLAILSALDEL--H---------LEEIRNNLLNFKGIKKRFDILQKN-
MURC_HELPJ      VWGLGEHNATNASLAILSALDEL--N---------LEEIRNNLLNFKGIKKRFDILQKN-
MURC_CAMJE      VFGMGYHLALDASLAILAALNFL--D---------IETIRTRLKNYQGIKKRFDILHADE
MURC_THEMA      KLKVPGFHNVLNALAVIALFDSLGYD---------LAPVLEALEEFRGVHRRFSIAFHDP
MURC_FUSNN      SLNIPGEHNIQNSLPVIYLAFKFGVS---------KEEIQEALNKFKGSKRRYDVLFDKE
MURC_CLOAB      ELNVPGKHNILNALSAIASALTLKIS---------HKSIIDGLKSFKGTHRRFEIKGVKN
MURC_CLOPE      SLNVPGMHNVSNSLSAVCLAEIFNIN---------ADSIVSGLSSFGGAHKRFEYKGTKN
MURC_CALS4      KLSIPGKHNIYNALASLAVTYLLGVD---------TEKAKEYIKEFKGTHRRFEVKGVVE
MURC_STRP1      HVPAYGKHNILNATAVIANLFVAGID---------MALVADHLKTFSGVKRRFTEK-IIN
MURC_STRP8      HVPAYGKHNILNATAVIANLFVAGID---------MALVADHLKTFSGVKRRFTEK-IVN
MURC_STRPN      HIPTFGRHNIMNATAVIGLLYTAGFD---------LNLVREHLKTFAGVKRRFTEK-IVN
MURC_LACLA      VVPAYGKHNVLNALSVVAVCHNLGLD---------MTEVADHLLTFRGVKRRFTEK-KVG
MURC_BACHD      TIPRFGKHNVLNSLAVIALCHYENIP---------VEVLARELKTFEGVKRRFTEK-TLG
MURC_BACSU      YIPAYGHHNVLNSLAVIALCHYEEID---------SSIIKHALKSFGGVKRRFNEK-QLG
MURC_LISIN      EIPAYGDHNVLNALSVIALCDYEGLP---------VDEVKKELKTFEGVKRRFSIT-EKG
MURC_LISMO      EIPAYGDHNVLNALSVIALCDYEGLP---------VEDVKNELKTFEGVKRRFSIT-EKG
MURC_STAAM      LSPQYGDHTVLNALAVIAISYLEKLD---------VTNIKEALETFGGVKRRFNET-TIA
MURC_STAAU      LSPQYGDHTVLNALAVIAISYLEKLD---------VTNIKEALETFGGVKRRFNET-TIA
MURC_BORBU      LKTVLFHNVLNFSAALLALNLFLESN--GKSIFDFEEAIKRIAKNYSGIKRRVEVVKEEN
MURC_TREPA      YVALPGEHSVLNATGALALALSLVKKQYGEVTVEHLTALRKVLALFQGCRRRSEVLGEVR
                            .                                  .  :*        

MURC_MYCLE      VGQASN-S--LVRVFDDYAHHPTEISATLAAFRIMLEQSGG-GRCIVVFQPHLYSRTKAL
MURC_MYCTU      VGKAS------VRVFDDYAHHPTEISATLAAARMVLEQGDG-GRCMVVFQPHLYSRTKAF
MURC_CORGL      GGKFNG-----AAIYDDYAHHPTEVTAVLSAARTRVKAAGK-GRVIVAFQPHLYSRTIEF
MURC_STRCO      G----------VQVVDSYAHHPTEMTADLEAMRAAV---GD-ARILVLFQPHLFSRTQEL
MURC_DEIRA      G----------ALVVDDYAHNATKVASAVQAARQTG------RRVRVVFQPHRYLRTQQS
MURC_NOSS1      G----------ITFIDDYAHHPSEIRATLAAARLQARPG---QRVVAIFQPHRYSRTLTF
MURC_SYNY3      G----------ITFIDDYAHHPSELLATLAAAKQKVTHGKY-ERVVAIFQPHRYSRTHTF
MURC_AGRFC      ---------NGVQVFDDYGHHPVEIKAVLAAAREACK-----GRIIAVHQPHRYSRLSSL
MURC_RHIME      ---------NGARIFDDYGHHPVEIRAVLRAAREACQ-----GRIVAVHQPHRYSRLSSL
