CLUSTAL format seed alignment for MF_00047

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DDL_ACTP2       -------------------------------MSIKDEKIAVLFGGVSQEREVSLNSGAAV
DDL_HAEDU       -------------------------------MNIKNEKIAVLYGGTSQEREVSLHSGAAV
DDL_ACTSZ       ------------------------------MKSLKQQKIAVLLGGTASEREVSLNSGAAV
DDL_MANSM       ------------------------------MKPLKEQKIAVLLGGTSAEREVSLTSGDAV
DDL_HAEI8       -------------------------------MNLKQEKIAVLLGGTSAEREVSFNSGKAV
DDL_HAEIG       -------------------------------MNLKQEKIAVLLGGTSAEREVSFNSGRAV
DDL_HAEIN       -------------------------------MNLKQEKIAVLLGGTSAEREVSLNSGKAV
DDL_HAES1       -----------------------------MAKPLKQQKIAVLLGGTSAEREVSLNSGNAV
DDL_PASMU       -----------------------------MKKTLKQEKIAVLLGGTSAEREVSLDSGQAV
DDL_YERPE       ----------------------------------MAEKVAVLLGGTSAEREVSLLSGQAV
DDL_YERPA       ----------------------------------MAEKVAVLLGGTSAEREVSLLSGQAV
DDL_YERPN       ----------------------------------MAEKVAVLLGGTSAEREVSLLSGQAV
DDL_YERPP       ----------------------------------MAEKVAVLLGGTSAEREVSLLSGQAV
DDL_YERPS       ----------------------------------MAEKVAVLLGGTSAEREVSLLSGQAV
DDL_YERP3       ----------------------------------MAEKVAVLLGGTSAEREVSLLSGQAV
DDL_PHOLL       ----------------------------------MAEKVAVLLGGTSAEREVSLLSGQAV
DDL_PECAS       ----------------------------------MTEKVAVLLGGTSAEREVSLLSGQAV
DDLB_ECOLI      ----------------------------------MTDKIAVLLGGTSAEREVSLNSGAAV
DDLB_SHIFL      ----------------------------------MTDKIAVLLGGTSAEREVSLNSGAAV
DDLB_ECO57      ----------------------------------MTDKIAVLLGGTSAEREVSLNSGAAV
DDLB_ECOL6      ----------------------------------MTDKIAVLLGGTSAEREVSLNSGAAV
DDL_SALPA       ----------------------------------MADKIAVLLGGTSAERDVSLNSGAAV
DDLB_SALTI      ----------------------------------MADKIAVLLGGTSAERDVSLNSGAAV
DDLB_SALTY      ----------------------------------MADKIAVLLGGTSAERDVSLNSGAAV
DDL_BUCBP       -------------------------------MTIITEKIAVLLGGTSQERNISLISGYNI
DDL_BUCAP       ----------------------------------MKKKIAVLLGGNSSERKISIKSGYAI
DDL_BORBR       -------------------------------MSKQFGKVGVLYGGRSAEREVSLMSGKGV
DDL_BORPE       -------------------------------MSKQFGKVGVLYGGRSAEREVSLMSGKGV
DDL_BORPA       -------------------------------MSKQFGKVGVLYGGRSAEREVSLMSGKGV
DDL_BORA1       -------------------------------MTQRFGKVGVLYGGRSAEREVSLMSGAGV
DDL_RALSO       -------------------MTTGPFVPHPTLDPKSLGKVGVILGGRSAEREISLLSGNGV
DDL_JANMA       -------------------------------MKKEFGKVGVLFGGRSAEREVSLMSGKGV
DDL_NITEU       ------------------------------MNTRDVGKVAVLLGGRSAEREISLRSGQAV
DDL_NITEC       ------------------------------MNIRDLGKVAVLLGGRSAEREISLKSGHAV
DDLB_CHRVO      --------------------------------MKQYGKVAVLMGGSSSEREVSLMSGAGV
DDL_METFK       -------------------------------MRRDFGKVAVLLGGKSGEREVSLKSGAAV
DDL_NEIMB       --------------------------------MQNFGKVAVLMGGFSSEREISLDSGTAI
DDL_NEIMF       --------------------------------MQNFGKVAVLMGGFSSEREISLDSGTAI
DDL_NEIMA       --------------------------------MQNFGKVAVLMGGFSSEREISLDSGTAI
DDL_NEIG1       --------------------------------MQNFGKVAVLMGGFSSEREISLDSGTAI
DDL_PSEE4       -------------------MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAV
DDLB_PSEPK      -------------------MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAV
DDL_PSEPF       -------------------MTAAYANLFSTIAPKDFGRVAVLFGGLSAEREVSLKSGNAV
DDLB_PSESM      ------------------MTAVARSSLRSTLEPKSFGRVAVLFGGKSAEREVSLNSGNAV
DDLB_PSEAE      ------------------MNLCLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMV
DDL_SACD2       -------------------MTTTYVKKFDG-NTAALGRTLVLFGGTSSEREVSLRSGAAV
DDL_XANAC       --------------------MSALVGNARTSDPAAFGRVAVLLGGTSSEREVSLNSGGNV
DDLB_XANCP      --------------------MSTQIAPARISDPAAFGRVAVLLGGTSSEREVSLNSGSNV
DDL_XYLFA       ----------------------------------MFGRVAVLLGGTSAEREVSLLSGRNV
DDL_XYLFT       ----------------------------------MFGRVAVLLGGTSAEREVSLLSGRNV
DDL_RHIME       ---------------------------------MSSKHVAVLLGGFSSERPVSLSSGTAC
DDL_SINMW       ---------------------------------MSSKHVAVLLGGFSSERPVSLSSGTAC
DDLB_RHILO      ---------------------------------MKSKHVAVLLGGFSSERPVSLSSGKAC
DDL_AGRFC       ---------------------------------MGGKHVAVLLGGFSSERPVSLSSGNAC
DDLB_BRUME      --------------------------MRRGEARMTGKHVAVLMGGFSSERSVSLSSGVAC
DDLB_BRUSU      ---------------------------------MTGKHVAVLMGGFSSERSVSLSSGVAC
DDL_OCHA4       ---------------------------------MTGKHVAVLMGGFSSERPVSLSSGTAC
DDL_CHESB       ---------------------------------MKKKHVAVLMGGFSSERPVSLSSGNSC
DDL_BARHE       ---------------------------------MKDEHIAVLMGGFSSERSVSLSSGTAC
DDL_BARQU       ---------------------------------MKGEHVAVLMGGGSSERSVSLSSGTAC
DDL_BARBK       ---------------------------------MTGKHVTVLMGGWSSERSVSLSSGTAC
DDL_GLUOX       ------------------------------------MKVAVLLGGTSSERPVSLVSGEAA
DDL_GRABC       ---------------------------------MSIRRVVVLYGGISEERAVSLISGQQV
DDL_CAUVC       -----------------------MTQQPQADAPLAGRHIAVLLGGPSSERKVSLVSGAAC
DDL_RICB8       --------------MHKYQTHWVESSEIKILSDKGKKHIALVAGGMSAEREVSLISAEGV
DDL_RICBR       --------------MHKYQTHWVESSEIKILSDKGKKHIALVAGGMSAEREVSLISAEGV
DDL_RICCN       --------------MHKYQTHWVEHSIVKILSSTGKKHIALMAGGMSAEREVSLVSSEGV
DDL_RICRS       --------------MHKYQTHWVEHSIVKILSSTGKKHIALMAGGMSAEREVSLVSSEGV
DDL_RICM5       --------------MHKYQTHWVEHSIVKILSSAGKKYIALMAGGMSAEREVSLVSSEGV
DDL_RICFE       --------------MNKYQTHWVEHSEVKILSTTGKKHIALVAGGMSAEREVSLVSSEGV
DDL_RICPR       --------------MHKYQTHFVEHSVVKILSSTGKKHIALVAGGMSAEREVSLVSSAGV
DDL_RICTY       --------------MNKYQTHLLEHSVVKILSGTGKKHIALVAGGMSAEREVSLISSVGV
DDL_FUSNN       ------------------------------------MRIAVFMGGTSSEKEISLKSGEAV
DDL_THEMA       ------------------------------------MRVALLMGGVSREREISLRSGERV
DDL_THEP1       ------------------------------------MRVALLMGGVSREREISLRSGERV
DDL_PSELT       ------------------------------------MKIAVLLGGISRERPISLKSGENV
DDL_FERNB       ------------------------------------MYLGVLLGGISREREISIRSGKRI
DDL_AQUAE       ------------------------------------MRVVVLMGGRSSEREISLKTGKAV
DDL_CARHZ       ------------------------------------MKIGVICGGLSSEREVSLRTGDAI
DDL_MOOTA       ------------------------------------MKIAVLMGGPSSEREISLKSGSAV
DDL_SYNJB       ------------------------------------MNIVVLAGGRSAERQVSWVTGKAC
DDL_SYNJA       ------------------------------------MNIVILAGGRSAERQVSLVTGKAC
DDL_GLOVI       ------------------------------------MRITVLSGSDSPEREVSLVSGRAV
DDL_MAGMM       -------------------------------MDWKQKKIGVLYGGLSEEREVSLRSGQAL
DDL_DESVH       ------------------------------------MKVLLIAGGWSSERDVSLAGARGI
DDL_DESVV       ------------------------------------MKVLLIAGGWSSERDVSLAGARGI
DDL_DESAG       ------------------------------------MRILLIAGGWSEERDVSLSGARGI
DDL_LAWIP       ------------------------------------MNILLLAGGWSSEREVSLQSAELI
DDLA_PSEAE      -------------------------------MGQDKLKVAVLFGGSSEERDVSIASGAQV
DDL_BACAN       ------------------------------------MRIGVIMGGVSSEKQVSIMTGNEM
DDLA_BACCR      ---------------------------------------MLLWAGYASEKQVSIMTGNEM
DDLA_CLOTE      ------------------------------------MQIGVVMGGVSTEKEISNLTGKYI
DDL_CLOB1       ------------------------------------MKIGVIMGGISTEREVSLNSGREV
DDL_CLOBH       ------------------------------------MKIGVIMGGISTEREVSLNSGREV
DDL_CLOBL       ------------------------------------MKIGIIMGGISTEREVSLNSGREV
DDLA_CLOPE      ------------------------------------MKVGVIMGGISSEREISIQSGNSV
DDL_CLOPS       ------------------------------------MKVGVIMGGISSEREISIQSGNSV
DDLB_CLOPE      ------------------------------------MKVGIIMGGISSEREVSLASGESI
DDL_LACSS       ------------------------------------MKIVVLAGGRSTERNVSLTSGHKI
DDL_PEDPA       ------------------------------------MKIAVLAGGKSTERNVSLSSGSKI
DDL_BACFR       ----------------------------------MKRNIAIVAGGDTSEIVVSLRSAQGI
DDL_BACFN       ----------------------------------MKRNIAIVAGGDTSEIVVSLRSAQGI
DDL_BACTN       ----------------------------------MKRTIAIVAGGDTSEFHVSLRSAQGI
DDL_BACV8       ----------------------------------MKRTIAIVAGGDSSELVVSLRSAQGL
DDL_PORGI       ---------------------------------MKKPIVAVIAGGYSGEHSVSLKSAAGI
DDL_LEPBJ       -----------------------------------MAKIAVFFGGSSTEHSISIRTGCFI
DDL_LEPBL       -----------------------------------MAKIAVFFGGSSTEHSISIRTGCFI
DDL_LEPIN       -----------------------------------MAKIAVFFGGSSTEHSISILTGCFI
DDL_LEPIC       -----------------------------------MAKIAVFFGGSSTEHSISILTGCFI
DDL_TROW8       -----------------------------------MRSLLLLFGGRSQEHSVSYASARAL
DDL_TROWT       -----------------------------------MRRLLLLFGGRSQEHSVSYASARAL
DDL_TREPA       -----------------------------------MVHVTLLYGGRSAEHDVSVRSARFV
DDL_NOSS1       ------------------------------------MRVGLLFGGRSGEHEVSISSARAI
DDL_TRIV2       ---------------------------------MSKLRVGLLFGGRSGEHEVSISSARAI
DDL_TRIEI       ---------------------------------MTKLRVGLLFGGCSGEHEVSIRSAKVI
DDL_SYNY3       ------------------------------------MRVGLLFGGCSGEHEVSIKSAQAI
DDL_SYNP6       ---------------------------------MAAQKVGLLFGGRSGEHEVSIRSAAAI
DDL_SYNE7       ---------------------------------MAAQKVGLLFGGRSGEHEVSIRSAAAI
DDL_THEEB       ---------------------------------MGRLRVGLLFGGRSREHEVSVVSAAAI
DDL_PROM3       -------------------------------MPSSRTCVGVVFGGASEEHAVSIRSAITV
DDL_PROMM       -------------------------------MPSSRTCVGVVFGGASEEHAVSIRSAITV
DDL_SYNS3       -------------------------------MPSSPVRIGVVFGGASGEHAVSIRSAITV
DDL_SYNSC       -------------------------------MPSSPITVGLVFGGRSGEHDVSIRSAATV
DDL_SYNS9       -------------------------------MESRPTTIGLVFGGYSGEHEVSIRSATTV
DDL_SYNPX       -------------------------------MSSSPTTVGVVFGGCSGEHDVSIRSAQTV
DDL_PROMA       -------------------------------MRNAIKTVGIVFGGVSGEHEVSIKSARTI
DDL_PROM1       -------------------------------MFSNKPVIGVVFGGKSSEHEVSIKSAKTI
DDL_PROMT       -------------------------------MFSNKQVIGVVFGGKSSEHEVSIKSAKTI
DDL_PROMS       ------------------------------MIGGKKKCIGLIFGGNSNEHEVSISSAKTV
DDL_PROM0       ------------------------------MIGEKKKCIGLIFGGHSNEHEVSISSAKTV
DDL_PROM9       ------------------------------MIEEKKKCIGLIFGGYSNEHDVSISSAKTV
DDL_PROM2       ------------------------------MIGEKKKRIGLIFGGYSNEHEVSISSAKTV
DDL_PROM5       ------------------------------MVRNEKKCIGIIFGGTSNEHYVSISSAKTV
DDL_PROMP       ------------------------------MLEKEKKCIGIIFGGESNEHDVSVSSAKTV
DDL_DEIGD       ----------------------------------MKKRILLLAGGQSEEHEVSLRSARSV
DDL_DEIRA       ----------------------------------MKRRILLLAGGQSGEHEVSLRSARSV
DDL_BACLD       ----------------------------------MKTRLGLVYGGKSAEHNVSLQTALAV
DDL_BACSU       -----------------------------------------MYGGKSAEHNVSLQTALAV
DDL_BACP2       ----------------------------------MKISLGLIYGGKSAEHNVSLQTALAV
DDLB_BACCR      ---------------------------------MTKIKLGLLYGGKSAEHQVSLQTALAA
DDL_GEOKA       ----------------------------------MKTKVGVLYGGKSPEHQVSLSTAMAV
DDL_GEOTN       ----------------------------------MKTRVGVLYGGKSPEHQVSLSTARAV
DDL_LISMO       ----------------------------------MKTKLILLYGGKSAEHEVSLQTAFSV
DDL_LISMF       ----------------------------------MKTKLILLYGGKSAEHEVSLQTAFSV
DDL_LISIN       ----------------------------------MKTKLILLYGGKSAEHEVSLQTAFSV
DDL_LISW6       ----------------------------------MKTKLILLYGGKSAEHEVSLQTAFSV
DDL_STAAB       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAAC       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAA1       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAAM       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAAN       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAA8       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAAE       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAA3       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAAS       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAAW       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAAR       ---------------------------------MTKENICIVFGGKSAEHEVSILTAQNV
DDL_STAES       ---------------------------------MTKENICIVFGGKSAEHDVSILTAQNV
DDL_STAEQ       ---------------------------------MTKENICIVFGGKSAEHDVSILTAQNV
DDL_STAHJ       ---------------------------------MVKENICIVYGGKSAEHDVSKLTAQNV
DDL_STAS1       ---------------------------------MAKENVCIVYGGKSAEHDVSILTAQNV
DDL_ENTFA       ------------------------------------MKIILLYGGRSEEHDVSVLSAYSV
DDL_ENTHA       ------------------------------------MKITLLYGGRSAEHDVSVLSAFSV
DDL_LACLM       ---------------------------------MSKETLILLYGGRSAEREVSVLSAESV
DDL_LACLA       ---------------------------------MSKETLILLYGGRSAEREVSVLSAESV
DDL_STRA1       ---------------------------------MSKETLILLYGGRSAEREVSVLSAESV
DDL_STRA3       ---------------------------------MSKETLILLYGGRSAEREVSVLSAESV
DDL_STRA5       ---------------------------------MSKETLILLYGGRSAEREVSVLSAESV
DDL_STRT2       ---------------------------------MSKQTLILLYGGRSAEREVSVLSAESV
DDL_STRT1       ---------------------------------MSKQTLILLYGGRSAEREVSVLSAESV
DDL_STRTD       ---------------------------------MSKQTLILLYGGRSAEREVSVLSAESV
DDL_STRP1       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRPM       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRPB       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRPC       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRP8       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRPG       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRPD       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRP3       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRP6       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRPF       ---------------------------------MSKQTLVLLYGGRSAEREVSVLSAESV
DDL_STRMU       ---------------------------------MSKETLVLLYGGRSAERDVSVLSAESV
DDL_STRR6       ----------------------------------MKQTIILLYGGRSAEREVSVLSAESV
DDL_STRP2       ----------------------------------MKQTIILLYGGRSAEREVSVLSAESV
DDL_STRPN       ----------------------------------MKQTIILLYGGRSAEREVSVLSAESV
DDL_CLOAB       ----------------------------------MKKKVAILFGGQSTEHEVSRVSAASV
DDL_CLONN       ----------------------------------MKKKVAILFGGQSTEHEVSRVSASSV
DDLB_CLOTE      ----------------MLLAQQLNLYILKGEIIMKKIKIAIVFGGQSTEHEVSRNSVTSI
DDL_CALS8       ---------------------------------MTKLKVAVLFGGVSTEHEVSIVSAKSV