MURC_BRUME      ---------NGVEIFDDYGHHPVEIRAVLKAAREATSQAG--GRVVAIVQPHRYTRLASL
MURC_RHILO      ---------NGVDVFDDYGHHPVEISAVLKAARSATK-----GRVIAIAQPHRFTRLHDL
MURC_CAUVC      ---------NGIRVVDDYGHHPVEIAAVLKAARAVTPN----GKVIAVVQPHRFTRLRDL
MURC_RICCN      ---------NNASIIDDYAHHPEEIKATLATAKNIANKQN--GKVIAIFQPHRYSRMQYL
MURC_RICPR      ---------NKAVIIDDYAHHPEEIKATLATAKNIANQQN--GKVIAIFQPHRYSRIKYL
MURC_BUCAI      IDQGFD-KRANCMLIDDYGHHPTELSETIKTIRISWPN----KNLIMIFQPHRYTRTYNL
MURC_BUCAP      IKKKSI-QNKSVMLINDYGHHPTELSETIKTIRKSWPK----KNLIMIFQPHRYTRTRNL
MURC_ECOLI      LEPVNG-KSGTAMLVDDYGHHPTEVDATIKAARAGWPD----KNLVMLFQPHRFTRTRDL
MURC_ECOL6      LEPVNG-KSGTAMLVDDYGHHPTEVDATIKAARAGWPD----KNLVMLFQPHRFTRTRDL
MURC_SALTI      LEPVNG-KAGTAMLVDDYGHHPTEVDATIKAARAGWPD----KNLVMLFQPHRYTRTRDL
MURC_SALTY      LEPVNG-KAGTAMLVDDYGHHPTEVDATIKAARAGWPD----KNLVMLFQPHRYTRTRDL
MURC_YERPE      LAPVNG-KEGSAMLVDDYGHHPTEVDATIKAARAGWPD----KRIVMLFQPHRYTRTRDL
MURC_VIBCH      ---ETG-N-GVAMLVDDYGHHPTEVDVTIKAARNGWAE----KRLVMIFQPHRYTRTRDL
MURC_HAEIN      R------PNGKVRLVDDYGHHPTEVGVTIKAAREGWGD----KRIVMIFQPHRYSRTRDL
MURC_PASMU      R------PNGKVMLVDDYGHHPTEVGVTIQAARQGWEN----KRIAMIFQPHRYSRTRDL
MURC_PSEAE      VE------GGSVMLVDDYGHHPREVAAVIKAIRGGWPE----RRLVMVYQPHRYTRTRDL
MURC_NEIMA      LPNG-----GTALLVDDYGHHPVEMAATLSAARGAYPE----KRLVLAFQPHRYTRTRDL
MURC_NEIMB      LPNG-----GTALLVDDYGHHPVEMAATLAAARGAYLE----KRLVLAFQPHRYTRTRDL
MURC_RALSO      TADGQ----GRFTLIDDYGHHPVEMAATLAAARGAFPG----RRLVLAFQPHRFTRTRDC
MURC_XANAC      TSTG-----ARVRVVDDYGHHPRELEAVFAAARGGWPD----KRLVVAFQPHRYSRTRDQ
MURC_XANCP      TASG-----ARVRVVDDYGHHPRELEAVFAAARGGWPD----KRLVVAFQPHRYSRTRDQ
MURC_XYLFA      IGNG-----ACVRLIDDYGHHPRELEAVFAAVRGGWPD----KRLVVAFQPHRYSRTRDQ
MURC_AQUAE      ----------NSPVYDDYGHHPTEIKAVINSLRDMYPD----KNLLVVFQPHRYSRTYYL
MURC_HELPY      ----------ALILIDDYAHHPTEISATLKSARIYANLLNTQEKIIVIWQAHKYSRLMDN
MURC_HELPJ      ----------NLILIDDYAHHPTEIGATLKSARIYANLLNTQEKIIVIWQAHKYSRLMDN
MURC_CAMJE      ----------NLVLIDDYGHHPTEIKATLSAAQEYVKL-GGYKKITAIFEPHRYTRLATN
MURC_THEMA      E--------TNIYVIDDYAHTPDEIRNLLQTAKEVFEN----EKIVVIFQPHRYSRLERE
MURC_FUSNN      LENGYGNKTKRVRIVDDYAHHPTEIKATLKAIKSIDTS-----RLVAIFQPHRYSRVHFL
MURC_CLOAB      ----------GITVIDDYAHHPTEIKATLDAAKNYPHN-----KIYCVFQPHTYSRTLSL
MURC_CLOPE      ----------DITVIDDYAHHPVEIKATLSTAKKMNHN-----RIVCVFQPHTYTRTKTL