DDL_CHLPD       ---------------------------------MPLSTVALIFGGKSTEHEISIISAKSI
DDL_PELLD       ---------------------------------MHHTTVALLFGGRSLEHEISVISARAV
DDL_CHLCH       ---------------------------------MSRTTVALFFGGQSAEHEISIISAQSI
DDL_CHLTE       ---------------------------------MSKQTVALFFGGKSAEHEISIISARSI
DDL_COXBU       --------------------------------MAEKLHISVLCGGQSTEHEISIQSAKNI
DDL_SOLUE       ----------------------------------MKLRVAVIYGGRTGEHEVSVRSAKSI
DDL_BACSK       ---------------------------------MAKKRVGIIFGGKSAEHEVSLQSAKNI
DDL_OCEIH       ----------------------------------MKKKVGIVFGGKSAEHEVSLQSAKNI
DDLA_ECOLI      ---------------------------------MEKLRVGIVFGGKSAEHEVSLQSAKNI
DDLA_ECO57      ---------------------------------MEKLRVGIVFGGKSAEHEVSLQSAKNI
DDLA_SHIFL      ---------------------------------MEKLRVGIVFGGKSAEHEVSLQSAKNI
DDLA_ECOL6      ---------------------------------MEKLRVGIVFGGKSAEHEVSLQSAKNI
DDLA_SALTI      ---------------------------------MAKLRVGIVFGGKSAEHEVSLQSAKNI
DDLA_SALTY      ---------------------------------MAKLRVGIVFGGKSAEHEVSLQSAKNI
DDL_BAUCH       ---------------------------------MAKLRVGIIFGGQSAEHEVSLQSAKNI
DDLA_CHRVO      ---------------------------------MGKIRVGLIFGGQSSEHEVSLQSARNI
DDLA_XANCP      ----------------------------MTGAGMRRIRVGLIFGGKSAEHEVSLQSARNI
DDLA_PSESM      ----------------------------------MKKSVAIVFGGQSSEHEVSLQSARNV
DDL_BLOFL       --------------------------------MKSKLRVGLVCGGCSLEHEVSLKSAIYI
DDL_WIGBR       ----------------------------------MKKTVAVLFGGESKEHEISLQSSISI
DDL_BIFAA       ---------------------------------MAKKRIVVMYGGKADEHSISCISAASA
DDL_BIFLO       MRLLCAAFRARFGPVGGAKHRLENGCSFNKRMVMAKKRVVVLYGGRADEHSISCISTAGV
DDL_CORGL       ----------------MSNSNS------------GKVRVAVVYGGRSSEHSVSCVSAGAI
DDL_CORGB       ----------------MSNSNS------------GKVRVAVVYGGRSSEHSVSCVSAGAI
DDL_COREF       ----------------MSNSNS------------AKVRVAVLYGGRSAEHSVSCVSAGAI
DDL_MYCTU       ----------------MSANDR----------RDRRVRVAVVFGGRSNEHAISCVSAGSI
DDL_MYCTA       ----------------MSANDR----------RDRRVRVAVVFGGRSNEHAISCVSAGSI
DDL_MYCBP       ----------------MSANDR----------RDRRVRVAVVFGGRSNEHAISCVSAGSI
DDL_MYCBO       ----------------MSAND-------------RRVRVAVVFGGRSNEHAISCVSAGSI
DDL_MYCUA       ----------------MSGSSR----------RGERLRVAVVFGGRSNEHAISCVSAGSI
DDL_MYCLE       ----------------MNVYQRPLMPWLP---SGGRVRVAVVFGGRSNEHAVSCLSAGSI
DDL_MYCSM       ----------------MTAPNHP----------PGRTRVAVVYGGRSSEHAISCVSAGSI
DDL_MYCS2       ----------------MTAPNHP----------PGRTRVAVVYGGRSSEHAISCVSAGSI
DDL_MYCSK       ----------------MIARNQ-------------RTRVAVVYGGRSSEHAISCVSAGSI
DDL_MYCSS       ----------------MIARNQ-------------RTRVAVVYGGRSSEHAISCVSAGSI
DDL_MYCSJ       ----------------MIARNQ-------------RTRVAVVYGGRSSEHAISCVSAGSI
DDL_STRAW       ----------------MSTENLPQSPEQ----PPRKPRVAVVFGGRSSEHGISVVTAGAV
DDL_STRCO       ----------------MSTENLPQNPEQSPRRPPRKPRVAVVFGGRSSEHGISVVTAGAV
DDLA_PSEPK      ---------------------------------MKQNVIALVFGGRSSEHSVALRSAATI
DDL_LEGPC       --------------------------------MSKPVNLVLLYGGKSGEHEVSLVSAASV
DDL_LEGPA       --------------------------------MSKPVNLVLLYGGKSGEHEVSLVSAASV
DDL_LEGPL       --------------------------------MSKPVNLVLLYGGKSGEHEVSLVSAASV
DDLA_BRADU      --------------------------------MADKIRVVVLYGGRSGEHEVSLKSAASV
DDLA_BRUME      -------------------------------MASGKMRIVVLFGGRSAEHDVSVLSATNV
DDLA_BRUSU      -------------------------------MASGKMRIVVLFGGRSAEHDVSVLSATNV
DDLA_RHILO      --------------------------------MKEKTRVAILYGGRSAEHDVSRLSAANV
DDLB_BRADU      ----------------------MTAYGGEMTKERRKITVGLLFGGRSAEHEVSRASAANI
DDL_VIBCB       ----------------------------------MIKNILLLCGGGSSEHEISLLSANFV
DDL_VIBPA       ----------------------------------MIKNILLLCGGGSSEHEISLLSANFV
DDL_VIBVU       ----------------------------------MMRNVLLLCGGGSSEHEISLLSSEYL
DDL_VIBVY       ----------------------------------MMRNVLLLCGGGSSEHEISLLSSEYL
DDL_VIBCH       ---------------------------------MTKTTILLLCGGGSSEHEISLVSANYI
DDL_AERHH       ---------------------------------MKNIHVLLLCGGGGSEHEVSLRSANFL
DDL_SHEON       ---------------------------------MSKINLLLLCGGGSAEHDISLLSANYF
DDL_LACBA       ------------------------------METKTKLHVGLLFGGNSSEHDVSKRSAHNI
DDL_LACPL       ------------------------------METQKKIHVGMLFGGNSSEHDVSKRSAHNI
DDL_LEUME       ---------------------------------MTKKRVALIFGGNSSEHDVSKRSAQNF
DDL_LEUMM       ---------------------------------MTKKRVALIFGGNSSEHDVSKRSAQNF
DDL_BORBU       ----------------------------------MKKNLMLIFGGVSFEHEISCKSAYSI
DDL_CALS4       -----------------------------------MLKVAVMFGGKSVEHEVSIITGLQV
DDL_THEM4       -----------------------------------MLNIGIFFGSKSVEHEISIITAQQV
DDL_CAMJE       ------------------------------------MKFAILFGGNSYEHEISIVSAVVL
DDL_WOLSU       ------------------------------------MNLAVIFGGASYEHEISIVSAISL
DDL_HELHP       ------------------------------------MKFDVLFGGVSFEHEISIVSAVAL
DDL_HELPY       ------------------------------------MEFCVLFGGASFEHEISIVSAIAL
DDL_HELPJ       ------------------------------------MEFCVLFGGASFEHEISIVSAIAL
                                                         . ..   *  ::       

DDL_ACTP2       TEALK---------SLGYNVEGIDTKDFPIEKLKEKG-----------------------
DDL_HAEDU       TEALK---------SLGYNVEGIDTKDIAIEKLKEKG-----------------------
DDL_ACTSZ       LDALR---------SQGYDAHPVDPKDMPVADLKQQG-----------------------
DDL_MANSM       LTALR---------NQGYDAHPIDPKEYPVAQLKEQG-----------------------
DDL_HAEI8       LEALL---------KQGYNAHPIDPKEYNVANLKKDG-----------------------
DDL_HAEIG       LEALL---------KQGYNAHPIDPKEYNVANLKKDG-----------------------
DDL_HAEIN       LEALL---------KQGYNAHPIDPKEYNVANLKKDG-----------------------
DDL_HAES1       LTALR---------NQGFDAHPIDPKEYPVAMLKEQG-----------------------
DDL_PASMU       LNALL---------SAGFDAHPIDPKTFPVATLKEQG-----------------------
DDL_YERPE       LAGLK---------EAGIDAYGVDTKDFPVTQLKEQG-----------------------
DDL_YERPA       LAGLK---------EAGIDAYGVDTKDFPVTQLKEQG-----------------------
DDL_YERPN       LAGLK---------EAGIDAYGVDTKDFPVTQLKEQG-----------------------
DDL_YERPP       LAGLK---------EAGIDAYGVDTKDFPVTQLKEQG-----------------------
DDL_YERPS       LAGLK---------EAGIDAYGVDTKDFPVTQLKEQG-----------------------
DDL_YERP3       LAGLK---------EAGIDAYGVDTKDFPVTQLKEQG-----------------------
DDL_PHOLL       LAGLR---------EAGIDAHPVDTKDFPVTQLKEAG-----------------------
DDL_PECAS       LAGLK---------EAGINAHAVDTRDFPVTTLKEEG-----------------------
DDLB_ECOLI      LAGLR---------EGGIDAYPVDPKEVDVTQLKSMG-----------------------
DDLB_SHIFL      LAGLR---------EGGIDAYPVDPKEVDVTQLKSMG-----------------------
DDLB_ECO57      LAGLR---------EGGIDAYPVDPKEVDVTQLKSMG-----------------------
DDLB_ECOL6      LAGLR---------EGGIDAYPVDPKEVDVTQLKSMG-----------------------
DDL_SALPA       LAGLR---------EGGIDAHPVDPQEVDVAQLKAMG-----------------------
DDLB_SALTI      LAGLR---------EGGIDAHPVDPQEVDVAQLKAMG-----------------------
DDLB_SALTY      LAGLR---------EGGINAHPVDPQEVDVAQLKAMG-----------------------
DDL_BUCBP       LNSLL---------KSGIHAVAIDTKDFPITQLPHQK-----------------------
DDL_BUCAP       LQSLL---------RSGFNAYAIDTRDFPIMQLKKQG-----------------------
DDL_BORBR       HEALL---------SAGVDAHLFDTGERSLADLAAAG-----------------------
DDL_BORPE       HEALL---------SAGVDAHLFDTGERSLADLAAAG-----------------------
DDL_BORPA       HEALL---------SAGVDAHLFDTGERSLADLAAAG-----------------------
DDL_BORA1       HEALR---------SAGVDAHLFDTGLQDLTALEAAG-----------------------
DDL_RALSO       LAALR---------SRGVDAHPFDPGTQPVAGLAAQG-----------------------
DDL_JANMA       LAALL---------SKGIDAHPFDPAERSLAELAAEK-----------------------
DDL_NITEU       LAALQ---------RSRVNAHAFDPAGQPLENLLQQG-----------------------
DDL_NITEC       LAALQ---------RSQVDAHAFDPVGQPLEDLLKQG-----------------------
DDLB_CHRVO      LSALR---------SKGVDAHGFDPSEKPLSALKEEG-----------------------
DDL_METFK       LAALR---------RNGVDAHAFDPAERALSEL--AG-----------------------
DDL_NEIMB       LNALK---------SKGIDAYAFDPKETPLSELKAQG-----------------------
DDL_NEIMF       LNALK---------SKGIDAYAFDPKETPLSELKAQG-----------------------
DDL_NEIMA       LNALK---------SKGIDAYAFDPKETPLSELKAQG-----------------------
DDL_NEIG1       LNALK---------SKGIDAYAFDPKETPLSELKERG-----------------------
DDL_PSEE4       IEALT---------SAGVDVVAIDVGDDLLARLQNEK-----------------------
DDLB_PSEPK      IDALS---------TAGVDVVAIDVGDDLLARLQSEK-----------------------
DDL_PSEPF       LTALQ---------SAGVDAFGIDVGADILQRLLSEK-----------------------
DDLB_PSESM      LKALL---------DAGVDAFGIDVGDDFLQRLVSEK-----------------------
DDLB_PSEAE      LQSLL---------AAGVDAFGIDVGEDLLQRLVEEK-----------------------
DDL_SACD2       LQALQ---------AGGVDAHGLDVQADAIAKIEAFA-----------------------
DDL_XANAC       LDALR---------ARGVDAQPVDGIPALAKALVAQQ-----------------------
DDLB_XANCP      LDALR---------ARGVDAQPVDGIPALAQALVAQR-----------------------
DDL_XYLFA       LEVLR---------VRGVDAQSVDGVPALAQALVERR-----------------------
DDL_XYLFT       LEVLR---------MRGVDAQSVDGVPALAQALVERR-----------------------
DDL_RHIME       ADALE---------AEGYRVTRVDVGRDVAAVLQEL------------------------
DDL_SINMW       ADALE---------GEGYRVTRVDVGHDVAAVLQEL------------------------
DDLB_RHILO      ADALE---------NEGYQVTRVDVGRDVGSVLAEL------------------------
DDL_AGRFC       ALALE---------GEGYKVTRVDVGRDVAAVLDEL------------------------
DDLB_BRUME      ATTLE---------ECGYRVTRIDVDRNVASILVEL------------------------
DDLB_BRUSU      ATTLE---------ECGYRVTRIDVDRNVASILVEL------------------------
DDL_OCHA4       AATLE---------ERGYCVTRIDVDRNVASVLAEL------------------------
DDL_CHESB       ADALE---------AEGYRVSRVDVSRDVSRVLSEL------------------------
DDL_BARHE       ADVLE---------AQGYRVSRVDVDGHIASVLEQL------------------------
DDL_BARQU       ADILE---------ARGYRVSRVDVDSHIASVLERL------------------------
DDL_BARBK       ADILE---------AQGYNVVRVDVDDRIVSVLEEL------------------------
DDL_GLUOX       IEALR---------EKGHDVTPIDVGPDIATTIASLKA-A--------------------
DDL_GRABC       VAALR---------EAGYEVTPIEVGADLRDTIAAL-T-P--------------------
DDL_CAUVC       AEALE---------RLGAKVSRIDPGPDVAQVLAAT------------------------
DDL_RICB8       GKALI---------EAGYKVTFIDMGADIAVKLHEI------------------------
DDL_RICBR       GKALI---------EAGYKVTFIDMGADITVKLHEI------------------------
DDL_RICCN       SKALI---------ELGYRVTFIDMGADIAVRLQEI------------------------
DDL_RICRS       SKALI---------ELGYRVTFIDMGADIAVRLQEI------------------------
DDL_RICM5       SKALI---------ELGYSVTFIDMGADITVRLQEI------------------------
DDL_RICFE       SKALI---------ELGYKVTFIDMGADIAVKLQEI------------------------
DDL_RICPR       SKALI---------ELGYKVTFVDMGADIAVKLQEI------------------------
DDL_RICTY       SKALI---------ELGYKVTFIDMGADIAVKLQEI------------------------
DDL_FUSNN       LESLQ---------KQGYDAYGVILDE--RNQVSAFVD-N--------------------
DDL_THEMA       KKALE---------KLGYEHTVFDVREDFLKKVDQLKSF---------------------
DDL_THEP1       KKALE---------KLGYEYTVFDVKEDFLKEVDQLKSF---------------------
DDL_PSELT       LKALK---------KLGHDVVPIDVDENFLEIAPKLKEF---------------------
DDL_FERNB       AQALR---------NMGHVVDEIDVDDNFIYKLSELKKY---------------------
DDL_AQUAE       AKALR---------ELGHEVYELDLDKELPCKLLEIKP----------------------
DDL_CARHZ       FRALL---------KKGYNVVKIDMDRNIAETLKKEN-----------------------
DDL_MOOTA       AAALS---------GLGHQVITIDLNREVVARLKNFA-----------------------
DDL_SYNJB       KRALE---------DLGHRVKVIDPDEDLPLRLWQERQA---------------------
DDL_SYNJA       KRALE---------DLGHRAKLIDPEEDLPLRLWQERQA---------------------
DDL_GLOVI       QAALE---------TLGHEVTMVDPGPDLPVRLLENP-----------------------
DDL_MAGMM       FVALQ---------SLGYQVVAIDVDRHITKVLEREG-----------------------
DDL_DESVH       EKALC---------ALGHDVTWFDPATSLDGLLEA-------------------------
DDL_DESVV       EKALR---------ALGHDVTWFDPATSLDGLLEA-------------------------
DDL_DESAG       HAALE---------RLGHQVTLFDPCRTLAGLLEA-------------------------
DDL_LAWIP       TSAMI---------EYGHTVTCLDPLYDFDKIVEV-------------------------
DDLA_PSEAE      IQALR---------SAGHQVLAVDTASGLLGAEEERRLLASKVKEVPPDSDSLAIIR---
DDL_BACAN       IANLD---------KNKYEIVPITLNEKMDL-----------------------------
DDLA_BACCR      IAHLD---------KNKYEIVPITLNEKMDL-----------------------------
DDLA_CLOTE      IENLD---------KSKYEILPIPINTKFEL-----------------------------
DDL_CLOB1       IKYLE---------LLEHEIIPIIIDKKEDV-----------------------------
DDL_CLOBH       IKYLE---------LLEHEIIPIIIDKKEDV-----------------------------
DDL_CLOBL       IKYLE---------LLEHEIIPIIIDKKEDV-----------------------------
DDLA_CLOPE      VHALD---------KDKYEAIPIVLNEKEDL-----------------------------
DDL_CLOPS       VHALD---------KDKYEAIPIVLNEKEDL-----------------------------
DDLB_CLOPE      FNHID---------KEKYEVSKIIINNKIDI-----------------------------
DDL_LACSS       THALQ---------TKGHDVAFVDLFLGNELKDGATIDSLYSSDPVEKDYDIDDEVL---
DDL_PEDPA       TNALR---------SKGYDATMIDLFLGYELEDGQSYEDVFKSSNTSTDYEISDAVL---
DDL_BACFR       YSFID---------KEKYNLYIVEMEGRR-WEVQLPDGSKTPVDR---------------
DDL_BACFN       YSFID---------KEKYNLYIVEMEGRR-WEVQLQDGSKTPVDR---------------
DDL_BACTN       YSFID---------KEKYTLYIVEMQGTR-WEVQLPDGAKAPVDR---------------
DDL_BACV8       YSFID---------KERYNLYIVEMEGHR-WEVVLPDGSKTPIDR---------------
DDL_PORGI       LSWLG---------SEPFSTFLVLIERDR-WSVRVSEQREVPLDK---------------
DDL_LEPBJ       CRTLH---------TMGHSVKPILLTQDGGWVVPLQYRISIPYEAV--------------
DDL_LEPBL       CRTLH---------TMGHSVKPILLTQDGGWVVPLQYRISIPYEAV--------------
DDL_LEPIN       CKTLH---------TMGHSVKPILLTKDGGWVVPSEYRMSIPFEVS--------------
DDL_LEPIC       CKTLH---------TMGHSVKPILLTKDGGWVVPSEYRMSIPFEVS--------------
DDL_TROW8       LEHIC---------DEWTVIPVGITKHGDFVYCSTVSEQDYGEVIDNGNRVVWPSRA---
DDL_TROWT       LEHIC---------DEWTVIPVGITKHGDFVYCSTVSEQDYGEVIDNGNRVVWPSRA---
DDL_TREPA       ARTLC---------LQHTVMLIGITRRGVWYAQPACALEQLCTGTVALSIQEDEKRR---
DDL_NOSS1       ASALSAGE-----NASKYEILPFYIHKDGRWLAGEAPQQVLKSGAP-LLESSNSSPAENN
DDL_TRIV2       ASALSAGE-----NASKYEILPFYIHKDGRWLAGEAPQQVLKSGAP-LLESSNSSPADNN
DDL_TRIEI       ATALTKVQ-----NKEKYELIPIYIQKNGLWQPSDFSQKVLNSDHPSLLQLTNENNHDLN
DDL_SYNY3       AKALASDD-----NQTKYQVSPFYIQKNGVWLGPDVSQQVLDQGVP--------------
DDL_SYNP6       ASALADPS-----NRDRYQVLPFYIDKEGGWHSGETAAQVLANQKP--------------
DDL_SYNE7       ASALADPS-----NRDRYQVLPFYIDKEGGWHSGETAAQVLANQKP--------------
DDL_THEEB       AQAFAAGD-----NGDRYEVIPIYIEKDGRWRHTERVGIPEGTAPE--------------
DDL_PROM3       VGALRSEV-----NNNRFEVIAIYIDQRGRWWPAGVAEAVLKQGQPA----------KPE
DDL_PROMM       VGALRSEV-----NNNRFEVIAIYIDQRGRWWPAGVAEAVLKQGHPA----------KPE