MURC_CALS4      ----------GVTVVDDYAHHPAEIHATLEAAKNYPHK-----RIIAIFQPHTYSRTKAL
MURC_STRP1      ----------DTIIIDDFAHHPTEIVATIDAARQKYPS----KEIVAIFQPHTFTRTIAL
MURC_STRP8      ----------DTIIIDDFAHHPTEIVATIDAARQKYPS----KEIVAIFQPHTFTRTIAL
MURC_STRPN      ----------DTVIIDDFAHHPTEIIATLDAARQKYPS----KEIVAVFQPHTFTRTIAL
MURC_LACLA      ----------ETVIIDDFAHHPTEIEATLDAARQKYPD----REIVAVFQPHTFTRTIAF
MURC_BACHD      ----------GQILIDDYAHHPTEISATIEAAKQKYPD----RPVVAIFQPHTFSRTKAF
MURC_BACSU      ----------DQVLIDDYAHHPTEIKVTIEAARQKYPD----REIVAVFQPHTFTRTQQF
MURC_LISIN      ----------NQVLVDDYAHHPSEIRATVNAARQKYPN----KKIVAVFQPHTFTRTRTF
MURC_LISMO      ----------NQVLVDDYAHHPSEIRATVNAARQKYPD----KKVVAVFQPHTFTRTRTF
MURC_STAAM      ----------NQVIVDDYAHHPREISATIETARKKYPH----KEVVAVFQPHTFSRTQAF
MURC_STAAU      ----------NQVIVDDYAHHPREISATIETARKKYPH----KEVVAVFQPHTFSRTQAF
MURC_BORBU      ----------GVIYMDDYAHHPREIKNTLFGIKNFYKN----KRIILDFMPHTFTRTKEF
MURC_TREPA      ----------GILFMDDYGHHPTAIKKTLRGLKTFFPE----RRIVVDFMSHTYSRTAAL
                               :.:.* .  :   .   :                 .* : *    

MURC_MYCLE      SREFGRAL-SAADEVFIVGVNGAREQPLAGVS-----GASVAKHVSVP-----VRYIPDY
MURC_MYCTU      AAEFGRAL-NAADEVFVLDVYGAREQPLAGVS-----GASVAEHVTVP-----MRYVPDF
MURC_CORGL      QKEFAEAL-SLADAAVVLEIYGAREQPVDGVS-----SEIITDAMTIP-----VVYEPNF
MURC_STRCO      GKEMGQAL-ALADASVVLDIYPAREDPIPGVT-----SELIVEAARAAG-AD-VTPVHDK
MURC_DEIRA      WPRLADAL-MDADEVLVLDIAAASETPIEGVH-----ATLITDRMTQGGHPN-VHYCPDR
MURC_NOSS1      LEEFSESF-SHADLVVLTDIYSAGEPNLGLIS-----GENLAEKIAQEH-PQ-VVYQPTL
MURC_SYNY3      MAEFATAF-KDADLVVLTDIYSAGEQNPYNIR-----GEDLAKAVGQHH-GH-VVYQPRL
MURC_AGRFC      FDDFAHCF-NDADTILLAPVYAAGEDPIEGAS-----SEALVSAIKAAGHRD-ARFLEKR
MURC_RHIME      FEDFTSCF-NDADTILLAPVYAAGEEAIEGVS-----SEALVDRIKAAGHRD-ARHVPGQ
MURC_BRUME      FDEFAACF-NDADTVIVAPVYTAGEEPIEGVN-----SEELVSRIKTAGHRD-ARYATGP
MURC_RHILO      FNEFSACF-NDADTVIVAPVYAAGEDPIDGVS-----SDELVSRIRAGGHRD-ARYIEGP
MURC_CAUVC      MTEFSSCF-NDADTVIVADVYTAGEQPIPGVD-----RDALVAGLKKFGHRR-ALPLENP
MURC_RICCN      FDDFMLCF-ADADILYITDIYAAGENPIEGIT-----GRSLVDKITKRKHHDKANFLAEL
MURC_RICPR      FDDFMLCF-ADADILYITNIYAAGETPIEGIT-----GQSLVDKMTQNKHHDKANFLAEL
MURC_BUCAI      YHDFVQTL-SQVDVLLILHVYSANEKFIVGAD-----SLSLFNDIKKLGKNY-VTLISNH
MURC_BUCAP      YFDFIKIL-SQVDSLLILNVYSANESFISGAD-----SFSLYSDIKKIKKN--VILVTNR