DDL_SYNS3       INALQEGQ-----NRDHFEVVPLYIDQEGRWWPEHIANSVLEQKQPL----------AED
DDL_SYNSC       VRGLRSGE-----NTERYTVQPIYIDRDGRWWGTDLAEATLTSEVA-------------P
DDL_SYNS9       IHGLRSGE-----NSQRYRVIPFYIDQEGRWWGEAFANRVLASQKP-------------I
DDL_SYNPX       AKGLTLGA-----NRERYRVVLVYIDRDGRWWGPDLAGKVLSSGCPP----------ADS
DDL_PROMA       IHALKHPI-----NINKFDVISIYIDKKGKWWPSEIAEKVLESDPNF----------DKN
DDL_PROM1       YNALSHLS-----NKERYVARPVYIDKYGYWHDYIFSESILYDKKD--------------
DDL_PROMT       YNALRYLS-----NKERYIARPIYIDKYGYWHDYIFSESILFDKKD--------------
DDL_PROMS       FQAFKSEI-----NKERFTIRAFYINKYGDWLDSDSSEKILIDESKN----------KNT
DDL_PROM0       FKAFKAQI-----NRERFTVKAFYINKYGDWLDSDISEKILTGEIEN----------YKT
DDL_PROM9       FNAFNSEI-----NKQRFNVKAFYINKYGDWIDNDISVKILIGEIEH----------KKT
DDL_PROM2       FQAFNSEI-----NKKRFKVKSFYIDKYGDWLDNDLSEKILNDEIKS----------NNI
DDL_PROM5       FKALISRT-----NKELFRIKAFYINKHGVWIDSDLSLEILRENSGN----------NIF
DDL_PROMP       FKALISKT-----NINRFWVKAFYINKHGVWLDNDQSLVLLKEKRKN----------ETI
DDL_DEIGD       LAALP---------RDQFDVTPVVISPQGRWLPPTDTQRALETGEAV-------------
DDL_DEIRA       LAALP---------RDQFDVTPVVISKQGRWLPPTETQKALETGVSS-------------
DDL_BACLD       TKALD---------TEKFDIHPIYITEKGEWVRGPQLTEPVSNVKML-------------
DDL_BACSU       IKALN---------TEKFDIHPIYITEKGEWVRGARLTEPVSNVKML-------------
DDL_BACP2       TKALN---------TEKFDIHPIYITEEGEWLRGEKLTEPVSNVRML-------------
DDLB_BACCR      IKALN---------QDKFEIHPIYITEQGQWVRGERIEGEVTDVEAL-------------
DDL_GEOKA       MNAID---------PHKFDVIPIYITPEGQWIKGEQLTGPIEEIKQL-------------
DDL_GEOTN       MNAID---------PHKFDVIPIYITPEGQWIKGKRLTGTVEEVKQL-------------
DDL_LISMO       INALD---------LEKFEAAPIYITNEGEWIQGPLLSGKLDFVEQL-------------
DDL_LISMF       INALD---------LEKFEAAPIYITNEGEWIQGPLLSGKLDFVEQL-------------
DDL_LISIN       INALD---------LEKFEAEPIYITNEGEWVQGPLLSGKLDFVEQL-------------
DDL_LISW6       INALD---------LEKFEAEPIYITNEGEWVQGPLLTGKLDFVEQL-------------
DDL_STAAB       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAAC       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAA1       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAAM       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAAN       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAA8       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAAE       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAA3       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIKSTDEL-------------
DDL_STAAS       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIISTDEL-------------
DDL_STAAW       LNAID---------KDKYHVDIIYITNDGDWRKQNNITAEIISTDEL-------------
DDL_STAAR       LNAID---------KDKYHVDIIYITNDGDWRKQNNITTEIKSTDEL-------------
DDL_STAES       LNAID---------KERYQVDIIYITNDGEWKKKDNITQEIKNTDEL-------------
DDL_STAEQ       LNAID---------KERYQVDIIYITNDGEWKKKDNITQEIKNTDEL-------------
DDL_STAHJ       LNAID---------KERYLVDIIYITNDGLWKKKENITEEIKEIESL-------------
DDL_STAS1       LNAID---------KEQYQIDIIYITNDGAWKKKENIVDTINDIDSL-------------
DDL_ENTFA       LNAIY---------YKYYQVQLVFISKDGQWVKGPLLSERPQNKEVL-------------
DDL_ENTHA       LNAIY---------YTYYQVQLIFISKEGQWVKGPLLTEKPTSKEDL-------------
DDL_LACLM       MRAVN---------YSRFIVKTYFITKGGEFIKTQEFTDRPAEEE---------------
DDL_LACLA       MRAVN---------YSRFVVKTYFITKGGEFIKTQEFTDKPAEEE---------------
DDL_STRA1       MRAIN---------YDKFFVKTYFITQVGQFIKTQEFDEMPSSDE---------------
DDL_STRA3       MRAIN---------YDKFFVKTYFITQVGQFIKTQEFDEMPSSDE---------------
DDL_STRA5       MRAIN---------YDKFFVKTYFITQVGQFIKTQEFDEMPSSDE---------------
DDL_STRT2       MRAVD---------YNAFEVKTYFITQSGDFIKTQEFIETPGDDE---------------
DDL_STRT1       MRAVD---------YNAFEVKTYFITQSGDFIKTQEFIETPGDDE---------------
DDL_STRTD       MRAVD---------YNAFEVKTYFITQSGDFIKTQEFIETPGDDE---------------
DDL_STRP1       MRAVN---------YDKFLVKTYFITQMGQFIKTQQFSEKPSESE---------------
DDL_STRPM       MRAVN---------YDKFLVKTYFITQMGQFIKTQQFSEKPSESE---------------
DDL_STRPB       MRAVN---------YDKFLVKTYFITQMGQFIKTQQFSEKPSESE---------------
DDL_STRPC       MRAVN---------YDKFLVKTYFITQMGQFIKTQQFSEKPSESE---------------
DDL_STRP8       MRAVN---------YDKFLVKTYFITQMGQFIRTQQFSEKPSESE---------------
DDL_STRPG       MRAVN---------YDKFLVKTYFITQMGQFIRTQQFSEKPSESE---------------
DDL_STRPD       MRAVN---------YDKFLVKTYFITQMGQFIKTQQFSEKPSESE---------------
DDL_STRP3       MRAVN---------YDKFLVKTYFITQMGQFIKTQQFSEKPSESE---------------
DDL_STRP6       MRAVN---------YDKFLVKTYFITQMGQFIRTQQFSEKPSESE---------------
DDL_STRPF       MRAVN---------YDKFLVKTYFITQMGQFIKTQQFSEKPSESE---------------
DDL_STRMU       MRAIN---------YDNFLVKTYFITQAGDFIKTQEFDSQPSETD---------------
DDL_STRR6       MRAVD---------YDRFTVKTFFISQSGDFIKTQEFSHAPGQED---------------
DDL_STRP2       MRAVD---------YDRFTVKTFFISQSGDFIKTQEFSHAPGQED---------------
DDL_STRPN       MRAVD---------YDRFTVKTFFISQSGDFIKTQEFSHAPGQED---------------
DDL_CLOAB       LRNID---------TSKYDLFPIGITKKGEWFEYTGSADKIENG----------------
DDL_CLONN       LKNID---------LSKYDVYPIGITKDGKWFEYTGAIDKIESG----------------
DDLB_CLOTE      LKNIN---------RDKYEICPIGITKEGKWFQYTGDINNIKNG----------------
DDL_CALS8       MQNLD---------KEKYEIIPIGITKEGKWLLYTGKIEDLDSKWT--------------
DDL_CHLPD       AAVID---------PFRFQVLPLYITHEGKWFTGEFAENILQLDLA--------------
DDL_PELLD       AANID---------RDRYRVLAVYITRDGGWYAGGVAEQILKLDIA--------------
DDL_CHLCH       AAHLD---------TERFTLLPIYITHSGEWLCDGFARTLLTTNLA--------------
DDL_CHLTE       AAQID---------RNRYELSPLYIDRDGKWHASECSQQVLDTDIA--------------
DDL_COXBU       VNTLD---------AAKYLISVIFIDHVGRWYLIDQPEMFLAHSPD--------------
DDL_SOLUE       LAGLD---------CEKYETIEYFIDQNGKW------------SPG--------------
DDL_BACSK       VEAID---------KDRFDVTLIGIDKQGQWHINEASNFLLNADNPA-------------
DDL_OCEIH       VDAID---------SDKYDVYLLGIDKQGNWHVNDRSHYLINEEDPK-------------
DDLA_ECOLI      VDAID---------KSRFDVVLLGIDKQGQWHVSDASNYLLNADDPA-------------
DDLA_ECO57      VDAID---------KSRFDVVLLGIDKQGQWHVSDASNYLLNADDPA-------------
DDLA_SHIFL      VDAID---------KSRFDVVLLGIDKQGQWHVSDASNYLLNADDPA-------------
DDLA_ECOL6      VDAID---------KSRFDVVLLGIDKQGQWHVSDASNYLLNADDPA-------------
DDLA_SALTI      VDAID---------KTRFDVVLLGIDKAGQWHVNDAENYLQNADDPA-------------
DDLA_SALTY      VDAID---------KTRFDVVLLGIDKAGQWHVNDAENYLQNADDPA-------------
DDL_BAUCH       VETID---------ENKFEVVLFGIDKEGQWHINNKLNYLIYGENET-------------
DDLA_CHRVO      LQAID---------GERFEVSLIGVDKQGRWHASQASNFLLNADDPG-------------
DDLA_XANCP      LQALD---------PQRFEPVLIGIDKQGQWHLSAQESFLLDADDPS-------------
DDLA_PSESM      INAID---------RESYALTLIGVDKLGRWLRFDEADYLLNANDPA-------------
DDL_BLOFL       MKYIN---------KRFFEVVVLWISKQGDWYIVENDDMHIDFFVN--------------
DDL_WIGBR       INAID---------KKKYNIILIGVEKNGKIGIRSINNYILFKYNIN-------------
DDL_BIFAA       LRALD---------TDKFEAIPVGITKDGKWIVNGENPLGWSLDEG-LPTVEKTPGAK--
DDL_BIFLO       LGAMD---------TERFEPIPVGITKDGKWIINGEDPRGWNLDGGELPTVKITPESR--
DDL_CORGL       MAHLD---------PEKYDVIPVGITVDGAWVVGETDPQKLTLIDRTMPEVEHHE-----
DDL_CORGB       MAHLD---------PEKYDVIPVGITVDGAWVVGETDPQKLTLIDRTMPEVEHRE-----
DDL_COREF       IAHLD---------PEKYEVIPVGITTDGAWVVGESDPERLRLVDRTMPEVQRRE-----
DDL_MYCTU       LRNLD---------SRRFDVIAVGITPAGSWVLTDANPDALTITNRELPQVKSGSGT---
DDL_MYCTA       LRNLD---------SRRFDVIAVGITPAGSWVLTDANPDALTITNRELPQVKSGSGT---
DDL_MYCBP       LRNLD---------SRRFDVIAVGITPAGSWVLTDANPDALTITNRELPQVKSGSGT---
DDL_MYCBO       LRNLD---------SRRFDVIAVGITPAGSWVLTDANPDALTITNRELPQVKSGSGT---
DDL_MYCUA       LRNLD---------PRRFEVIAIGITPQGSWVLTDGNPDALAITDRRLPEVSSQSGT---
DDL_MYCLE       LRNLD---------RQRFDVVAVGITPEGTWMLTDPNPDALAIANRQLPAVSCESGI---
DDL_MYCSM       LRNLD---------PERFEVVAIGITPDGSWVLTDGRPETLAITDGKLPAVTEASGT---
DDL_MYCS2       LRNLD---------PERFEVVAIGITPDGSWVLTDGRPETLAITDGKLPAVTEASGT---
DDL_MYCSK       LRNLD---------PERFDVVAVGITPDGSWVLTDGRPETLAITDGRLPEVSAESGT---
DDL_MYCSS       LRNLD---------PERFDVVAVGITPDGSWVLTDGRPETLAITDGRLPEVSAESGT---
DDL_MYCSJ       LRNLD---------PERFDVVAVGITPDGSWVLTDGRPETLAITDGRLPEVSAESGT---
DDL_STRAW       LRAID---------RTKYDVLPIGITRDGRWALTADEPERMAITDRRTPSVEELAESNEG
DDL_STRCO       LAAID---------RTRYDVLPIGITRDGRWALTADEPERMAITERRTPDVEELAESTEG
DDLA_PSEPK      HAALM---------ALGHRVHCVGIDREGNWRYQGEPCQFPGAVDRSAPLISIRPGH---
DDL_LEGPC       LKHLD---------SEKYHIIPIAMDKSGRFHRHDYNDL-LACSDKLPVVTEKSTPL---
DDL_LEGPA       LKHLD---------SEKYHIIPIAMDKSGRFHRHDYNDL-LACSDKLPVVTEKSTPL---
DDL_LEGPL       LKHLD---------SEKYHIIPIAMDKSGRFHRHDYNDL-LACSDKLPVVTEKSTPL---
DDLA_BRADU      FRHLD---------RTRFEVIPVSIDKTGRWQWNDLRSLDQAHAAALPILPDAPEMR---
DDLA_BRUME      MNALD---------PAKYEAVPVFVTRAGQWLLSRFVN-GALEK-----PSSGAELC---
DDLA_BRUSU      MNALD---------PAKYEAVPVFVTRAGQWLLSRFVN-GALEK-----PSSGAELC---
DDLA_RHILO      LKAID---------RTRYEVVPIAISRDGRWRLQPSSE-AGADGAGAQVPEDGVEVA---
DDLB_BRADU      LRALN---------SDRYDVYLIGISRDGRWFACDSGNGAGTGSTALTISDEAPEIG---
DDL_VIBCB       EQQLNL--------IENVSVTRVEIKNEG-WVTNQGE-----------------------
DDL_VIBPA       EQQLNL--------IQNVKVTRVEIKNEG-WVTDQGE-----------------------
DDL_VIBVU       QQQLGL--------IENVNVLKVEIKNEG-WFDQKER-----------------------
DDL_VIBVY       QQQLGL--------IENVNVLKVEIKNEG-WFDQKER-----------------------
DDL_VIBCH       QQQLEL--------TPEFHVIRVEMKKEG-WFSEQGA-----------------------
DDL_AERHH       EKQLSL--------LPGVEVTRVEMFADR-WLSADGR-----------------------
DDL_SHEON       ETSLAK--------SEQFNVLRVVLDKFGQYQTAAGD-----------------------
DDL_LACBA       YDAMD---------KDRYNVSLFLLTRDGFVLSDAASRRVFDGEDEAT---------VAA
DDL_LACPL       YDAMD---------KNKYEIDLFLITKNGIVLSDAATRRVFDGEPEDQ---------VVA
DDL_LEUME       YNAIEA--------TDKYEIIVFAIAQNGFFLDTESSKKILALEDEQP---------IVD
DDL_LEUMM       YNAIEA--------TGKYEIIVFAIAQNGFFLDTESSKKILALEDEQP---------IVD
DDL_BORBU       YLALLD--------LNKYNIYPVYIDKCTGVWYLLDSVSDPPKPINTD------------
DDL_CALS4       IENMN---------KEKYEPIPVYVGRDGRWYTGKGLLDISNYKDIPSLLKKCEQVVLPP
DDL_THEM4       LSSID---------RKKYNVIPIYISKSGEWFTGKVLEDLETFKDFDKLEKKAKKIDSFS
DDL_CAMJE       KKVINQNL-EFIFCDEERRFYHIPSEKMNSKTFSTKAYKKEKELFIK-------------
DDL_WOLSU       KKILPALE-HFIFVDGNRDFYWIPASEMRSKHFADGIYKKNPKLFLR-------------
DDL_HELHP       KKVLGESIGNFIFLDSSHRFYLIPLDSMKSKLFSSGDYKKCTEIFLQ-------------
DDL_HELPY       KGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFAQIKEKKLPPLILT-------------
DDL_HELPJ       KGVLKDRIKYFIFLDENHYFYLIEESNMHSKYFAQIKEKKLPPLILT-------------
                   .                                                        

DDL_ACTP2       -------------------------------------------------IQRVFNILHGG
DDL_HAEDU       -------------------------------------------------IQRVFNILHGG
DDL_ACTSZ       -------------------------------------------------FERVFNILHGR
DDL_MANSM       -------------------------------------------------FERAFNILHGR
DDL_HAEI8       -------------------------------------------------FNRAFNILHGR
DDL_HAEIG       -------------------------------------------------FNRAFNILHGR
DDL_HAEIN       -------------------------------------------------FNRAFNILHGR
DDL_HAES1       -------------------------------------------------FDRVFNILHGR
DDL_PASMU       -------------------------------------------------FDRVFNILHGR
DDL_YERPE       -------------------------------------------------FDKVFIALHGR
DDL_YERPA       -------------------------------------------------FDKVFIALHGR
DDL_YERPN       -------------------------------------------------FDKVFIALHGR
DDL_YERPP       -------------------------------------------------FDKVFIALHGR
DDL_YERPS       -------------------------------------------------FDKVFIALHGR
DDL_YERP3       -------------------------------------------------FDKVFIALHGR
DDL_PHOLL       -------------------------------------------------FEKVFIALHGR
DDL_PECAS       -------------------------------------------------FTNVFIALHGR
DDLB_ECOLI      -------------------------------------------------FQKVFIALHGR
DDLB_SHIFL      -------------------------------------------------FQKVFIALHGR
DDLB_ECO57      -------------------------------------------------FQKVFIALHGR
DDLB_ECOL6      -------------------------------------------------FQKVFIALHGR
DDL_SALPA       -------------------------------------------------FQKVFIALHGR
DDLB_SALTI      -------------------------------------------------FQKVFIALHGR
DDLB_SALTY      -------------------------------------------------FQKVFIALHGR
DDL_BUCBP       -------------------------------------------------FTKAFIALHGR
DDL_BUCAP       -------------------------------------------------FDSAYIALHGT
DDL_BORBR       -------------------------------------------------FERVFIALHGR
DDL_BORPE       -------------------------------------------------FERVFIALHGR
DDL_BORPA       -------------------------------------------------FERVFIALHGR
DDL_BORA1       -------------------------------------------------FERVFIALHGR
DDL_RALSO       -------------------------------------------------FHRVVISLHGR
DDL_JANMA       -------------------------------------------------FDRVFIALHGR
DDL_NITEU       -------------------------------------------------FDRVFIALHGR
DDL_NITEC       -------------------------------------------------FDRAFIALHGR
DDLB_CHRVO      -------------------------------------------------FDCVFNILHGP
DDL_METFK       -------------------------------------------------FDRVFIALHGR
DDL_NEIMB       -------------------------------------------------FQTAFNILHGT
DDL_NEIMF       -------------------------------------------------FQTAFNILHGT
DDL_NEIMA       -------------------------------------------------FQTAFNILHGT
DDL_NEIG1       -------------------------------------------------FQTAFNILHGT
DDL_PSEE4       -------------------------------------------------IDRAFIILHGR
DDLB_PSEPK      -------------------------------------------------IDRAFIILHGR
DDL_PSEPF       -------------------------------------------------IDRAFIILHGR
DDLB_PSESM      -------------------------------------------------IDRAFIVLHGR
DDLB_PSEAE      -------------------------------------------------IDRAFIILHGR
DDL_SACD2       -------------------------------------------------PDRVFIALHGP
DDL_XANAC       -------------------------------------------------FDRVFNVLHGH
DDLB_XANCP      -------------------------------------------------FDRVFNVLHGH
DDL_XYLFA       -------------------------------------------------FDRVFNVLHGH
DDL_XYLFT       -------------------------------------------------FDRVFNVLHGH
DDL_RHIME       ------------------------------------------------RPDVVFNALHGP
DDL_SINMW       ------------------------------------------------RPDVVFNALHGP
DDLB_RHILO      ------------------------------------------------KPDVAFNALHGP