MURC_ECOLI      YDDFANVL-TQVDTLLMLEVYPAGEAPIPGAD-----SRSLCRTIRGRGKID-PILVPDP
MURC_ECOL6      YDDFANVL-TQVDTLLMLEVYPAGEAPIPGAD-----SRSLCRTIRGRGKID-PILVPDP
MURC_SALTI      YDDFANVL-TQVDALLMLDVYPAGEAPIPGAD-----SRSLCRTIRNRGKID-PILVSDP
MURC_SALTY      YDDFANVL-TQVDALLMLDVYPAGEAPIPGAD-----SRSLCRTIRNRGKID-PILVSDP
MURC_YERPE      YDDFANVL-SQVDVLLMLDVYAAGEPPIPGAD-----SRALCRTIRNRGKLD-PILVPDS
MURC_VIBCH      YDDFANVL-EQVDVLIMLDVYAAGEKPIAGAD-----GRSLCRTIRSRGKID-PIFVPDS
MURC_HAEIN      FDDFVQVL-SQVDALIMLDVYAAGEAPIVGAD-----SKSLCRSIRNLGKVD-PILVSDT
MURC_PASMU      FDDFVQVL-SQVDVLIMLDVYAAGETPIAGAD-----SRSLCRSIRNLGKVD-PIFVSDH
MURC_PSEAE      YEDFVQVL-GEANVLLLMEVYPAGEEPIPGAD-----SRQLCHSIRQRGQLD-PIYFERD
MURC_NEIMA      FEDFTKVL-NTVDALVLTEVYAAGEEPIAAAD-----SRALARAIRVLGKLE-PIYCENV
MURC_NEIMB      FEDFTKVL-NTVDALVLTEVYAAGEEPIAAAD-----SRALARAIRVLGKLE-PIYCENV
MURC_RALSO      FEDFIKVL-GTVDALLLAEVYAAGEPPIVAAD-----GRALTRALRVAGKIE-PVFVEQI
MURC_XANAC      FDAFAAVL-STVDALVLSEVYPAGEAPIPGAD-----SRALARAIRARGRSE-PVVVGQI
MURC_XANCP      FDAFAAVL-STVDALVLSEVYPAGEAPIPGAD-----SRALARAIRARGRSE-PVVVGQV
MURC_XYLFA      FDAFAAVL-SSVDALVLSEVYPAGEVPIPGAD-----AKALARAIRARGRSE-PVVVGQV
MURC_AQUAE      FEDFVKVL-KDIDKLIVTDIYPASENNVYGVS-----AEELARKS-G------AVFAKDK
MURC_HELPY      LEEFKKCFSEHCDRLIILPVYSASEVK-------------RDIDLKAHFKHYNPTFIDRV
MURC_HELPJ      LEEFKKCFLEHCDRLIILPVYSASEVK-------------RDIDLKAHFKHYNPTFIDRV
MURC_CAMJE      LKEFAKAF-EGVDELVILPVYAAGEEP-------------IELDLKAVFP--KALFVEDI
MURC_THEMA      DGNFAKAL-QLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGKEAYFVEKLPELEKVI
MURC_FUSNN      LDEFKDAF-VNVDKVILLPIYAAGEKNE---------FNISSEELKEHINHNNVEVMNEW
MURC_CLOAB      FDDFSNSF-SGVDELVLADIYAAREKDTGVVS-----SLKLSEAINKNGVK--SSNLHSF
MURC_CLOPE      FNDFVKCF-DDCDELVLMDIYAAREKDLGEIN-----SDQLGDAIRAHGVK--CTNVHSH
MURC_CALS4      LSDFAESF-DAADKIIITDIYAAREKDTGIVS-----SKDLVDLIFKRGKD--VLYIKDF
MURC_STRP1      LEDFACAL-NEADSVYLAQIYGSAREVD--------KGEVKVEDLAAKIIKP-----SQV
MURC_STRP8      LEDFACAL-NEADSVYLAQIYGSAREVD--------KGEVKVEDLAAKIIKP-----SQV
MURC_STRPN      LDDFAHAL-NQADAVYLAQIYGSAREVD--------HGDVKVEDLANKINKK-----HQV
MURC_LACLA      ADEFAEVL-DHADTVYLAQIYGSAREVD--------HHEITAQDLADKVRKP-----AKV
MURC_BACHD      LHEFAEAL-KQADHVYLCDIFGSAREN---------KGSLSIEDLQALIPG------AHL