DDL_AGRFC       ------------------------------------------------RPDVAFNALHGP
DDLB_BRUME      ------------------------------------------------KPDVVFNALHGP
DDLB_BRUSU      ------------------------------------------------KPDVVFNALHGP
DDL_OCHA4       ------------------------------------------------KPDVAFNALHGP
DDL_CHESB       ------------------------------------------------KPDVAFNALHGP
DDL_BARHE       ------------------------------------------------QPDIAFNALHGP
DDL_BARQU       ------------------------------------------------QPDVAFNALHGP
DDL_BARBK       ------------------------------------------------RPTTVFNALHGP
DDL_GLUOX       ------------------------------------------------APDVVFNALHGP
DDL_GRABC       ------------------------------------------------APDVVFNALHGR
DDL_CAUVC       ------------------------------------------------KPDMVFNALHGE
DDL_RICB8       ------------------------------------------------KPDIVFNCLHGT
DDL_RICBR       ------------------------------------------------KPDIVFNCLHGT
DDL_RICCN       ------------------------------------------------KPDIVFNCLHGT
DDL_RICRS       ------------------------------------------------KPDIVFNCLHGT
DDL_RICM5       ------------------------------------------------KPDIVFNCLHGT
DDL_RICFE       ------------------------------------------------KPDIVFNCLHGT
DDL_RICPR       ------------------------------------------------NPDIVFNCLHGT
DDL_RICTY       ------------------------------------------------NPDIVFNCLHGT
DDL_FUSNN       ------------------------------------------------DYDLAYLVLHGG
DDL_THEMA       --------------------------------------------------DVVFNVLHGT
DDL_THEP1       --------------------------------------------------DVVFNVLHGT
DDL_PSELT       --------------------------------------------------EVVFNALHGH
DDL_FERNB       --------------------------------------------------DALFNILHGT
DDL_AQUAE       --------------------------------------------------DKVFIALHGR
DDL_CARHZ       -------------------------------------------------IDFAFIALHGK
DDL_MOOTA       -------------------------------------------------PDVVFNALHGK
DDL_SYNJB       ------------------------------------------------GCDFVWIALHGP
DDL_SYNJA       ------------------------------------------------GCDFVWIALHGP
DDL_GLOVI       -------------------------------------------------PDFVWIALHGD
DDL_MAGMM       -------------------------------------------------IEVAVLALHGP
DDL_DESVH       ----------------------ASSH------------------------DFAFINLHGS
DDL_DESVV       ----------------------ASSH------------------------DFAFINLHGS
DDL_DESAG       ----------------------AQAH------------------------DFAFLNLHGQ
DDL_LAWIP       ----------------------AEKQ------------------------DVAFILLHGS
DDLA_PSEAE      ----------------------SGKQSLLS-------------AGELAGVDVFFLALHGG
DDL_BACAN       -------------------------------------------IEKAKDIDFALLALHGK
DDLA_BACCR      -------------------------------------------IEKAKDIDFALLALHGK
DDLA_CLOTE      -------------------------------------------IDKIKCLEFAFIALHGN
DDL_CLOB1       -------------------------------------------MEKAKGIDFAFLALHGK
DDL_CLOBH       -------------------------------------------MEKAKGIDFAFLALHGK
DDL_CLOBL       -------------------------------------------MEKAKGIDFAFLALHGE
DDLA_CLOPE      -------------------------------------------IEKVKGIDFALLALHGK
DDL_CLOPS       -------------------------------------------IEKVKGIDFALLALHGK
DDLB_CLOPE      -------------------------------------------LEKVKGLDFALLALHGK
DDL_LACSS       ----------------------TDDDINKLREDGSTQLFGPNVLEICKTADIVFLALHGG
DDL_PEDPA       ----------------------TEEDIEELRTDGTVGLFGKNVLPILQAADFVFLALHGG
DDL_BACFR       ------------------------------------NDFSFINGAEKVVFDFAYITIHGT
DDL_BACFN       ------------------------------------NDFSFMNGAEKVVFDFAYITIHGT
DDL_BACTN       ------------------------------------NDFSFMLGTEKIRFDFAYITIHGT
DDL_BACV8       ------------------------------------NDFSFMENGEKKQFDFAYITIHGT
DDL_PORGI       ------------------------------------NDFSFDLDGERIRFDYAYITIHGT
DDL_LEPBJ       -----------------------NSSDLFEEEFQKTNGVSKMDFISNLDADIVFLGLHGG
DDL_LEPBL       -----------------------NSSDLFEEEFQKTNGVSKMDFISNLDADIVFLGLHGG
DDL_LEPIN       -----------------------NSPDLFQEEFQKRYGVSRTNQIFSLDADIVFLGLHGG
DDL_LEPIC       -----------------------NSPDLFQEEFQKRYGVSRTNQIFSLDADIAFLGLHGG
DDL_TROW8       ----------------------GCKKIEVVQARG---------KSFFVEFDLVFPLLHGV
DDL_TROWT       ----------------------GCKKIEVVQARG---------KSFFVEFDLVFPLLHGV
DDL_TREPA       ----------------------VCLVPGGGTAGAF------VIAGMPCVTDVVFPVLHGS
DDL_NOSS1       LVNSQQQTLERWQSPS-----------------------------QVAEVDVWFPILHGP
DDL_TRIV2       LVNSQQQTLERWQSPS-----------------------------QVAEVDVWFPILHGP
DDL_TRIEI       TSLTQQSSSPLWQIPP-----------------------------QAAQVDVWFPILHGP
DDL_SYNY3       WGDQPVTAGQRWQFPP-----------------------------EAARMEVWFPILHGP
DDL_SYNP6       --LFVEEPSDRWQFPA-----------------------------DCRDVEVWFPILHGP
DDL_SYNE7       --LFVEEPSDRWQFPA-----------------------------DCRDVEVWFPILHGP
DDL_THEEB       --------SSLWQFPA-----------------------------VVDTIDVWFPIVHGP
DDL_PROM3       QLSTPLAPQGFTKLPE-----------------------------GSERVQVWYPVLHGP
DDL_PROMM       QLSTPLAPQGFTKLPE-----------------------------GSERVQVWYPVLHGP
DDL_SYNS3       SLPHPLPPAGFRSLPI-----------------------------DNDRVDVWFPVLHGP
DDL_SYNSC       ELTTPRPPSGFQGFPE-----------------------------GCDAIDLWYPVLHGP
DDL_SYNS9       EPPHSIETKGFRELPE-----------------------------GSETVQVWYPVLHGP
DDL_SYNPX       DLPQPLPAPGFRGLPA-----------------------------GTDVVAVWYPVLHGP
DDL_PROMA       IFFKQVEFIGLDHLPK-----------------------------ETEKIQIWFPVLHGP
DDL_PROM1       HLIFEDRRVNLTNLS------------------------------NMEDIDVWFPCLHGP
DDL_PROMT       HLIFEERRINLTNLS------------------------------NMEDIDVWFPCLHGP
DDL_PROMS       TKKQIFNQEKINFLDGV----------------------------DFQNVDVWFPLLHGI
DDL_PROM0       KKQEIFNQEKINFLDGI----------------------------EFQNIDVWFPLLHGF
DDL_PROM9       KKQELFNQKKINFLDGI----------------------------EFQNIDIWFPLLHGF
DDL_PROM2       KKQEIVNQQKINFLDGI----------------------------EFQNIDVWFPLLHGL
DDL_PROM5       EKYQELPNRKINFLNNL----------------------------EFQNIDIWFPLLHGC
DDL_PROMP       DKNQVFPKREINFLNTI----------------------------EFQGIDIWFPLLHGV
DDL_DEIGD       ------RGGDLVLHRAA----------------------------SAEGYDAVFPLLHGP
DDL_DEIRA       ------QGGDLMLHRAA----------------------------AAEGYDAVFPLLHGP
DDL_BACLD       -QFEQTGQTFSPAVLN-----RDMFPGEADAK--------------EDSIDVVFPLLHGP
DDL_BACSU       -QFEQGGSAFSPAALN-----QEMFPQEASQQ--------------NEAIDVVFPLLHGP
DDL_BACP2       -QFEQNAKTFLPTSLN-----ESMFPQPTSA---------------DEKIDVVFPLLHGP
DDLB_BACCR      -KMSGAENAISPLSLS-----TEIIPSAASE---------------ENAIDVIFPLLHGP
DDL_GEOKA       -QFTSAATALIPVSLN-----QVPAADSAAGGN-------------EETIDVIFPLLHGP
DDL_GEOTN       -QFTSTATAMIPVSLN-----QVPASGSATESD-------------EETIDVIFPLLHGP
DDL_LISMO       -RFSATDTIKLATTES-----EKSEGEAISPAVL----------EADGQETVVFPLLHGP
DDL_LISMF       -RFSATDTIKLATTES-----EKSEGEAISPAVL----------EADGQETVVFPLLHGP
DDL_LISIN       -RFSATDRVKLATAES-----EKSEGEAISPAVL----------EADGQETVVFPLLHGP
DDL_LISW6       -RFSATNTVKLAATES-----EKSEGEAISPAVL----------EADDQETVVFPLLHGP
DDL_STAAB       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAAC       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAA1       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAAM       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAAN       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAA8       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAAE       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAA3       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAAS       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAAW       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAAR       -HLENGEALEISQLLK-----ESSSG---------------------QPYDAVFPLLHGP
DDL_STAES       -VINDVETGEISQLLS-----KGSLG---------------------KSYDAVFPLLHGP
DDL_STAEQ       -VINDVETGEISQLLS-----KGSLG---------------------KSYDAVFPLLHGP
DDL_STAHJ       -NMTDIEAGEITILLK-----ESSNG---------------------KPYDAIFPLLHGP
DDL_STAS1       -RLIDVEAGEISKLLS-----QGSTG---------------------NAYSAVFPLLHGP
DDL_ENTFA       -HLTWAQTPEETGEFSGKRISPSEIY---------------------EEEAIVFPVLHGP
DDL_ENTHA       -HLTWDPSGKVTDGFTGRVINPGEIK---------------------EEGTIVFPVLHGP
DDL_LACLM       -KLLTNDLAESYPKIS-----PAAIY---------------------EKDAVVFPVLHGP
DDL_LACLA       -KLLTNDLAESYPKIS-----PAAIY---------------------EKAAVVFPVLHGP
DDL_STRA1       -KLMTNQTVDLDKMVR-----PSDIY---------------------DDNAIVFPVLHGP
DDL_STRA3       -KLMTNQTVDLDKMVR-----PSDIY---------------------DDNAIVFPVLHGP
DDL_STRA5       -KLMTNQTVDLDKMVR-----PSDIY---------------------DDNAIVFPVLHGP
DDL_STRT2       -KLMTNDTVEASQAIK-----PSDIY---------------------EEDAVVFPVLHGP
DDL_STRT1       -KLMTNDTVEASQAIK-----PSDIY---------------------EEDAVVFPVLHGP
DDL_STRTD       -KLMTNDTVEASQAIK-----PSDIY---------------------EEDAVVFPVLHGP
DDL_STRP1       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRPM       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRPB       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRPC       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRP8       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRPG       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRPD       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRP3       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRP6       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRPF       -RLMTNETIELTQKIK-----PSDIY---------------------EEGAVVFPVLHGP
DDL_STRMU       -KLMTNDTIIASQKIK-----PSDIY---------------------EEEAVVFPVLHGP
DDL_STRR6       -RLMTNETIDWDKKVA-----PSAIY---------------------EEGAVVFPVLHGP
DDL_STRP2       -RLMTNETIDWDKKVA-----PSAIY---------------------EEGAVVFPVLHGP
DDL_STRPN       -RLMTNETIDWDKKVA-----PSAIY---------------------EEGAVVFPVLHGP
DDL_CLOAB       -EWEKDEFYKSPNGQAILFNK---------------------------EVDVVFPVMHGL
DDL_CLONN       -EWEKDEFYKNPNGQEILFNR---------------------------EVDVVFPVMHGL
DDLB_CLOTE      -QWEKDNKNKLENGYNVLFNK---------------------------EVELVFPVLHGL
DDL_CALS8       -MYSIECFISPDRTKKALVKIKDSEA-------------------TFIDIDVVFPVLHGL
DDL_CHLPD       -EMLRSTSLDATGNTLRQMAMHTGQQGF---DFD----------FFKAGIDLAFIALHGS
DDL_PELLD       -DLIRTTSLEATAATLREMVAASAEPPF---NFD----------F--RGIDVAFPVLHGS
DDL_CHLCH       -SKLRGSSREETAAALQQMVRNAAQAPC---NRN----------LAALGVDVAFLALHGS
DDL_CHLTE       -ALLRSGTPESAGKRLDELTAAAAGECF---DFG----------SFLKNTDVAFIALHGS
DDL_COXBU       -HLVKEGSARPITIAFGDAAKPWQSL-----NGD----------GRRYSADCVFPMVHGT
DDL_SOLUE       -PILPE---------------------------P----------GAHANIDVVFPVLHGT
DDL_BACSK       -LIELNKSNQGVALIP-----GKEDRQLVGTANQ----------SVLDQLDVVFPIVHGT
DDL_OCEIH       -LISLNKTNEGIAVIP-----GAEKNQIVTSNST----------KSLDQLDVIFPIVHGT
DDLA_ECOLI      -HIALRPSATSLAQVP-----GKHEHQLIDAQNG----------QPLPTVDVIFPIVHGT
DDLA_ECO57      -HIALRPSATSLAQVP-----GKHEHQLIDAQNG----------QPLPTVDVIFPIVHGT
DDLA_SHIFL      -HIALRPSATSLAQVP-----GKHEHQLIDAQNG----------QPLPTVDVIFPIVHGT
DDLA_ECOL6      -HIALRPSATSLAQVP-----GKHEHQLIDAQNG----------QPLPTVDVIFPIVHGT
DDLA_SALTI      -HIALRPSAISLAQVP-----GKHQHQLINAQNG----------QPLPTVDVIFPIVHGT
DDLA_SALTY      -HIALRPSAISLAQVP-----GKHQHQLINAQNG----------QPLPTVDVIFPIVHGT
DDL_BAUCH       -YIALNKSNKHIAIIP-----GRKHDQFIQIDML----------EQLVQLDVIFPIVHGT
DDLA_CHRVO      -RIALRESGENLALVP-----GECSGQLQTAANA----------HPLAQIDVAFPIVHGT
DDLA_XANCP      -RIALRHSGRGLAVLP-----GAASAQLRAVDAE----------QALAQIDVVFPIVHGT
DDLA_PSESM      -RIKLSGSGKQLSLLP-----GSVGGQFVEVESG----------KPLAAIDVVFPLIHGA
DDL_BLOFL       -KENLHKCMPILMFSS-----GNR-----CFEYI----------NNILSLDVIFPIIHGA
DDL_WIGBR       -YIKLAPAVSYLYIIP-----GKNNYQFYSLKN-----------KKMLKIDVIFSILHGS
DDL_BIFAA       DVVLEVALGQDGFFARE-------DDG---------------TMTPFGHVDAVFPVLHGP
DDL_BIFLO       PVMLDPSRGQDGFFIGEPSHINSADSGFGTSFVSMSDPEMHHVLTSLGHVDAVLPVLHGP
DDL_CORGL       EVRPSLDPAHRGEFHFS---DG----------------------SLYATADVIFPVLHGR
DDL_CORGB       EVRPSLDPAHRGEFHFS---DG----------------------SLYATADVIFPVLHGR
DDL_COREF       EIRPSLDPAHRGEFHFA---DG----------------------SLYATADVIFPVLHGR
DDL_MYCTU       ELALPADPRRGGQLVSLPPGAG----------------------EVLESVDVVFPVLHGP
DDL_MYCTA       ELALPADPRRGGQLVSLPPGAG----------------------EVLESVDVVFPVLHGP
DDL_MYCBP       ELALPADPRRGGQLVSLPPGAG----------------------EVLESVDVVFPVLHGP
DDL_MYCBO       ELALPADPRRGGQLVSLPPGAG----------------------EVLESVDVVFPVLHGP
DDL_MYCUA       ELALPADPRWGGQLVSLPPGAG----------------------EVLASVDVVFPVLHGP
DDL_MYCLE       ELTLPADPRRSGQLVSLSHGAGL------------------GAGEVLTSVDVVFPVLHGP
DDL_MYCSM       ELALPAAPNRSGQLLALGNGP----------------------GEILAAVDVVFPVLHGP
DDL_MYCS2       ELALPAAPNRSGQLLALGNGP----------------------GEILAAVDVVFPVLHGP
DDL_MYCSK       ALALPADPGRRGELVSLSPAAA---------------------GEVLAAVDVVFPVLHGP
DDL_MYCSS       ALALPADPGRRGELVSLSPAAA---------------------GEVLAAVDVVFPVLHGP
DDL_MYCSJ       ALALPADPGRRGELVSLSPAPA---------------------GEVLAAVDVVFPVLHGP
DDL_STRAW       GVILPVDPANREVVYSEPGSVP----------------------KALGEVDVVFPVLHGP
DDL_STRCO       GVLLPVDPANREVVYSEPGSVP----------------------KALGEVDVVFPVLHGP
DDLA_PSEPK      -RSLSYTTQESG--------------------------------TVEIGIDLLFPALHGR
DDL_LEGPC       ---EGLLINGR----------------------------------LAVDAEIVFPVVHGP
DDL_LEGPA       ---EGLLINGR----------------------------------LAVDAEIVFPVVHGP
DDL_LEGPL       ---EGLLINGR----------------------------------LAVDAEIVFPVVHGP
DDLA_BRADU      ---LARGPDGRGVLVPITQGAA-----------------------APIAIDVVFPVIHGP
DDLA_BRUME      ---LVPGGCGRAIVVPDAGAPY-----------------------EADKIDIIFPVLHGL
DDLA_BRUSU      ---LVPGGCGRAIVVPDAGAPY-----------------------EADKIDIIFPVLHGL
DDLA_RHILO      ---LLPGGKGRLVALTKNGE-------------------------QPDPVDVVFPVLHGP
DDLB_BRADU      ---LVPGGRGRLVHCDGPTGS------------------------DAGSIDVAFPILHGP
DDL_VIBCB       --LVYLDPNQKKLCSD----------------------------NLSLDVDFIVPCIHGF
DDL_VIBPA       --LVYLDLNTKQLCSN----------------------------ESNQTIDFIVPCIHGF
DDL_VIBVU       --LVYLDIHTKSVKSDEF--------------------------NESIHIDFIVPCIHGF
DDL_VIBVY       --LVYLDIHTKSVKSDEF--------------------------NESIDIDFIVPCIHGF
DDL_VIBCH       --LVYLDTNSATLNSD----------------------------KASYPIDFVVPCIHGF
DDL_AERHH       --ECKLGLD-KLLSFD----------------------------SVARPVDYVVPCIHGY
DDL_SHEON       --DCELTNNREIRFRDES--------------------------KAPWPVDYVIPCIHGY
DDL_LACBA       EEQAKVDASNPLAPIWNL--------------------------SQAKDIDVFFPIIHGN
DDL_LACPL       EEMPKLDMSDPLAPIKNL--------------------------TLAKDIDIFYPVVHGN
DDL_LEUME       AFMKTVDTSDPLARIHAL--------------------------KSAGDFDIFFPVVHGN
DDL_LEUMM       AFMKTVDASDPLARIHAL--------------------------KSAGDFDIFFPVVHGN
DDL_BORBU       -VLPIVSLLPGFGIFSN---------------------------NKNLEIDVVFPVVHGR
DDL_CALS4       VPGLNKLYYYPFRKKFMSK------------------------EYDYIDVDVIFPAFHGT
DDL_THEM4       VKNNKLLLKYGLKKQ---------------------------------TIDFCFLVFHGT
DDL_CAMJE       ----QGGFFSKGFLKE-----------------------------NKLECECVINLIHGR
DDL_WOLSU       ----PGGFYAKGLWGE-----------------------------KRVPFDTALNLIHGG
DDL_HELHP       ----RGAFVKKTFFGF-----------------------------KPIIPHTLINLIHGA
DDL_HELPY       ----HNGLLKNSFLGA-----------------------------KIIELPLVINLVHGG
DDL_HELPJ       ----HNGLLKNSFLGA-----------------------------KIIELPLVINLVHGG
                                                                        .** 

DDL_ACTP2       --IGENGVLQGALEQMGIPYTGCGVMASAVTLDKFRTKLMWQ----AVGL---------P
DDL_HAEDU       --IGENGVLQGALEQMGIPYTGCGVMASAITLDKFRTKLLWN----AVGL---------P
DDL_ACTSZ       --GGEDGVIQGVLEQIGLPYTGCGVMTSALTMDKMRTKMLWK----GFGL---------P
DDL_MANSM       --GGEDGVIQGVLEQIGLPYTGCGVMTSALTMDKMRTKMLWK----GFGL---------P
DDL_HAEI8       --GGEDGTMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWK----AFGL---------P
DDL_HAEIG       --GGEDGTMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWK----AFGL---------P
DDL_HAEIN       --GGEDGTMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWK----AFGL---------P
DDL_HAES1       --GGEDGTIQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWK----AFGL---------P
DDL_PASMU       --GGEDGTMQGLLEQIGIPYTGCGVMTSALTMDKMRTKMLWK----AFGL---------P
DDL_YERPE       --GGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQ----ALGL---------P
DDL_YERPA       --GGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQ----ALGL---------P
DDL_YERPN       --GGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQ----ALGL---------P
DDL_YERPP       --GGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQ----ALGL---------P
DDL_YERPS       --GGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQ----ALGL---------P
DDL_YERP3       --GGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQ----ALGL---------P
DDL_PHOLL       --GGEDGTLQGVLEFLQLPYTGSGVMASALSMDKLRTKQVWQ----GIGL---------T
DDL_PECAS       --GGEDGTLQGVLEFLGLPYTGSGVMASALTMDKLRTKQVWQ----AVGL---------P
DDLB_ECOLI      --GGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQ----GAGL---------P
DDLB_SHIFL      --GGEDGTLQGMLELMGLPYTGSGVMASALSIDKLRSKLLWQ----GAGL---------P
DDLB_ECO57      --GGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQ----GAGL---------P
DDLB_ECOL6      --GGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQ----GAGL---------P
DDL_SALPA       --GGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQ----GAGL---------P
DDLB_SALTI      --GGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQ----GAGL---------P
DDLB_SALTY      --GGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQ----GAGL---------P
DDL_BUCBP       --DGEDGTIQSVLKYLNIPFTGSKTLPSAISINKFKTKLLWQ----SFNL---------P
DDL_BUCAP       --GGEDGSIQGILEYLNIPYTGSGIMSSAISLDKWRTKLLWK----SLSL---------R
DDL_BORBR       --YGEDGTLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWL----QHGL---------P
DDL_BORPE       --YGEDGTLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWL----QHGL---------P
DDL_BORPA       --YGEDGTLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWL----QHGL---------P
DDL_BORA1       --FGEDGAIQGALELLNIPYTGSGVTASALAMDKIMTKRVWL----QHGL---------P
DDL_RALSO       --FGEDGTIQGLLEQFGIPYTGSGVLASALAMDKEATKRLWQ----THSL---------P
DDL_JANMA       --FGEDGSLQGALEQLGIPYTGPGVMASAIAMDKVITKRVCL----SHGV---------P
DDL_NITEU       --YGEDGSVQGALELMELPYTGSGILASALAMDKWRTKMIWQ----AAGI---------N
DDL_NITEC       --YGEDGSVQGALELMDLPYTGSGILASALAMDKWRTKMIWQ----AAGI---------S
DDLB_CHRVO      --FGEDGTLQGALEALGMPYTGCGVMASAIAMDKWRTKLLWK----GAGL---------P
DDL_METFK       --YGEDGTIQGALELMGIPYTGSGVMASSVGMDKWRTKLLWR----AAGV---------V
DDL_NEIMB       --YGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQ----ALGL---------P
DDL_NEIMF       --YGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQ----ALGL---------P
DDL_NEIMA       --YGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQ----ALGL---------P
DDL_NEIG1       --YGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQ----ALGL---------P
DDL_PSEE4       --GGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ----SLGI---------P
DDLB_PSEPK      --GGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ----SLGI---------P
DDL_PSEPF       --GGEDGSMQGLLEVAGIPYTGSGILASALAMDKLRTKQVWH----TLGI---------P
DDLB_PSESM      --GGEDGTMQGLLECLEIPYTGSGVLASALAMDKLRTKQVWQ----SLGP---------A
DDLB_PSEAE      --GGEDGSMQGLLECAGIPYTGSGVLASALAMDKLRTKRVWL----SLGL---------P
DDL_SACD2       --GGEDGKMQAVLDWLAIPYTGSDHAASALAMDKLKTKQVWQ----SVGL---------V
DDL_XANAC       NGGGEDGIVQGLMEAFGVPYTGSDVLGSALSMDKIRTKQVWL----SLGL---------S
DDLB_XANCP      NGGGEDGIVQGLMEAFGVPYTGSNVLGSALSMDKIRTKQVWL----SLGL---------S
DDL_XYLFA       NGGGEDGVVQGLMQAFGVPYTGSDVLGSALSMDKVRTKQVWL----ALGL---------P
DDL_XYLFT       NGGGEDGVVQGLMQAFGVPYTGSDVLGSALSMDKVRTKQVWL----ALGL---------P
DDL_RHIME       --FGEDGTIQGILEYLEIPYTHSGVLASALAMDKDQAKHVAK----AAGI---------P
DDL_SINMW       --FGEDGTIQGILEYLEIPYTHSGVLASALAMDKAQAKHVAK----AAGI---------P
DDLB_RHILO      --FGEDGTIQGILEYLGIPYTHSGVLASALAMNKEQAKKIVK----TVGV---------P
DDL_AGRFC       --FGEDGTIQGILEYLAIPYTHSGVLASALAMDKAQAKKVAA----AAGI---------P
DDLB_BRUME      --FGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAA----AAGV---------V
DDLB_BRUSU      --FGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAA----AAGV---------V
DDL_OCHA4       --FGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAA----AAGV---------A
DDL_CHESB       --FGEDGTVQGVLEYLGIPYTHSGVLASALAMDKDLAKTVAK----SAGI---------P
DDL_BARHE       --FGEDGRIQGVLEYLKIPYTHSGVMASALAMDKGRAKIVVA----SVGV---------S
DDL_BARQU       --FGEDGCIQGVLEYLKIPYTHSGVMASALAMDKGRAKIVVA----SVGV---------S
DDL_BARBK       --FGEDGCIQGILEYLKIPYTHSGVMASALAMDKGRAKIIAA----SAGV---------S
DDL_GLUOX       --RGEDGAIQGVLEWLGLPYTHSGIRASAVAMDKGATRILLA----AAGL---------P
DDL_GRABC       --FGEDGAIQGVLDWLNIPYTHSGVRASAIAMDKAAARTAFL----AAGL---------P
DDL_CAUVC       --WGEDGCVQGVLETLKLPYTHSGVLASALAMDKAKAKAVLA----AAGV---------T
DDL_RICB8       --YGEDGCLPGLLNIMRIPYTHSGVLASSLAFDKVHSRSWFL----TNNI---------N
DDL_RICBR       --YGEDGCLPGLLNIMRIPYTHSGVLASSLAFDKVHSRSWFL----TNNI---------N
DDL_RICCN       --YGEDGCLPGLLNIMRIPYTHSGVLSSALAFDKIHSRIWFL----TNNI---------N
DDL_RICRS       --YGEDGGLPGLLNIMRIPYTHSGVLSSALAFDKIHSRIWFL----TNNI---------N
DDL_RICM5       --YGEDGCLPGLLNIMRIPYTHSGMLSSALAFNKIHSRSWFL----TNNI---------N
DDL_RICFE       --YGEDGCLPGLLNIMRIPYTHSGVLSSALAFDKIHSRSWFL----TNNI---------N
DDL_RICPR       --YGEDGCLPGLLNIMRIPYTHSGLLSSALAFDKIHFRSCVL----KNNI---------N
DDL_RICTY       --YGEDGCLPGLLNIMRIPYTHSGVLSSALAFDKIHSRSCFL----KNNI---------N
DDL_FUSNN       --NGENGKIQAVLDILGKKYTGSGVLASAITMDKDKTKQIAQ----SVGI---------K
DDL_THEMA       --FGEDGTLQAILDFLGIRYTGSDAFSSMICFDKLVTYRFLK----GTVE----------
DDL_THEP1       --FGEDGTLQAILDFLGIRYTGSDAFSSMICFDKLATYRFLK----DIVE----------
DDL_PSELT       --FGEDGTVQAILDWVGVSYTGSKVLASAICFDKVMTYRVLD----GYVN----------
DDL_FERNB       --FGEDGKMQAILDSIGIPYTGSGVETSVIAFDKYLCNLFVE----NTIERYEELSV-VK
DDL_AQUAE       --YGEDGTVQGLLEILDIPYTGSDTIASAVSIDKDFTKRIVK----SLGI---------N
DDL_CARHZ       --YGEDGAIQGLLEIMDIPYTGSGILASSLAIDKIMTKKILK----AEGI---------P
DDL_MOOTA       --PGEDGSVQGLLEVLGLPYTGSRVLASAITMDKIMTKRVLL----QAGI---------P
DDL_SYNJB       --GGEDGVVQGMLDWLGLPYQGSGPLASALAMDKLVSKQIFR----AAGI---------P
DDL_SYNJA       --GGEDGVVQGMLEWLGLPYQGSGPLASALAMDKLVSKQIFR----AEGI---------P
DDL_GLOVI       --KGENGKLQGLLDWLGLPYNGSGVTASAIAMDKVVSKRLFV----AEGI---------P
DDL_MAGMM       --MGEDGTIQGLLEFMGIPYTGPNVAASAICMDKGLSKRLFH----SEGL---------P
DDL_DESVH       --PGEDGLVQAMLDTAGCPYQGSGPAGSFLALNKAVSKQLLR----RHGI---------L
DDL_DESVV       --PGEDGLVQAMLDTAGCPYQGSGPAGSFLALNKAVSKQLLR----RHGI---------L
DDL_DESAG       --PGEDGLVQALLETAGVPYQGSGPAGSFLALNKAAAKEVFV----RNGL---------P
DDL_LAWIP       --PGEDGILQALLERVGCPYQGASPAGSLLALHKAAAKALFR----REGL---------L
DDLA_PSEAE      --TGEDGTLQALLDAGGFAYTGSGHLASAMAMDKDVAKRLFL----AAGV---------E
DDL_BACAN       --YGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILR----YEGI---------E
DDLA_BACCR      --YGEDGTVQGTLESLGIPYSGSNMLSSSICMDKNISKKILR----YEGV---------E
DDLA_CLOTE      --FGEDGKVQALLETMGVPYSGSGVLASSLCMDKNMSKKILQ----GEGI---------K
DDL_CLOB1       --FGEDGTVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILK----YANI---------N
DDL_CLOBH       --FGEDGTVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILK----YANI---------N
DDL_CLOBL       --FGEDGTVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILK----YANI---------N
DDLA_CLOPE      --FGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILA----FGNV---------R
DDL_CLOPS       --FGEDGTVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILA----FGNV---------R
DDLB_CLOPE      --FGEDGTVQAFLDIMDIPYSGCGALSSSLCMDKNLSKKVLK----AENI---------R
DDL_LACSS       --DGENGKVQAVLDVFEIPYTGSDTLAAGITMSKKVSKEILL----FNNI---------P
DDL_PEDPA       --DGENGKVQAVLDLNHIKYTGSGSLASGIAMDKAISKEIML----YNNI---------K
DDL_BACFR       --PGEDGRLQGYFDMMRIPYSCCGVLAAAITYDKFVCNQYLKAFGV-------------R
DDL_BACFN       --PGEDGRLQGYFDMIRIPYSCCGVLAAAITYDKFVCNQYLKAFGV-------------R
DDL_BACTN       --PGEDGRLQGYFDMMHIPYSCCGVLAAAITYDKFTCNQYLKAFGV-------------R
DDL_BACV8       --PGENGILQGYFDLLGIPYSSCNVLVSAMTFNKFTCNQYLKGFGI-------------R
DDL_PORGI       --PGENGLLQGYLDMIGIPYNTGDTLVESLTFNKYVCNRFLSGFGI-------------R
DDL_LEPBJ       --KGEDGSIQGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSGQ-------------K
DDL_LEPBL       --KGEDGSIQGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSGQ-------------K
DDL_LEPIN       --QGEDGTIQGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSGQ-------------K
DDL_LEPIC       --QGEDGTIQGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSGQ-------------K
DDL_TROW8       --FGEDGTIQGMLDLLDIPYVGSGVFASAAAMDKHYTKILCS----HAGI---------P
DDL_TROWT       --FGEDGTIQGMLDLLDIPYVGSGVFASAAAMDKHYTKILCS----HAGI---------P
DDL_TREPA       --YGEDGTVQGLLEMLQVPYVGCGVCASALAMDKVKAKMLWQ----AAGL---------P
DDL_NOSS1       --NGEDGTIQGLLTLMQTPFVGSGVLGSALGMDKIAMKMAFEQAG-------------LP
DDL_TRIV2       --NGEDGTIQGLLTLMQTPFVGSGVLGSALGMDKIAMKMAFEQAG-------------LP
DDL_TRIEI       --NGEDGTIQGLLKLMQVPFVGSGVLGSAMGMDKIAMKIAFDHAG-------------LP
DDL_SYNY3       --NGEDGTVQGLFSLMQVPYVGSGVLGSCVGMDKLAMKMVFERAG-------------LP
DDL_SYNP6       --NGEDGTIQGLLTLMQRPFVGSGVLGSALGMDKIAMKQAFAQAS-------------LP
DDL_SYNE7       --NGEDGTIQGLLTLMQRPFVGSGVLGSALGMDKIAMKQAFAQAS-------------LP
DDL_THEEB       --NGEDGTIQGLLELMQRPYVGSGVAASAIGMDKILMKTVFGAIG-------------LP
DDL_PROM3       --NGEDGTVQGLFTLMGQPFVGSGVLGSALSMDKLAMKAAFAAAG-------------LP
DDL_PROMM       --NGEDGTVQGLFTLMGQPFVGSGVLGSALSMDKLAMKAAFAAAG-------------LP
DDL_SYNS3       --NGEDGTVQGLFTLMGQPYVGSGVLGSAVGMDKLAMKAAFAAAG-------------LP
DDL_SYNSC       --NGEDGTIQGLFQLTGKPFVGAGVLGSAVSMDKQAMKSAFSSAG-------------LS
DDL_SYNS9       --NGEDGTVQGLFQLMRQPFVGAGVLGSAVSMDKLAMKAAFAGAG-------------LS
DDL_SYNPX       --NGEDGTIQGLFELMQQPYVGAGVLGSAVSMDKQAMKAALAGAG-------------LA
DDL_PROMA       --NGEDGSIQGFFQLTGKPYVGSGVLGSALGMDKIAMKAAFSAAG-------------LP
DDL_PROM1       --NGEDGVIQGLFKSTGKPFVGSGVLGSALGMDKIAMKSVFKSYN-------------LP
DDL_PROMT       --NGEDGVIQGLFKSTGKPFVGSGVLGSALGMDKIAMKSVFKSYN-------------LP
DDL_PROMS       --NGEDGSIHGLLRFTKKPLVGCGIIGSALGMDKILMKIIFSNLK-------------IP
DDL_PROM0       --NGEDGSIHGLIRFTKKPLVGCGIIGSALGMDKILMKTIFSNHK-------------LP
DDL_PROM9       --NGEDGSIHGLLKFTNKPLVGCGILGSALGMDKILMKTIFSNLK-------------IP
DDL_PROM2       --NGEDGSIHGLLQYTRKPIVGCGILGSAIGMDKIMMKTIFSNLK-------------IP
DDL_PROM5       --NGEDGAIHGLLKFTQKPLIGCGISGSAIGMDKILMKQIFSNLS-------------IP
DDL_PROMP       --NGEDGAIHGLLKFTQKPIVGGGILGSALGMDKILMKKIFSHLE-------------IP
DDL_DEIGD       --MGEDGTIQGLLTLAGIPFVGSGVLGSAVSMDKVMTKQVLASVG-------------MP
DDL_DEIRA       --MGEDGTIQGLLTLAGIPFVGSGVLGSAVSMDKVMTKQVLDSAG-------------IP
DDL_BACLD       --NGEDGTIQGMLELLNVPYVGNGVLASSAGMDKVVMKHLFAQAG-------------LD
DDL_BACSU       --NGEDGTIQGMLELLNIPYVGNGVLASSAGMDKVVMKHLFAQVG-------------LA
DDL_BACP2       --NGEDGTMQGLLELLNIPYVGNGVLASAAGMDKVMMKDVFAQAG-------------LA
DDLB_BACCR      --NGEDGTVQGLLELMNIPYVGNGVLASSAGMDKVVMKNIFAEAG-------------LK
DDL_GEOKA       --NGEDGTVQGLLEILNIPYVGNGVLASAVGMDKVMMKNLFAQAG-------------LR
DDL_GEOTN       --NGEDGTVQGLLEMLNLPYVGNGVLASAVGMDKVVMKNLFAQAG-------------LR
DDL_LISMO       --NGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAG-------------IP
DDL_LISMF       --NGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAG-------------IP
DDL_LISIN       --NGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAG-------------IP
DDL_LISW6       --NGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAG-------------IP
DDL_STAAB       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAAC       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAA1       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAAM       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAAN       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAA8       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAAE       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAA3       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAAS       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAAW       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAAR       --NGEDGTIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRG-------------LP
DDL_STAES       --NGEDGTIQGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFEHRG-------------LP
DDL_STAEQ       --NGEDGTIQGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFEHRG-------------LP
DDL_STAHJ       --NGEDGTIQGLFEVLDLPYVGNGVLAASSSMDKLVMKQLFEHRG-------------LP
DDL_STAS1       --NGEDGTIQGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFAHRG-------------LP
DDL_ENTFA       --NGEDGTIQGFMETINMPYVGAGVLASANAMDKIMTKYLLQTVG-------------IP
DDL_ENTHA       --NGEDGTIQGFLETLNLPYVGAGVLTSACAMDKIMTKYILQAAG-------------VP
DDL_LACLM       --MGEDGSIQGFLEILRLAYVGPNILSASSTMDKLLAKHVFEAVG-------------VP
DDL_LACLA       --MGEDGSIQGFLEILRLAYVGPNILSASSTMDKLLAKHVFEAVG-------------VP
DDL_STRA1       --MGEDGSIQGFLEVLRMPYVGTNILSSSVAMDKITTKQVLATVG-------------VP
DDL_STRA3       --MGEDGSIQGFLEVLRMPYVGTNILSSSVAMDKITTKQVLATVG-------------VP