MURC_BACSU      LDEFAESL-SGADCVYLCDIFGSAREN---------AGKLTIGDLQGKIHN------AKL
MURC_LISIN      LQGFADSL-NLADEVYLCDIFGSAREK---------TGNLTIADLAHKTKG------NHI
MURC_LISMO      LQGFADSL-NLADEVYLCDIFGSAREK---------TGNLTIADLAHKTKG------NHI
MURC_STAAM      LNEFAESL-SKADRVFLCEIFGSIREN---------TGALTIQDLIDKIEG------ASL
MURC_STAAU      LNEFAESL-SKADRVFLCEIFGSIREN---------TGALTIQDLIDKIEG------ASL
MURC_BORBU      FADFVEVL-SAADILILHNIYLSNRENF--------NPDELSVKLFLNIKKI-----NKN
MURC_TREPA      LTEFAESF-QDADVVILHEIYASAREVY--------QGEVNGEHLFELTKRK-----HRR
                   :   :    :   :  :  : .                                   

MURC_MYCLE      SAVVIEVAAAAGPGDVIVTMGIGDVGLLGPEIVAALRVRANCNTPGCSGVLQ-----
MURC_MYCTU      SAVAQQVAAAASPGDVIVTMGAGDVTLLGPEILTALRVRANRSAPGRPGVLG-----
MURC_CORGL      SAVPERIAEIAGPNDIVLTMGAGSVTMLAPEILDQLQNN------------------
MURC_STRCO      DASPALVAGMAKAGDLVLTMGAGDVTDLGPRILDELSK-------------------
MURC_DEIRA      AAVVRDLRESAQPGDIIVTMGAGDVYRIAEEVVGGSA--------------------
MURC_NOSS1      STVCEYLLKNLRPGDLALFLGAGNLNQAIPEIITTLCAPATATL-------------
MURC_SYNY3      TELREFLPKVLQSGDLALFLGAGNLNQQIAPVLAACA--------------------
MURC_AGRFC      EDLASQVAAIANPGDFVVLLGAGNITQWAAALPSELKSISGKSE-------------
MURC_RHIME      EALAPVIAKIAQPGDFVVLLGAGSITYWAAALPKQLAEISGNRA-------------
MURC_BRUME      EALAPLVASIAQAGDFVVCLGAGNVTQWAYALPKELAEQGKK---------------
MURC_RHILO      TAIAPIIRGLAKPGDFVVFLGAGNITQWAYALPKELAAS------------------
MURC_CAUVC      TALPRLIAAEATSGDLVVLLGAGDITTWSYALPGQLEALTK----------------
MURC_RICCN      DDAVGVIIDNAASGDMIIMMGAGNISSFANELEGRLSSRGFSCHTVV----------
MURC_RICPR      DDVVSIIIDNAASGDMIIMMGAGNISSFANELDRRLLSHEILENTDCDTKSNDKVMQ
MURC_BUCAI      NMILDTLIQTLQGNDIILIQGAGNIDTIAHKILIKKTKKVIK---------------
MURC_BUCAP      NLILNYLLPHLNGNDIILIQGAGDIDTIINKIFILKNKKVII---------------
MURC_ECOLI      ARVAEMLAPVLTGNDLILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD---------
MURC_ECOL6      AQVAEMLAPVLTGNDLILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD---------
MURC_SALTI      AQVATMLAPVLTGNDLILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG---------
MURC_SALTY      AQVATMLAPVLTGNDLILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG---------
MURC_YERPE      ESAPEMLAQILNGEDLILVQGAGNIGKIARKLAEHKLQPQLKDEEHHG---------