DDL_STRA5       --MGEDGSIQGFLEVLRMPYVGTNILSSSVAMDKITTKQVLATVG-------------VP
DDL_STRT2       --MGEDGSIQGFLETLKLPYVGTNVLSSSVAMDKIMTKRILEVAG-------------VP
DDL_STRT1       --MGEDGSIQGFLETLKLPYVGTNVLSSSVAMDKIMTKRILEVAG-------------VP
DDL_STRTD       --MGEDGSIQGFLETLKLPYVGTNVLSSSVAMDKIMTKRILEVAG-------------VP
DDL_STRP1       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRPM       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRPB       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRPC       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRP8       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRPG       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRPD       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRP3       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRP6       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRPF       --MGEDGSIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIG-------------IP
DDL_STRMU       --MGEDGSIQGFLEVLKMPYVGTNILSSSVAMDKITTNQVLESAT------------TIP
DDL_STRR6       --MGEDGSVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAG-------------IA
DDL_STRP2       --MGEDGSVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAG-------------IA
DDL_STRPN       --MGEDGSVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAG-------------IA
DDL_CLOAB       --YGEDGTIQGLCKLVGVPCVGPSVLSSSVCMDKVYTKYVLEHFN-------------IK
DDL_CLONN       --YGEDGTIQGLCKLLTIPCVGPGVMSSAVCMDKVYTKYVLENFG-------------VK
DDLB_CLOTE      --YGEDGTIQGLCKLVGLPCVGPGVLSSALCMDKIYTKYVLENFK-------------FK
DDL_CALS8       --NGEDGTVQGLLELSGIPYVGCGVLSSALCMDKAFAKKLALLEG-------------IP
DDL_CHLPD       --YGEDGRIQGLLDTFGIPYTGCGVLASAVAMDKALTKLCVTEAG-------------IA
DDL_PELLD       --YGEDGRVQGLLETLQVPCTGCGVLASALTMDKALTKLAAADAG-------------LA
DDL_CHLCH       --FGEDGRMQGFLETCGIPYTGCGVLASALTMDKALTKLCVADAG-------------IA
DDL_CHLTE       --YGEDGKLQGCLDTFGIPYTGCGLTASALAMDKVLTKLCAMNAG-------------IA
DDL_COXBU       --QGEDGALQGLLELLNLPYVGANVQSSAVCMEKDLTKTVLRAGG-------------IP
DDL_SOLUE       --FGEDGTVQGLLELADLPYVGAGVLGSAVSMDKEMMKRVCKERM-------------LP
DDL_BACSK       --LGEDGSLQGMFRLANLPFVGSNVLGSAVSMDKDIAKRLLQGAG-------------LH
DDL_OCEIH       --LGEDGSLQGMLRMANIPFVGSSVLGSAISMDKDIAKRLLKDAG-------------LK
DDLA_ECOLI      --LGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAG-------------LN
DDLA_ECO57      --LGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAG-------------LN
DDLA_SHIFL      --LGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAG-------------LN
DDLA_ECOL6      --LGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAG-------------LN
DDLA_SALTI      --LGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAG-------------LN
DDLA_SALTY      --LGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAG-------------LN
DDL_BAUCH       --LGEDGNLQGLLRMANLPFVGSTVLGSAVSMDKDIAKRLLRDAD-------------LE
DDLA_CHRVO      --LGEDGSLQGLLRMANIPFVGAGVLGSAVCMDKDVAKRLLRDAG-------------LK
DDLA_XANCP      --LGEDGSLQGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDAG-------------LE
DDLA_PSESM      --FGEDGALQGLLRMLAVPFVGADVLASAACMDKDVTKRLLRDAG-------------IA
DDL_BLOFL       --LGEDGSLQGLLRLMNLPYVGSDVLGSAICMDKDITKRLLRDSG-------------LS
DDL_WIGBR       --NGENGAFQGLFNTIYTPFVGSNVLSSSICMDKDISKRILSTFG-------------IS
DDL_BIFAA       --YGEDGTIQGLFEMMGVPYVGCGVLASAACMDKHYTKVLLAAAG-------------IP
DDL_BIFLO       --YGEDGTVQGLLEMMGVPYVGCGVFASAACMDKHYTKVVLDAAG-------------IP
DDL_CORGL       --FGEDGTVQGLFALSDIPVVGPGVLASAAGMDKEYTKKLMAAEG-------------LP
DDL_CORGB       --FGEDGTVQGLFALSDIPVVGPGVLASAAGMDKEYTKKLMAAEG-------------LP
DDL_COREF       --FGEDGTIQGMFALSDIPVVGPGVLSSAAGMDKEFTKKLMAAEG-------------LP
DDL_MYCTU       --YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADG-------------LP
DDL_MYCTA       --YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADG-------------LP
DDL_MYCBP       --YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADG-------------LP
DDL_MYCBO       --YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADG-------------LP
DDL_MYCUA       --YGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLWSAAG-------------LP
DDL_MYCLE       --YGEDGTIQGLLELARVPYVGAGVLASAAGMDKEFTKKLFAAEG-------------LP
DDL_MYCSM       --YGEDGTIQGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEG-------------LP
DDL_MYCS2       --YGEDGTIQGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEG-------------LP
DDL_MYCSK       --YGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLVAEG-------------LP
DDL_MYCSS       --YGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLVAEG-------------LP
DDL_MYCSJ       --YGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLVAEG-------------LP
DDL_STRAW       --YGEDGTLQGLLELSGVPYVGAGVLASAVGQDKEYMKRVFTSFG-------------LK
DDL_STRCO       --YGEDGTLQGLLELSGVPYVGAGVLASAVGQDKEYMKAVFTSYG-------------LK
DDLA_PSEPK      --WGEDGTIQGLAAMCGLPCVGSGVLGSAMAMDKDVTKRMVQSAG-------------LV
DDL_LEGPC       --LYEDGCLQGLLELAGVAYVGCDVLSSAIGMDKDMARRLACING-------------LK
DDL_LEGPA       --LYEDGCLQGLLELAGVAYVGCDVLSSAIGMDKDMARRLACING-------------LK
DDL_LEGPL       --LYEDGCLQGLLELAGVAYVGCDVLSSAIGMDKDMARRLACING-------------LK
DDLA_BRADU      --LCEDGTVQGLLELADVAYVGSGVLASAVSMDKDVAKRLAEFAG-------------IP
DDLA_BRUME      --HGEDGAVQGLAQVARVPLAGCGIPGSANALDKDIAKRLVNEAG-------------LS
DDLA_BRUSU      --HGEDGAVQGLAQVARVPLAGCGIPGSANALDKDIAKRLVNEAG-------------LS
DDLA_RHILO      --FGEDGSVQGYAEVADVAYVGCGILASAAAMDKDVAKRLLREAG-------------LA
DDLB_BRADU      --NGEDGTVQGALELADVSFVGSSVTGSAVAMDKEVSKRLMRDAG-------------LP
DDL_VIBCB       --PGETGDIQSMFEIAGIPYLGCGPEASSNSFNKITSKLWYDAIG-------------IP
DDL_VIBPA       --PGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSKLWYDALD-------------IP
DDL_VIBVU       --PGETGDIQSLFELAGIPYLGCGPEASSNSFNKITSKLWYDAIG-------------IP
DDL_VIBVY       --PGETGDIQSLFELAGIPYLGCGPEASSNSFNKITSKLWYDAIG-------------IP
DDL_VIBCH       --PGETGDIQSMLELAGIPYLGCGPEASANSFNKITSKLWYDALD-------------IP
DDL_AERHH       --PGETGDLQSFLELAGLPYLGCDAEASKICFNKISTKLWLSAIG-------------IP
DDL_SHEON       --PGETGDIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALG-------------IP
DDL_LACBA       --LGEDGTIQGLFRLLKKPFVGSGVLASAVSFDKDMTKQVLTAHG-------------IR
DDL_LACPL       --LGEDGTLQGLFKLLKKPYVGSGVLASAASFDKDITKQILTHHH-------------IQ
DDL_LEUME       --LGEDGTLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNG-------------IR
DDL_LEUMM       --LGEDGTLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNG-------------IR
DDL_BORBU       --TGEDGAIQGVLKVMDIPCVGAGIIGSAISSNKYFCKLLLKSFD-------------IP
DDL_CALS4       H--GEDGTMQGLFQLANIPYVGSGVVGSATGMDKVIMKDIFKANN-------------LP
DDL_THEM4       N--GEDGTFQGMCEIFGIPYSGCNHFSSAFTMDKVVTKLLLKEKE-------------IS
DDL_CAMJE       --DGEDGKIAALFEFYSIKFIGPRLEASVLSFNKELTKLYAKSVG-------------VK
DDL_WOLSU       --DGEDGKLASLLEFFRIPFIGPRIEASVMSFNKHLTKLYAKERG-------------VK
DDL_HELHP       --DGEDGSVSALLDFYHLPFIGPRIESSVMSFNKVFTKIFAAQRG-------------VK
DDL_HELPY       --DGEDGKLASLLEFYRIAFIGPRIEASVLSYNKYLTKLYAKDLG-------------VK
DDL_HELPJ       --DGEDGKLASLLEFYRIAFIGPRVEASVLSYNKYLTKLYAKDLG-------------VK
                    * * . .                      *                          

DDL_ACTP2       TADMVVVRRGE--AVDSE----------------QIIAKLGLPVFVKPSSEGSSVGVTKV
DDL_HAEDU       TADMVVVQRGQ--AIDIN----------------QIIAKLSLPVFVKPSSEGSSVGVFKV
DDL_ACTSZ       IADMEIVTKNTALSLEPQ----------------AIVARLGLPLMVKPSREGSSVGLTKV
DDL_MANSM       IADMEIVTRDTVDELNPL----------------EVVERLGLPLMVKPSREGSSVGLTKV
DDL_HAEI8       VADMKVVTRETFSELDPQ----------------AVVAKLGLPLMVKPSLEGSSVGLTKV
DDL_HAEIG       VADMKVVTRETFSELDPQ----------------AVVAKLGLPLMVKPSLEGSSVGLTKV
DDL_HAEIN       VADMKVVTRETFSELDPQ----------------AVVAKLGLPLMVKPSLEGSSVGLTKV
DDL_HAES1       VADMEVVTRTSFSQLNPQ----------------VVVEKLGLPLMVKPSLEGSSVGLTKV
DDL_PASMU       VAEMEIVTKANVGELNPS----------------AVVEKLGLPVMVKPSLEGSSVGLTKV
DDL_YERPE       ISPYVALNRQQFETLSPE-------------ELVACVAKLGLPLIVKPSHEGSSVGMSKV
DDL_YERPA       ISPYVALNRQQFETLSPE-------------ELVACVAKLGLPLIVKPSHEGSSVGMSKV
DDL_YERPN       ISPYVALNRQQFETLSPE-------------ELVACVAKLGLPLIVKPSHEGSSVGMSKV
DDL_YERPP       ISPYVALNRQQFETLSPE-------------ELVACVAKLGLPLIVKPSHEGSSVGMSKV
DDL_YERPS       ISPYVALNRQQFETLSPE-------------ELVACVAKLGLPLIVKPSHEGSSVGMSKV
DDL_YERP3       ISPYVALNRQQFETLSPE-------------ELVACVAKLGLPLIVKPSHEGSSVGMSKV
DDL_PHOLL       VSPYVSINSQQVERLTDS-------------QLQEYVADLGLPLIVKPSLEGSSVGMTKV
DDL_PECAS       VSPYVALDRRQYLDTEAN-------------TLLAQFTHLGLPLIVKPSREGSSVGMSKV
DDLB_ECOLI      VAPWVALTRAEFEKGLSD-------------KQLAEISALGLPVIVKPSREGSSVGMSKV
DDLB_SHIFL      VAPWVALTRAEFEKGLSD-------------KQLAEISALGLPVIVKPSREGSSVGMSKV
DDLB_ECO57      VAPWVALTRVEFEKGLSD-------------KQLAEISALGLPVIVKPSREGSSVGMSKV
DDLB_ECOL6      VAPWVALTRAEFEKGLND-------------KQLAEISSLGLPVIVKPSREGSSVGMSKV
DDL_SALPA       VAPWVALTRAEFEKGLSE-------------EQKARISALGLPLIVKPSREGSSVGMTKV
DDLB_SALTI      VAPWVALTRAEFEKGLSE-------------EQKARISALGLPLIVKPSREGSSVGMTKV
DDLB_SALTY      VAPWVALTRAEFEKGLSE-------------EQKARISALGLPLIVKPSREGSSVGMTKV
DDL_BUCBP       VVPYLHINKHEFNKKFLQ-------------KFKKNISLLGLPIIVKPNQEGSSIGITIV
DDL_BUCAP       VLPDIYLQKKDISKYTYS-------------YILKKILKLKFPVVIKPNNAGSSIGITIV
DDL_BORBR       TPAFEVLGGST--------------------ELRLVPDRLGLPLILKPPHEGSTVGITKV
DDL_BORPE       TPAFEVLGGST--------------------ELRLVPDRLGLPLILKPPHEGSTVGITKV
DDL_BORPA       TPAFEVLGGST--------------------ELRLVPDRLGLPLILKPPHEGSTVGITKV
DDL_BORA1       TPAFEEIDSDT--------------------ELRRVPDRLGLPLILKPPHEGSTVGITKV
DDL_RALSO       TPDFVMLHAGA--------------------DWQAVADRLGLPLIVKPAREGSSIGLTKV
DDL_JANMA       TPKFTALEVEAT---TAE-------------QLQAIAAEFGMPLMLKAPHEGSTIGIAKV
DDL_NITEU       TPDYVMLDASS--------------------RFRDVADRLGLPLIIKPAREGSTLGLNKV
DDL_NITEC       TPDYVMLDADS--------------------NFQEVTDRLGLPLIIKPAREGSTIGLNKV
DDLB_CHRVO      IPAFELLDENS--------------------DFDAIERQLGLPIFVKPSTEGSSIGVTKV
DDL_METFK       TPDFELVTADS--------------------NFDAIERKLGLPLFVKPANEGSSIGISKV
DDL_NEIMB       VPEFAVLHDDT--------------------DFDAVEEKLGLPMFVKPAAEGSSVGVVKV
DDL_NEIMF       VPEFAVLHDDT--------------------DFDAVEEKLGLPMFVKPAAEGSSVGVVKV
DDL_NEIMA       VPEFAVLHDDT--------------------DFDAVEEKLGLPMFVKPAAEGSSVGVVKV
DDL_NEIG1       VPEFAVLYDDT--------------------DFDAVEEKLGLPMFVKPAAEGSSVGVVKV
DDL_PSEE4       TPRHAVLA-------SEQ-------------DCVAASAELGFPLIVKPAHEGSSIGMAKV
DDLB_PSEPK      TPRHAVLA-------SES-------------DCLQASTELGFPLIVKPAHEGSSIGMAKV
DDL_PSEPF       TPRHAVLR-------SEA-------------DCISAATELGFPLIVKPAHEGSSIGMAKV
DDLB_PSESM      TPLHAVLE-------NEN-------------DCICAATELGFPLIVKPAHEGSSIGMAKV
DDLB_PSEAE      TPDYAVLA-------SED-------------DCREAAQRLGFPLIVKPAHEGSSIGMAKV
DDL_SACD2       TPEYASLV-------ENS-------------DWQAVLDSLGGQGFVKPAHEGSSIGMSVV
DDL_XANAC       TPRYARLAAGA----SAE-------------DIHAAARQIGLPIIVKPANEGSSVGVSRV
DDLB_XANCP      TPRYARLAAGA----SAQ-------------QIHAAAEQIGLPVIVKPANEGSSVGVSRV
DDL_XYLFA       TPRYASLSVCA----TAV-------------EVRQAVEMLGFPVIIKPAKEGSSVGVSRV
DDL_XYLFT       TPRYASLSVCA----TAV-------------EVRKAVEMLGFPVIIKPAKEGSSVGVSRV
DDL_RHIME       VAEALVMDRR----------------------SFGNQHPMKPPYVVKPVREGSSFGVVIV
DDL_SINMW       VAEAVVMDRR----------------------SFGNQHPMKPPYVVKPVREGSSFGVVIV
DDLB_RHILO      VAESKVANRF----------------------AIQNKHPMKPPYVIKPVNEGSSFGVVIV
DDL_AGRFC       VAGERVMNRF----------------------DFTSEHPLQPPYVVKPVREGSSFGVVIV
DDLB_BRUME      VAPSRLMNRF----------------------DIGSQHPMKPPYVVKPVREGSSFGVVIV
DDLB_BRUSU      VAPSRLMNRF----------------------DIGSQHPMKPPYVVKPVREGSSFGVVIV
DDL_OCHA4       VASSLLLNRF----------------------EIGTEHPMEPPYVVKPVREGSSFGVVIV
DDL_CHESB       VASSRVMNRF----------------------EIGDKHPMEPPYVVKPVAEGSSFGVVIV
DDL_BARHE       IAPSCVMSRF----------------------AVGKEHPMEPPYVIKPVCEGSSLGVIIV
DDL_BARQU       VAPSCIMSRF----------------------AVGREHPMEPPYVIKPLCEGSSFGVVIV
DDL_BARBK       VAPSCVMSRF----------------------SLGAEHPMKPPYVIKPIREGSSFGVVIV
DDL_GLUOX       VAQGRVVTVE----------------------ELAEADPLPAPYVIKPVAEGSSVGVEIV
DDL_GRABC       VAEGRLVTVE----------------------ELAEQDPLPRPFVIKPANEGSAVGVHIL
DDL_CAUVC       VPGGGLFNRH----------------------DVARDHVLQPPYVVKPNAEGSSVGVFII
DDL_RICB8       MAESIVISKG----------------------DNIKTDPIKRPYVIKPFTQGSSIGVEVI
DDL_RICBR       MAESIVISKG----------------------DNIKTDPIKRPYVIKPFTQGSSIGVEVI
DDL_RICCN       MAEGIVVNKS----------------------DNIKNDPMKRPYVIKPLTQGSSIGVEVI
DDL_RICRS       MAESIVVNKS----------------------DNIKNDPMKRPYVIKPLTQGSSIGVEVI
DDL_RICM5       MAESIVVNKS----------------------DNIKNDPMKRPYVIKPLTQGSSIGVEVI
DDL_RICFE       MAESIIVNKS----------------------DNIKSDPVKRPYVIKPLTQGSSIGVEVI
DDL_RICPR       IADSIVVSKS----------------------DHINTDPMKRPYVIKPLKQGSSIGVEVI
DDL_RICTY       MADSIVVSKS----------------------DHINTDPMKRPYVIKPLKQGSSIGVEVI
DDL_FUSNN       TPKS----------------------------YRPVEEIERFPVIIKPVDEGSSKGLFLC
DDL_THEMA       IPDFVEI------------------------KEFMKTSPLGYPCVVKPRREGSSIGVFVC
DDL_THEP1       IPDFIEI------------------------REFMETSPLGYPCVVKPRREGSSIGVFIC
DDL_PSELT       FPEYTIV------------------------KKPVKESPYGFPCVIKPRKEGSSIGVHIC
DDL_FERNB       IPNFLLISSEEFEE---S-------------KIYMIEEKIGLPCVVKPRKEGSSIGTHIC
DDL_AQUAE       TPDWETFISE---------------------GDVLNTEWNKFPAVVKPVREGSSVGLKIV
DDL_CARHZ       TPNYIAFSFDENPN-FEA-------------ISSEILQTLKLPVVIKAPREGSTIGIEFV
DDL_MOOTA       TPKFLAWTGAEYATGKKE-------------IKAAILKELGLPVVIKAPTQGSTIGTFIV
DDL_SYNJB       TPDW--QVWDDQNP--LT-------------WADC-AAELGSPLVIKPSNNGSTVGISIV
DDL_SYNJA       TPEW--LVWDEAQP--LS-------------WAEC-VARLGSPLVVKPSNSGSTVGISLA
DDL_GLOVI       TPAY--RVAEAVPQ--VS-------------ECQAWLAALGSPVVVKPADGGSTVGVTIA
DDL_MAGMM       TPAWIELAGDHEEA--DE-------------LVDHFLGDFHGAAFVKPLDSGSSVGISRA
DDL_DESVH       TPDWAFLAARP---------------------AADWEPGLGYPLFVKPNTGGSSLCLSRV
DDL_DESVV       TPDWAFLAARP---------------------AADWEPGLGYPLFVKPNTGGSSLCLSRV
DDL_DESAG       TPEWVFLPAHP---------------------GADWEPPFAFPAFIKSNNGGSSLALHRV
DDL_LAWIP       TPKSVFLPLKP---------------------EVTWEPGLNYPIFVKSNIGGSSVNVHLV
DDLA_PSEAE      TASWLMAPASE---------------------EEVREQ-LGFPLVVKPNSQGSTVGLSIV
DDL_BACAN       TPDWIELTKM------ED-------------LNFDELDKLGFPLVVKPNSGGSSVGVKIV
DDLA_BACCR      TPDWIELTKM------ED-------------LNLDELDKLGFPLVVKPNSGGSSVGVKIV
DDLA_CLOTE      TPRWIMLYKN------ED-------------IDFESIKNIGYPLVVKPNSGGSSIGITIV
DDL_CLOB1       TADWVNVSSV------EN-------------IDYEAIEKIGYPVFVKPNSGGSSVATNLV
DDL_CLOBH       TADWVNVSSV------EN-------------IDYEAIEKIGYPVFVKPNSGGSSVATNLV