MURC_VIBCH      QTLPSVLANILQDGDLVLTQGAGDVGKVARHLAALELNIGRMQQI------------
MURC_HAEIN      SQLGDVLDQIIQDGDLILAQGAGSVSKISRGLAESWKN-------------------
MURC_PASMU      RQLGEILDQVLQDGDLILAQGAGNVSKIARQLAETWTKE------------------
MURC_PSEAE      ADLAPLVKPLLRAGDILLCQGAGDVGGLAPQLIKNPLFAGKGGKGA-----------
MURC_NEIMA      ADLPEMLLNVLQDGDIVLNMGAGSINRVPAALLELSKQI------------------
MURC_NEIMB      ADLPEMLLNVLQDGDIVLNMGAGSINRVPAALLALSKQI------------------
MURC_RALSO      EDMPQAILDAAQDNDVVITMGAGSIGQVPGQVVARQAEVRAANVVDLNGGAAA----
MURC_XANAC      AGLAEVLPDVLQDGDLLLMMGAGDIGYVAQHIINNGFVGEPA---------------
MURC_XANCP      AGLSEVLPDVLQDGDLLLMMGAGDIGYVAQQIVTDGFVGAPA---------------
MURC_XYLFA      ASLIEVLPDVLQEGDLLLMMGAGDIGSIAQRIAHDGFVFGEV---------------
MURC_AQUAE      EEVFEKVREVHDEGDVILFLGAGSISKWCEEFLKEVNLEK-----------------
MURC_HELPY      RKKGDFLELLVNDNVVETIEKGFVIGFGAGDITYQLRGEM-----------------
MURC_HELPJ      RKKGDFLELLVNDNVVETIEKGFVIGFGAGDITYQLRGEM-----------------
MURC_CAMJE      KREGKFLVASKG----QVFEEGLIIGFGAGDISNKLRQKNE----------------
MURC_THEMA      SVSENTVFLFVGAGDIIYSSRRFVERYQSSKSSPSRVLGSNK---------------
MURC_FUSNN      KDIKRYVSRVKKDSTYIFMGAGDISTLAHEIAEELEGMSE-----------------
MURC_CLOAB      EDIVNYFKSKLNDGDILLTVGAGDVFKIGEMFLSK----------------------
MURC_CLOPE      EEALEYVNANLSKGDLLLTVGAGDVVKVGELFLK-----------------------
MURC_CALS4      DSIVEYLKENTEEGDLVLTIGAGNIYEVGEKFLEENKK-------------------
MURC_STRP1      VTVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ-------------
MURC_STRP8      VTVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ-------------
MURC_STRPN      ITVENVSPLLDHDNAVYVFMGAGDIQTYEYSFERLLSNLTSNVQ-------------
MURC_LACLA      IDLDNVSPLLDHDRGVYVFMGAGNIQKYELAFEKLLSQVSTNLQ-------------
MURC_BACHD      LSENDLAPLQDHRSGVLLFMGAGDIQKFQQAYEHVLTT-------------------
MURC_BACSU      IEEDDTSVLKAHDKAVLIFMGAGDIQKYMRAYENVMA--------------------
MURC_LISIN      IKEEHTEELLQYPEAVILFMGAGDVQKFQAAYEKVLDNEIVANEVLKKSAIN-----
MURC_LISMO      IKEEHTEELLKYPEAVILFMGAGDVQKFQAAYEKVLDHEFLTEADLKKSAIN-----
MURC_STAAM      INEDSINVLEQFDNAVVLFMGAGDIQKLQNAYLDKLGMKNAF---------------
MURC_STAAU      INEDSINVLEQFDNAVVLFKGAGDIQKLQNAYLDKLGMKNAF---------------
MURC_BORBU      TYFFKDVKDSINFIKSLLISGDLFITMGAGNNFILHDFL------------------
MURC_TREPA      VYYYEAVMQAVPFLQAELKEGDLFVTLGAGDNCKLGEVLFNYFKEEV----------