DDL_CLOBL       TADWVNVSSV------EN-------------IDYEAIEKIGYPVFVKPNSGGSSVATNLV
DDLA_CLOPE      TARWEMVSSV------DE-------------IDYEKIENLGYPVFVKPNNGGSSVATTLV
DDL_CLOPS       TARWVMVSSV------DE-------------IDYEKIENLGYPVFIKPNNGGSSVATTLV
DDLB_CLOPE      TAKWITVKSI------EE-------------IDYEKIEEIGYPVFVKPNNGGSSVATFKV
DDL_LACSS       TARFVAAYRH------QP-------------M---PEMPFEYPVVVKPSNGGSSVGTHIV
DDL_PEDPA       TAQFAVLHAK------DG-------------IH--PQLAFDYPMVVKPNSGGSSIGTRIV
DDL_BACFR       ISESLLLRQGQA-VSD-----------------EDVVEKIGLPCFIKPNLGGSSFGVTKV
DDL_BACFN       ISESLLLRQGQA-VSD-----------------EDVVEKIGLPCFIKPNLGGSSFGVTKV
DDL_BACTN       IAESLLLRQGQS-VSD-----------------EDVMEKIGLPCFIKPSLGGSSFGVTKV
DDL_BACV8       VAESLILRKGFE-ITD-----------------EEVINKIGLPCFIKPNAGGSSFGVTKV
DDL_PORGI       IADSMRLTGRDT-QPDV----------------ADLIARMGLPLFVKPNVGGSSIATTKV
DDL_LEPBJ       VAPFFEVEKLGY-TNSPE-------------ETVIKLMSLGFPQFLKPVEGGSSVSTYKI
DDL_LEPBL       VAPFFEVEKLGY-TNSPE-------------ETVIKLMSLGFPQFLKPVEGGSSVSTYKI
DDL_LEPIN       VAPFFEIDKLEY-LNSTD-------------AVITKLETLGFPQFLKPVEGGSSVSVYKI
DDL_LEPIC       VAPFFEIDKLEY-LNSTD-------------AVITKLETLGFPQFLKPVEGGSSVSVYKI
DDL_TROW8       VLPWYLIKGHAWHKNRDS-------------FLKQISDRFTFPLFVKPVDAGSSFGCTFV
DDL_TROWT       VLPWYLIKGHAWHKNRDS-------------FLKQISDRFTFPLFVKPVDAGSSFGCTFV
DDL_TREPA       VLPFVFFRKDAWRMHMQE-------------FVAQLETRLGYPLFVKPAQAGSSVGASAV
DDL_NOSS1       QVKYKAVTRAQIWSNPCVF----------PKLCDEIEASLGYPCFVKPANLGSSVGISKV
DDL_TRIV2       QVKYKAVTRAQIWSNPCVF----------PKLCDEIEASLGYPCFVKPANLGSSVGISKV
DDL_TRIEI       QVKYQVVTRSQIWSNSCVF----------PKLCDDIETTLEYPCFVKPANLGSSVGIAKV
DDL_SYNY3       QVNYMGVERGEIWSNPCVF----------PALCEKIEAQVGYPCFVKPANLGSSVGIAKV
DDL_SYNP6       QVAYVAVNRSQVFSDPCRY----------TSLLEQIETELGYPCFVKPANLGSSVGIAKV
DDL_SYNE7       QVAYVAVNRSQVFSDPCRY----------TSLLEQIETELGYPCFVKPANLGSSVGIAKV
DDL_THEEB       QVPYVALQRSDLWSDPCRY----------NHLCDRIETELGYPCFVKPANLGSSVGISKA
DDL_PROM3       QVPYFAVDAADLLDTESR-----------QGVAKNLEAKLKYPCFVKPANLGSSVGISKA
DDL_PROMM       QVPYAAVDAADLLETESR-----------QGVAKHLEAKLKYPCFVKPANLGSSVGISKA
DDL_SYNS3       QVPYVGLNVADLNHPERQ-----------NKLVARIEAELGYPCFVKPANMGSSVGISKA
DDL_SYNSC       QVPYVALHASELEDAKSR-----------SALLDRIERELNYPCFVKPANLGSSVGISKV
DDL_SYNS9       QVPYVGLNASDLGDSARR-----------EHVLDRIEAELHYPCFVKPANLGSSVGISKV
DDL_SYNPX       QVPYVCAQADELSDAARQ-----------EALLKRIESGLCYPCFIKPANLGSSVGISKA
DDL_PROMA       QVNYCEIHSIDLLDKKRL-----------SYLIQKIETQLGYPCFIKPANLGSSVGISKA
DDL_PROM1       QVPYVSLNKADIQNNLYM-----------KSIYEQINKIINYPCFIKPANLGSSVGITKA
DDL_PROMT       QVPYISLNKPDIQNNLYM-----------KSIYEQINKIISYPCFIKPANLGSSVGITKA
DDL_PROMS       QVNYLVFQNQDLNDEEVK-----------NKLIHEILKKLNFPVFVKPSNSGSSLGISKV
DDL_PROM0       QVNYLVFQNEDLNDKQVK-----------NKIINEILKKLKFPVFVKPSNSGSSLGISKV
DDL_PROM9       QVNYLVIQNEDLNNLEVK-----------NKLIIEIIKKLNFPVFVKPSNSGSSLGISKV
DDL_PROM2       QVNYLAFQNEDLDDREVK-----------KKVINEILKKLNFPFFVKPSNSGSSLGISKV
DDL_PROM5       QVNFLAIQNYDLSDDNVK-----------DNLSVEIIEKLNLPVFVKPANSGSSLGISKA
DDL_PROMP       QVNYLDIQNQDLSDDKVK-----------NNLSVEIIEKLKLPVFVKPANSGSSLGISKA
DDL_DEIGD       QVAWRLAVRREWQERPQE--------------VRARAGELGYPLFVKPANLGSSVGISKV
DDL_DEIRA       QVAWRLAVRREWQQTPDA--------------VRARAAELGYPLFVKPANLGSSVGISKV
DDL_BACLD       QAKYVSFLKKTWSQSKEE-------------CYAQVEGELGYPCFVKPANLGSSVGISKC
DDL_BACSU       QAKYAAFLKKDWTRSPKE-------------SCEEVEQELGYPCFVKPANLGSSVGISKC
DDL_BACP2       QAKHLSFNKKDYEKATPD-------------SLEQVEQVLGYPCFVKPANMGSSVGISKC
DDLB_BACCR      QAKYASFIRSAWEKNREE-------------AYSKVEDKLGYPCFVKPANLGSSVGINKC
DDL_GEOKA       QAKYIAVTKYDWQKRGET-------------VYDRIERELGYPCFVKPANAGSSVGISKC
DDL_GEOTN       QAKYVSVTKYEWKKGGEA-------------VYDRIEQELGYPCFVKPANAGSSVGISKC
DDL_LISMO       QVPAVAVRLIDWKNYQEE-------------MVAEMEEVLTYPVFVKPANLGSSVGISKA
DDL_LISMF       QVPAVAVRLIDWKNYQAE-------------MVAEMEEVLTYPVFVKPANLGSSVGISKA
DDL_LISIN       QVPAVAVRLIDWKNYQEE-------------MVTEMEEVLTYPVFVKPANLGSSVGISKA
DDL_LISW6       QVPAVAVRLIDWKNYQEE-------------MVSEMEEVLTYPVFVKPANLGSSVGISKA
DDL_STAAB       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAAC       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAA1       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAAM       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAAN       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAA8       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAAE       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAA3       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAAS       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAAW       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSVGISKC
DDL_STAAR       QLPYISFLRSEYEKYEHN-------------ILKLVNDKLNYPVFVKPANLGSSIGISKC
DDL_STAES       QLPYISFLRSEYEKYENN-------------IIKLVNDKLTYPVFVKPANLGSSVGISKC
DDL_STAEQ       QLPYISFLRSEYEKYENN-------------IIKLVNDKLTYPVFVKPANLGSSVGISKC
DDL_STAHJ       QLPYISFLRSEYEKYEGN-------------IIKLVKDKLTYPVFVKPANLGSSVGISKC
DDL_STAS1       QLPYVSFLRSEYHKYEGN-------------ILKLVHDKLEYPVFVKPANLGSSVGISKC
DDL_ENTFA       QVPFVPVLRSDWKGNPKE-------------VFEKCEGSLIYPVFVKPANMGSSVGISKV
DDL_ENTHA       QVPYVPVLKNQWKENPKK-------------IFDQCEGSLLYPMFVKPANMGSSVGISKA
DDL_LACLM       QVPYVAAFADE---NQVE-------------IAQEVVEKLDFPVFVKPANMGSSVGISKV
DDL_LACLA       QVPYVAAFADE---NQGE-------------IAQEVVEKLEFPVFVKPANMGSSVGISKV
DDL_STRA1       QVAYQTYFEGD---DLEH-------------AIKLSLETLSFPIFVKPANMGSSVGISKA
DDL_STRA3       QVAYQTYFEGD---DLEH-------------AIKLSLETLSFPIFVKPANMGSSVGISKA
DDL_STRA5       QVAYQTYFEGD---DLEH-------------AIKLSLETLSFPIFVKPANMGSSVGISKA
DDL_STRT2       QVAYTVYIEGE---DLEA-------------AVAETLEKLTFPVFVKPANMGSSVGISKA
DDL_STRT1       QVAYTVYIEGE---DLEA-------------AVAETLEKLTFPVFVKPANMGSSVGISKA
DDL_STRTD       QVAYTGYIEGE---DLEA-------------AVAETLEKLTFPVFVKPANMGSSVGISKA
DDL_STRP1       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRPM       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRPB       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRPC       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRP8       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRPG       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRPD       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRP3       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRP6       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRPF       QVAYTVYIDGQ---DLEA-------------CLVETLARLTFPIFVKPANMGSSVGISKA
DDL_STRMU       QVAYVALIEGE---PLES-------------KLAEVEEKLIYPVFVKPANMGSSVGISKA
DDL_STRR6       QVPYVAIVEGD---DVTA-------------KIAEVEEKLAYPVFTKPSNMGSSVGISKS
DDL_STRP2       QVPYVAIVEGD---DVTA-------------KIAEVEEKLAYPVFTKPSNMGSSVGISKS
DDL_STRPN       QVPYVAIVEGD---DVTA-------------KIAEVEEKLAYPVFTKPSNMGSSVGISKS
DDL_CLOAB       QADYVVVHAHEYKTSKEE-------------IIKEIENKLGYAVFIKPSNSGSSVGITKA
DDL_CLONN       QADYVVVNAHDYKNNKMD-------------IISTIENKLGYDVFIKPSNSGSSVGISKA
DDLB_CLOTE      QANYVVVNKFEYEKNKEE-------------IIKEVE-KLQYDVFIKPANSGSSVGITKA
DDL_CALS8       QGHFLVIYKDEYLSKKEY-------------FIRRIESEFSYPVFVKPANSGSSVGISKA
DDL_CHLPD       TAPGITILSSEYFADPKS-------------TQKSIEEQFTWPVFVKPASLGSSVGISKV
DDL_PELLD       VAVSVTVMSHAYRRDPEA-------------THRLAVASLSFPMFVKPVSLGSSVGITKV
DDL_CHLCH       VAQGTNILSADYLANPNA-------------VEASVEAQVSYPLFVKPASLGSSIGISKV
DDL_CHLTE       VAEFMTITSCAYMANPLE-------------TIVEITKRFDWPLFVKPASLGSSVGISKV
DDL_COXBU       VVDWHTLSPRD--ATEGV-------------YQRLLDRWGTSELFVKAVSLGSSVATLPV
DDL_SOLUE       IVDYVTVTRQT--PSIVD-------------ACRRL----PFPMFVKPANLGSSVGISKA
DDL_BACSK       VASGLTFTRAAKETIDFE----------------SIADQLGLPLFIKPANQGSSVGVNKA
DDL_OCEIH       VAKGYAYRSVDKESIHFD----------------SLKEELGLPMFIKPANQGSSVGVHKV
DDLA_ECOLI      IAPFITLTRANRHNISFA----------------EVESKLGLPLFVKPANQGSSVGVSKV
DDLA_ECO57      IAPFITLTRANRHNISFA----------------EVESKLGLPLFVKPANQGSSVGVSKV
DDLA_SHIFL      IAPFITLTRANRHNISFA----------------EVESKLGLPLFVKPANQGSSVGVSKV
DDLA_ECOL6      IAPFITLTRANRHNISFA----------------EVESKLGLPLFVKPANQGSSVGVSKV
DDLA_SALTI      IAPFITLTRTNRHAFSFA----------------EVESRLGLPLFVKPANQGSSVGVSKV
DDLA_SALTY      IAPFITLTRTNRHAFSFA----------------EVESRLGLPLFVKPANQGSSVGVSKV
DDL_BAUCH       VTPSITLTRINRENFSYD----------------QIITYLGSSLFVKPANQGSSVGVSKV
DDLA_CHRVO      VAPFVSLTRSKAAGADLS----------------AIVEQLGLPLFVKPANQGSSVGVSKV
DDLA_XANCP      VAPFACFTRHTAAQADVQ----------------TLIAQFGLPLFVKPANQGSSVGVSQV
DDLA_PSESM      VAPFMVLNRG--ESLSFA----------------QAAAQLSLPMFVKPANQGSSVGVSKV
DDL_BLOFL       ITPFRTFLAHEKKKLKFL----------------NFADMFGLPFFVKPVNQGSSIGVAKV
DDL_WIGBR       VVPSITLYYEN-YKKKIN----------------KIINNIKFPCCIKPSNQGSSFGVNVA
DDL_BIFAA       VAPGITLDARSFDKASEFKTDADAIMAQVSE------AGLQYPLFVKPSRAGSSFGVTKV
DDL_BIFLO       TAPGVTVDARNFTAAD--------VLAEIED------AGLTYPLFVKPSRAGSSFGVTKV
DDL_CORGL       VGREVILRD-RTELTE----------AEKNL--------LGLPVFVKPARGGSSIGISRV
DDL_CORGB       IGREVILRD-RTELTE----------AEKNL--------LGLPVFVKPARGGSSIGISRV
DDL_COREF       IGREVILRD-RAELTD----------AEKKL--------LGLPVFVKPARGGSSIGISKV
DDL_MYCTU       VGAYAVLRPPRSTLHR----------QECER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCTA       VGAYAVLRPPRSTLHR----------QECER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCBP       VGAYAVLRPPRSTLHR----------QECER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCBO       VGAYAVLRPPRSTLHR----------QECER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCUA       IGPHAVLRPSRQSLDR----------EELQR--------LGLPAYVKPARGGSSIGVSRV
DDL_MYCLE       LSAYTVLRPLRPTLHR----------QECER--------LSLPVFVKPARGGSSIGISRV
DDL_MYCSM       IGDQVVLRPGVETLDL----------EQRER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCS2       IGDQVVLRPGVETLDL----------EQRER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCSK       VGDHVVLRPGRANVTL----------DERER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCSS       VGDHVVLRPGRANVTL----------DERER--------LGLPVFVKPARGGSSIGVSRV
DDL_MYCSJ       VGDHVVLRPGRANVTL----------DERER--------LGLPVFVKPARGGSSIGVSRV
DDL_STRAW       VGPYVVIRPREWERDE----------SAARRKIVDFAGEHGWPLFVKPARAGSSIGITKV
DDL_STRCO       VGPYAVIRPREWEQDR----------SGARKKIVDFAGEHGWPLFVKPARAGSSIGITKV
DDLA_PSEPK      VVPWLAMNSMRPWEEL----------VECLG---------SSTLFVKPATSGSSIGVSRV
DDL_LEGPC       SARYKLLSWHANASERQ------QFCHEVASEFGWP-------LFVKPCSLGSSVGIHKA
DDL_LEGPA       SARYKLLSWHANASERQ------QFCHEVASEFGWP-------LFVKPCSLGSSVGIHKA
DDL_LEGPL       SARYKLLSWHANASERQ------QFCHEVASEFGWP-------LFVKPCSLGSSVGIHKA
DDLA_BRADU      VAPYRVLTRKAFVQDRV------SSLAKAVEGLSLP-------VFVKPCNMGSSVGIHKV
DDLA_BRUME      TAKSVTITREEVPA-----------FSALEQALGLP-------IFIKPARQGSSVGVHKV
DDLA_BRUSU      TAKSVTITREEVPA-----------FSALEQALGLP-------IFIKPARQGSSVGVHKV
DDLA_RHILO      VARSVTVLKGDVGS-----------FQEIAGALGLP-------FFAKPARQGSSFGVSKV
DDLB_BRADU      VVPFLTTTASSRIE-----------YAAAVAALGTPD------LFVKPANLGSSVGVSRA
DDL_VIBCB       NTPYLFLTRNDEQAHEQA----------------LQAFDKWGKVFVKAARQGSSVGCYSV
DDL_VIBPA       NTPYLFLTRNDEHAHRQA----------------EQAFEKWGKVFVKAARQGSSVGCYSV
DDL_VIBVU       NTPYLFLTENNEESHQLS----------------REAFDKWGKLFVKAARQGSSVGCYSV
DDL_VIBVY       NTPYLFLTENNEESHQLS----------------REAFDKWGKLFVKAARQGSSVGCYSV
DDL_VIBCH       NTPYLFLTQNTPSSIDKA----------------KQAFGHWGSIFVKAARQGSSVGCYKV
DDL_AERHH       NTPYLFLTEQNDAALSEA----------------KAALAKWGKVFIKAASQGSSVGCYSA
DDL_SHEON       NTPYIFLNQYDDEAIAQT----------------QAALEKWGSIFVKAASQGSSVGCYKV
DDL_LACBA       NTKYVVLTPDNRADFDYA----------------TIQSRLGDNVFIKPANQGSSVGIHKA
DDL_LACPL       NTKYVVVTPENRDQMTYA----------------YLQAHVGDHLFIKPANQGSSIGIHKA
DDL_LEUME       NTKYIVVDPESANNWSWD----------------KIVAELGNIVFVKAANQGSSVGISRV
DDL_LEUMM       NTKYIVVDPESANNWSWD----------------KIVAELGNIVFVKAANQGSSVGISRV
DDL_BORBU       LVPFIGFRQHDYFLDKEE-------------IKRNVKEVLGYPVIVKPAVLGSSIGINVA
DDL_CALS4       IVNYLWFLRKEYEKNKEA-------------MLDLIESKLKYPMFVKPANLGSSIGISKA
DDL_THEM4       VVDFEY-----TTEINEE-------------FFKRCEKNLGYPMIVKPARLGSSIGVSKV
DDL_CAMJE       TLDYTILRK----NQNSK-------------------EKLSFPCIIKPARLGSSIGISIV
DDL_WOLSU       TLPYLLARK----NEKRE-------------------FGNEFPLIVKPLRLGSSIGVSIA
DDL_HELHP       VLDYEILTR----ANPHL-------------------KHIAYPIILKPARLGSSIGVSVI
DDL_HELPY       TLDHVLLNEKNRANALDL-------------------MNFNFPFIIKPNNAGSSLGVNVV
DDL_HELPJ       ALDYVLLNEKNRANALDL-------------------IGFNFPFIVKPSNAGSSLGVNVV
                                                              *.   **:      

DDL_ACTP2       KTVEQ-------LLPAVEEALKFDSIVLVEAFLAG--KEYSVPVLDG--------QVLPA
DDL_HAEDU       KTKEE-------LLPAITAALEFDTIVLVEEFLTG--AEYSVPVLDG--------EVLPA
DDL_ACTSZ       DSADK-------LKSAVDLALKFDDIVLIEEWLSG--DELTVPVLGD--------EVLPA
DDL_MANSM       NAVEE-------LKNAVDLALTHDDTVLIEEWLSG--IEMTVPVLDD--------QVLPA
DDL_HAEI8       KAVEE-------LKSAVEYALKFDNTILIEEWLAG--DELTVPVLDN--------QVLPA
DDL_HAEIG       KAVEE-------LKSAVEYALKFDNTILIEEWLAG--DELTVPVLDN--------QVLPA
DDL_HAEIN       KAVEE-------LKSAVEYALKFDNTILIEEWLAG--DELTVPVLDN--------QVLPA
DDL_HAES1       NAIDD-------LKSAVEFALQYDETVLIEEWLSG--DELTVPILGN--------EVLPS
DDL_PASMU       KRVED-------LKSAVDFALKYDDTVLIEEWLSG--AEFTVPVLDN--------EVLPS
DDL_YERPE       DHASE-------LQKALVEAFQHDSDVLIEKWLSG--PEFTVAILGD--------EVLPS
DDL_YERPA       DHASE-------LQKALVEAFQHDSDVLIEKWLSG--PEFTVAILGD--------EVLPS
DDL_YERPN       DHASE-------LQKALVEAFQHDSDVLIEKWLSG--PEFTVAILGD--------EVLPS
DDL_YERPP       DHASE-------LQKALVEAFQHDSDVLIEKWLSG--PEFTVAILGD--------EVLPS
DDL_YERPS       DHASE-------LQKALVEAFQHDSDVLIEKWLSG--PEFTVAILGD--------EVLPS
DDL_YERP3       DHASE-------LQKALVEAFQHDSDVLIEKWLSG--PEFTVAILGD--------EVLPS
DDL_PHOLL       NEISE-------LRGALEAAFRYDVDLLVEKWLHG--PEYTVAILGD--------TALPS
DDL_PECAS       NTLSD-------LPAALEEAFRHDDDVLVEKWLSG--PEYTVAILGD--------EVLPS
DDLB_ECOLI      VAENA-------LQDALRLAFQHDEEVLIEKWLSG--PEFTVAILGE--------EILPS
DDLB_SHIFL      VAENA-------LQDALRLAFQHDEEVLIEKWLSG--PEFTVAILGE--------EILPS
DDLB_ECO57      VAENA-------LQDALRLAFQHDEEVLIEKWLSG--PEFTVAILGE--------EILPS
DDLB_ECOL6      VAENA-------LQDALRLAFQHDEEVLIEKWLSG--PEFTVAILGE--------EILPS
DDL_SALPA       VEENA-------LQGALSLAFQHDDEILIEKWLCG--PEFTVAIVGE--------EILPS
DDLB_SALTI      VEENA-------LQGALSLAFQHDDEILIEKWLCG--PEFTVAIVGE--------EILPS
DDLB_SALTY      VEENA-------LQGALSLAFQHDDEILIEKWLCG--PEFTVAIVGE--------EILPS
DDL_BUCBP       YSYET-------LYKACKTAFIFDNSILIEKFIYG--EEYTISILGK--------KILPI
DDL_BUCAP       NHPDL-------LIDSINLAFNYSNNIIIEKFLKG--TEYTVSILNK--------KVLPP
DDL_BORBR       AGYSD-------MKAAYELAARFDAEVLAEQFITG--RELTVAVLGSGAA----ARALPV
DDL_BORPE       AGYSD-------MKAAYELAARFDAEVLAEQFITG--RELTVAVLGSGAA----ARALPV
DDL_BORPA       AGYSD-------MKAAYELAARFDAEVLAEQFITG--RELTVAVLGSGAA----ARALPV
DDL_BORA1       AACAD-------MEQAYAAASHFDEVVLAEQFVRG--RELTVALLGSGRN----ARALPV
DDL_RALSO       TSVAE-------LPAAYEKAARLDRDVMAEQFIDG--DELTCAVIGEGEH----ATALPL
DDL_JANMA       ETAEG-------MQAGFDLCAKYDDVVLVEQFVKG--RELTVPVLGSGRN----ARALPI
DDL_NITEU       DNEQD-------FRSAYQAAAEYDSLVLAEQFIQG--IELTAAILDD--------MPLPL
DDL_NITEC       DYAQD-------MQSAYQTAAQHDSLVIAEQFIQG--IELTAAILDD--------VPLPL
DDLB_CHRVO      KQPGE-------LRAAFEEARKYDKVVIAEQFIGG--GEYTCAVIGE--------TAYPT
DDL_METFK       KAAGG-------LQAAYALAAKSDPLVIAEQFVGG--GEYTVGILGG--------AALPV
DDL_NEIMB       KGKGR-------LKSVYEELKHLQGEIIAERFIGG--GEYSCPVLNG--------KGLPG
DDL_NEIMF       KGKGR-------LKSVYEELKHLQGEIIAERFIGG--GEYSCPVLNG--------KGLPG
DDL_NEIMA       KGKGR-------LKSVYEELKHFQGEIIAERFIGG--GEYSCPVLNG--------KGLPG
DDL_NEIG1       KEKGR-------LKSVYEELKHLQGEIIAERFIGG--GEYSCPVLNG--------KGLPG
DDL_PSEE4       NSEQE-------LVAAWKDAAKYDSQVLVEQWIHG--PEFTIAVLRG--------QVLPP
DDLB_PSEPK      NSTQE-------LVAAWQDAAKYDSQVLVEQWIHG--PEFTIAVLRG--------QVLPP
DDL_PSEPF       SSASE-------LIDAWKAASTYDSQVLVEQWIHG--PEFTIATLRD--------QVLPP
DDLB_PSESM      NSVDE-------LIAAWKAASTYDSQVLVEQWIQG--PEFTVASLRG--------QVLPP
DDLB_PSEAE      GGLDE-------LIAAWREAARYDSQVLVEQWISG--PEFTVATLRG--------QVLPA
DDL_SACD2       STAQE-------LKAAYEKAAHYDAKVLVERRIVG--REFTVAVLNG--------VALPA
DDL_XANAC       FDQAQ-------LEEAVTLAARYDGALLMEQLIEG--DELTVAVLGD--------TALPS
DDLB_XANCP      FDQAQ-------LDEAVTLAARYDGALLMEQLIEG--DELTVAVLGD--------VALPS
DDL_XYLFA       FALEH-------LEEAVALAARYEGELLMEQLIEG--DELTVSILDE--------MALPS
DDL_XYLFT       FALEH-------LEEAVALAARYEGELLMEQLIEG--DELTVSILDE--------MALPS
DDL_RHIME       KEDQSHP-----PQVITSSEWRYGDRVMVERYIAG--REFTCGVMGD--------VALGV
DDL_SINMW       KEDQSHP-----PQVITSSDWRYGDRIMVERYVAG--REFTCGVMGD--------VALGV
DDLB_RHILO      SEGQSHP-----PQVVGSSEWKYGDTVMVERYIHG--RELTCAVMGD--------VALGV
DDL_AGRFC       KEDQSHP-----PQILTSSEWPFGNQVMVERYIHG--RELTCGVLDG--------EALGV
DDLB_BRUME      KEDQPHP-----PQVIGSADWKYGDEVMVEGYIAG--RELTCAVMGD--------RAMDV
DDLB_BRUSU      KEDQPHP-----PQVIGSADWKYGDEVMVEGYIAG--RELTCAVMGD--------RAMDV
DDL_OCHA4       KEDQTHP-----PQIISSAEWNYGAEVLVEKYIPG--RELTCAVMGD--------RVMDV
DDL_CHESB       REGQSHP-----PQVLGSAEWGYGERVMVERYIPG--RELTCAVMGD--------RVLGV
DDL_BARHE       KENESVP-----SLNVVGSEWVYADTVIVEKYIPG--RELTCAVMGN--------KALDV
DDL_BARQU       KENESAP-----PRNVVGAEWVYADEVIVEKYIPG--REFTCAVLGN--------EALDV
DDL_BARBK       GSDETMP-----LHDIMNNEWVYDDEIMVEKYVPG--RELTCAVLGD--------EVLDV
DDL_GLUOX       RTGDNRR-----AE--IARTWRFGKEALVESFIPG--RELTAGVMGD--------RALAV
DDL_GRABC       HEGDNRR-----TE--IARSWSFGGQALVEEYIPG--RELTVGVLND--------RALTV
DDL_CAUVC       KEGANRP-----PEEVGAPSWTFGEEVMVEPYIQG--MELAVAVLGESNG----PRALAV
DDL_RICB8       FEEDD--------FNFANYDFPYGDEVIIEKYIKG--RELQVAILNG--------KALGA
DDL_RICBR       FEEDD--------FNFANYDFPYGDEVIIEKYIKG--RELQVAILNG--------KALGA
DDL_RICCN       FAEDD--------FNFADYDFPYGDQVIIEQYIKG--RELQVAVLNG--------KALGA
DDL_RICRS       FAEDD--------FNFADYDFPYGDQVIIEQYIKG--RELQVAVLNG--------KALGA
DDL_RICM5       FAEDN--------FNFADYDFPYGDQVIIEQYIKG--RELQVAVLNG--------KALGV
DDL_RICFE       FEEDD--------FNFADYNFPYGYQVIIEQYIKG--RELQVAVLNG--------KALGA
DDL_RICPR       FEEDD--------FNFTDYDFPYGEDIIIEQYIQG--QELQVALLNG--------KALGV
DDL_RICTY       FEEDD--------FHFIDYDFPYGEDIIIEQYIQG--QELQVALLNG--------KALGV
DDL_FUSNN       NNKEE-----------AEEAVKKLAKPIIEDYIIG--EELTVGVLNG--------EALGV
DDL_THEMA       ESDEE-------FQHALKEDLPRYGSVIVQKYIPG--REMTVSILETEKG----FEILPV
DDL_THEP1       ESDEE-------FQHALKEDLPRYGSVIVQKYIPG--REMTVSILETEKG----FEVLPI
DDL_PSELT       DNSNQ-------LYNDLSEELKKYNEMMIQRYIEG--RELTVSILEIGKP-----QILPV
DDL_FERNB       FSKEE-------LLDALKNEFKNYDEMIVQEYIKG--KEITVSVIDINGT----PTVLPI
DDL_AQUAE       ESLEE-------LKEYALDLLKKTERVMVEEFVEG--RDMTVGILK--------GEALPV
DDL_CARHZ       FSKQE-------LPKAIKKVLEIDKQLLVEEFIEG--VEVTASVLGNSN-----PVVLPL
DDL_MOOTA       REEGE-------LEPAIAGALKYDLSFMAEAYLAG--PEITAAVLGNRK-----PQVLPL
DDL_SYNJB       RDERS-------FAQGLELARSVSSRIFLERYVPG--KEITLSILSG--------QVLPA
DDL_SYNJA       RDEVS-------LAQGLALASSVSSRVFLERYIPG--KEITLSILSG--------QVLPA
DDL_GLOVI       REAGH-------LPEAVRLALQYSPQVLIEQYIPG--QEITVALLDG--------LVLPA
DDL_MAGMM       VGKDE-------LIRGVAKALSVSHRCMVERAIEG--RELTLSILDG--------EAFPL
DDL_DESVH       TQPEG-------LAPALEAVFAHCGEAIVEPAIPG--VEVTCGVLGD--------TALPP
DDL_DESVV       TQPEG-------LAPALEAVFAHCGEAIVEPAIPG--VEVTCGVLGD--------TALPP
DDL_DESAG       SCPGE-------LARALDELFTRGGEAIIEPAVEG--VEVTCGVLGD--------EALPP
DDL_LAWIP       TNYEE-------LFIAMEALFNAGEEVLLEEAIIG--QEVTCGVIDD--------QALPP
DDLA_PSEAE      HSQAE-------LQPAIELAGRYGDEVMLERFVAG--REVTVGVLDD--------QALPV
DDL_BACAN       YDKDE-------LISMLETVFEWDSEVVIEKYIKG--EEITCSIFDG--------KQLPI
DDLA_BACCR      YNKNE-------LISMLETVFEWDSEVVIEKYIKG--DEITCSILDG--------KQLPI
DDLA_CLOTE      KKEQE-------LIKAIEEAFKFDEEILIEEYIKG--EEITCCMLDG--------KPLPI
DDL_CLOB1       KDKEG-------IKEAVELALKYDKEVMIENYTKG--EEITCCMLNG--------KMLPV
DDL_CLOBH       KDKEG-------IKEAVELALKYDKEVMIENYTKG--EEITCCMLNG--------KMLPV
DDL_CLOBL       KDKEG-------IKEAVELALKYDKEVMIENYTKG--EEITCCMLNG--------KMLPV
DDLA_CLOPE      ESKEA-------VKDAVLEALKYDTEVMIEEYIKG--DEITCPIIDG--------KMLPV
DDL_CLOPS       ESKEA-------VKDAVLEALKYDTEVMIEEYIKG--DEITCPIIDG--------KMLPV
DDLB_CLOPE      YKKED-------IKNSVMEGLKYDEEVIIESFIKG--REITCPIFNG--------ELFPI
DDL_LACSS       HNEAE-------LKPAVEDALRFDNEALIEEFIKG--REFSLGVINE--------QPLPA
DDL_PEDPA       HDEAE-------LAESLKDAYRFDDEIIVEEFITG--REFSLGVVNG--------QAMPA
DDL_BACFR       KTREQ-------IQPAIAKAFSEAEEVMIEAFMGG--TELTCGCYKTKE----KSVVFPL
DDL_BACFN       KTREQ-------IQPAIAKAFSEAEEVMIEAFMGG--TELTCGCYKTKE----KSVVFPL
DDL_BACTN       KTKEQ-------IQPAIVKAFEEAQEVLVEAFMEG--TELTCGCYKTKD----KTVIFPP
DDL_BACV8       KTKED-------IQPAIEKAFEESDEVMIEAFMKG--TEITCGCYKTSD----KEVVFPI
DDL_PORGI       VEAAQ-------LLPAIEQAFSEGEEVMIERLICG--TEVTCGAFLRKK----EVVALPV
DDL_LEPBJ       TNQEQ-------LSRQLALIFESDSKVMSQSFLAG--TEVSCGVLERYRNGKLERIALPA
DDL_LEPBL       TNQEQ-------LSRQLALIFESDSKVMSQSFLAG--TEVSCGVLERYRNGKLERIALPA
DDL_LEPIN       TNREQ-------LKEKLALIFESDSKVMSQSFLTG--IEVSCGVLERYRDGKFKKIALPA
DDL_LEPIC       TNREQ-------LKEKLALIFESDSKVMSQSFLTG--IEVSCGVLERYRDGKFKKIALPA
DDL_TROW8       DFFEQ-------LPVAIEHALQHGKSAIVEPALDA--PEVFCSLIENN-------GVLQC
DDL_TROWT       DFFEQ-------LPVAIEHALQHGKSAIVEPALDA--PEVFCSLIENN-------GVLQC
DDL_TREPA       QTRAP-------LIPAIEAAFQWDEVVLVERYVRA--REIECALSGNGPY-----TVHGA
DDL_NOSS1       RSRQE-------LEDALDNAANYDRRIIIEAGVAA--REVECAVLGND-QPQ----ASTV
DDL_TRIV2       RSRQE-------LEDALDNAANYDRRIIVEAGVVA--REVECAVLGND-QPQ----ASTV
DDL_TRIEI       RSRSE-------LETALDNAASYDRRIIVEAGVEA--KELECAVLGND-MPK----ASIV
DDL_SYNY3       RNRSE-------LEAALDNAASYDRRIIVEAGLTDI-REVECAVLGNE-NPQ----ASVV
DDL_SYNP6       RDRAE-------LEAALDQAAALDRRLIIEAAIDNP-REVECAVLGND-YPQ----ASIL
DDL_SYNE7       RDRAE-------LEAALDQAAALDRRLIIEAAIDNP-REVECAVLGND-YPQ----ASIL
DDL_THEEB       KNRQQ-------LTTALEVAAELDRRIIVEAGVVA--RELECAVLGND-KPQ----ASVV
DDL_PROM3       QNRNE-------LLIGLDKAASLDRRIVVEQGVSA--RELECAVLGKR-ELQ----TSVV
DDL_PROMM       QNRNE-------LLIGLDKAASLDRRIVVEQGVSA--RELECAVLGKR-ELQ----TSVV
DDL_SYNS3       RHRDQ-------LLAGLKEAARHDTRLVVEHGVSA--RELECAVLGRQ-QLK----ASVV
DDL_SYNSC       RSRQE-------LEAGLEQAAALDPRLVVEQGVNA--REVECAVLGRR-TLE----ASVI
DDL_SYNS9       RNRHE-------LETGLDHAAQLDPRLVVEQGVDA--RELECAVLGRH-QLR----SSVV
DDL_SYNPX       RNREE-------LIHGLRLAATLDPRLVVEQGVQA--RELECAVLGGT-TLR----ASVV
DDL_PROMA       YDKKE-------LLNGLDLAAQLDSRIVVEKNIKA--RELECAVIGKK-QIK----TSCV
DDL_PROM1       YSKEE-------FITGIEFAAKYDERIIVEKSIEG--RELECGVLGKS-IMK----SSVV
DDL_PROMT       YSKEE-------FIAGIEFAAKYDERIIVEKSIEG--RELECGILGKS-IMK----SSVV
DDL_PROMS       INKSE-------IIPALEKARGIDPSILIEEGLEV--REIECGIIGNS-KLL----TSEI
DDL_PROM0       KNESE-------ILLALEKAWGIDPRILIEEGLEV--REIECGIIGNS-KLI----TSEI
DDL_PROM9       INKSA-------LLKALEKAWEIDARILVEEGLET--REIECGIIGNS-ELL----TSEI
DDL_PROM2       INESE-------ILQSLEKAQKIDSRILVEEGLEV--REIECGIIGNS-ELL----TSEI
DDL_PROM5       KNKSE-------IIKALQKAWEIDSRIVIEEGLNV--RELECGIIGNL-KLS----TSKI
DDL_PROMP       KTRSE-------IIKALQKAWEIDSRIVIEEGLDV--RELECGIIGNL-KLT----ASEI
DDL_DEIGD       SGPGE-------LERALDLAFSLGRRVILEAMTAHKPRELEVGILGND-API----ASPV
DDL_DEIRA       GSPEE-------LDAALTLAFGLDRRVILEAMTPHKPREVEVGILGND-VPV----ASPV
DDL_BACLD       RSREE-------LDQAFELAFQYDRKIVVEEGVIG--REIELGVLGND-EPV----CSVA
DDL_BACSU       RNREE-------LQKAFELAFQYDRKVVVEEGING--REIEIGVLGND-DPK----CSVV
DDL_BACP2       RSKEE-------LQTAFDLAFQYDRRVVVEEGVVG--REIEIGVLGND-EPK----CSVV
DDLB_BACCR      KNREE-------LEDAFVEAFQFDRKIIVEENIVG--REVEVGVLGND-EPK----CSVV
DDL_GEOKA       KQRGD-------LKAAFIEAFQYDRKIIIEEAIVG--REIEIGVIGND-EPI----CSVV
DDL_GEOTN       KQRDD-------LKTAFAEAFKYDRKIIIEESIVG--REIEIGVIGND-EPI----CSVA
DDL_LISMO       TNKKE-------LVDAMTEAFLYDRRVVVEQGVVA--REIEMGVLGND-TPV----CSVP
DDL_LISMF       TNKKE-------LADAMTEAFLYDRRVVVEQGVVA--REIEMGVLGND-TPV----CSVP
DDL_LISIN       TNKTE-------LIEAMTEAFLYDRRVVVEQGVVA--REIEMGVLGND-TPV----CSVP
DDL_LISW6       TNKKE-------LEDAMTEAFLYDRRVVVEQGVVA--REIEMGVLGND-TPV----CSVP
DDL_STAAB       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAAC       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAA1       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAAM       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAAN       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAA8       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAAE       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAA3       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAAS       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAAW       NNEAE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAAR       SNEVE-------LKEGIKEAFQFDRKLVIEQGVNA--REIEVAVLGND-YPE----ATWP
DDL_STAES       NNEEE-------LKSGITEAFQFDRKLVIEQGINA--REIEVAVLGND-YPE----TTWP
DDL_STAEQ       NNEEE-------LKSGIAEAFQFDRKLVIEQGINA--REIEVAVLGND-YPE----TTWP
DDL_STAHJ       NNEDE-------LKSGIEEAFQFDRKLVIEQGINA--REVEVAVLGND-YPE----TTWP
DDL_STAS1       NNEEE-------LKNGIEEAFQFDRKLVIEQGIEA--REIEVAVLGND-YPE----TTWP
DDL_ENTFA       ENREE-------LQEALEEAFRYDARAIVEQGIEA--REIEVAILGNE-DVR----TTLP
DDL_ENTHA       ENREE-------LQNALALAYQYDSRAIVEQGIEA--REIEVAVLGNE-DVR----TTLP
DDL_LACLM       DDLAD-------LQPALSEAYKYDNRVVIEQGVDA--REIECAVLGNNSDVS----ATLP
DDL_LACLA       DDLAD-------LQPALSEAYKYDNRVVIEQGVDA--REIECAVLGNNSDVS----ATLP
DDL_STRA1       TDESS-------LRSAIDLALKYDSRILIEQGVTA--REIEVGILGNN-DVK----TTFP
DDL_STRA3       TDESS-------LRSAIDLALKYDSRILIEQGVTA--REIEVGILGNN-DVK----TTFP
DDL_STRA5       TDESS-------LRSAIDLALKYDSRILIEQGVTA--REIEVGILGNN-DVK----TTFP
DDL_STRT2       ENESE-------LRSAIDLALKYDSRILIEQGVVA--REIEVGILGNT-TVK----TTDP
DDL_STRT1       ENESE-------LRSAIDLALKYDSRILIEQGVVA--REIEVGILGNT-TVK----TTDP
DDL_STRTD       ENESE-------LRSAIDLALKYDSRILIEQGVVA--REIEVGILGNT-TVK----TTDP
DDL_STRP1       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRPM       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRPB       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRPC       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRP8       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRPG       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRPD       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRP3       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRP6       QTKVE-------LRKAIQLALTYDSRVLIEQGVVA--REIEVGLLGND-KVK----STLP
DDL_STRPF       QTKVE-------LRKAIQLALTYDSRVLIEQGVIA--REIEVGLLGND-KVK----STLP
DDL_STRMU       ENRTD-------LKQAIALALKYDSRVLIEQGVDA--REIEVGILGNT-DVK----TTLP
DDL_STRR6       ENQEE-------LRQALKLAFRYDSRVLVEQGVNA--REIEVGLLGNY-DVK----STLP
DDL_STRP2       ENQEE-------LRQALKLAFRYDSRVLVEQGVNA--REIEVGLLGNY-DVK----STLP
DDL_STRPN       ENQEE-------LRQALKLAFRYDSRVLVEQGVNA--REIEVGLLGNY-DVK----STLP
DDL_CLOAB       HNRKE-------LEAGLEEAMKYDRKILVEEALNA--REIEVAVLGNE-EPK----AAIP
DDL_CLONN       HNREE-------LEAGLEEALKFDRKVLVEVALNA--REIEVAVLGND-EPV----AATP
DDLB_CLOTE      HNKEE-------LLKGLEEAFIHDKNVLVEEAINA--REIEVAVLGND-DPK----AAVP
DDL_CALS8       KDKDE-------LILAIHEAFLYDTKILIEQAINA--REIECAVLGNS-EIL----VSAL
DDL_CHLPD       HHIGE-------LIAALETACRYDSKILVEKAMQG--REVEVAVLGNN-APE----VSIT
DDL_PELLD       NSESE-------LAEAITHACSLDSKVLIEQAVKG--REVEVAVIGND-TLE----ASPC
DDL_CHLCH       HNREE-------LHPALQAACALDWKVVVESTVKG--REIEVAVLGNA-DPI----ASVC
DDL_CHLTE       RNAEE-------LAAALENACGLDSKALVEAAISG--REIEVAVLGNS-DPL----ASEP
DDL_COXBU       KTETE-------FTKAVKEVFRYDDRLMVEPRIRG--REIECAVLGNG-APK----ASLP
DDL_SOLUE       HDEQE-------LEAAFSLAKQYDRKIIVERGIEG--RELECSVLGNE-APM----ASLP
DDL_BACSK       TTEAE-------FTAAIEEAFSYDHKVLIEAAIKG--REIECAVLGN-DYPK----ASTC
DDL_OCEIH       ENEEQ-------FYSAIKDAFQFDHKLLVEEAIVG--REIECAVLGN-EKPA----ASVP
DDLA_ECOLI      TSEEQ-------YAIAVDLAFEFDHKVIVEQGIKG--REIECAVLGN-DNPQ----ASTC
DDLA_ECO57      TSEEQ-------YAIAVDLAFEFDHKVIVEQGIKG--REIECAVLGN-DNPQ----ASTC
DDLA_SHIFL      TSEEQ-------YAIAVDLAFEFDHKVIVEQGIKG--REIECAVLGN-DNPQ----ASTC
DDLA_ECOL6      TSEEQ-------YTIAVDLAFEFDHKVIVEQGIKG--REIECAVLGN-DNPQ----ASTC
DDLA_SALTI      ANEAQ-------YQQAVALAFEFDHKVVVEQGIKG--REIECAVLGN-DNPQ----ASTC
DDLA_SALTY      ANEAQ-------YQQAVALAFEFDHKVVVEQGIKG--REIECAVLGN-DNPQ----ASTC
DDL_BAUCH       INRIS-------FDQALALAFCFDDKVLVESAING--RELECAVLGN-HDPQ----ASLC
DDLA_CHRVO      KREAD-------LRAALDEAFRYDHKVLVEQAVIG--REIECAVLGN-ERPR----ASGC
DDLA_XANCP      RSAEE-------FSAALELALRYDHKVLVEAAIAG--REIECAVLGN-ATPQ----ASVC
DDLA_PSESM      SDEAG-------FAAALALGFEFDHKLLIEQGIVG--REVECAVLGN-DEAQ----VSVC
DDL_BLOFL       NDDYS-------FHSALDIAFFYSHKIIIESCIAG--RELECAVLGNNENPI----TSVC
DDL_WIGBR       NDFIS-------LKESIDVAFLYSKKILIEPFIQG--REIEVGVLGN-RNVI----SSVC
DDL_BIFAA       EHEGD----AAELAAAVYEASRHDWRILVEQGIDA--REIECAVLCPKAGEA--PQASWP
DDL_BIFLO       EKADDRETQQDRLAAAIATAGEHDWKVLVEQGIDG--REIECAVLCPKAGDE--PEASWP
DDL_CORGL       TAWED-------FNKAVGLARAHDEKVIVESEIVG--SEVECGVLQYPDGR---IVASVP
DDL_CORGB       TAWED-------FNKAVGLARAHDEKVIVESEIVG--SEVECGVLQYPDGR---IVASVP
DDL_COREF       SRWED-------LPAAVDLARQHDEKVIVESEIVG--PEVECGVLQYPDGR---IVASLP
DDL_MYCTU       SSWDQ-------LPAAVARARRHDPKVIVEAAISG--RELECGVLEMPDGT---LEASTL
DDL_MYCTA       SSWDQ-------LPAAVARARRHDPKVIVEAAISG--RELECGVLEMPDGT---LEASTL
DDL_MYCBP       SSWDQ-------LPAAVARARRHDPKVIVEAAISG--RELECGVLEMPDGT---LEASTL
DDL_MYCBO       SSWDQ-------LPAAVARARRHDPKVIVEAAISG--RELECGVLEMPDGT---LEASTL
DDL_MYCUA       SSFDE-------LPAAIAAARRHDPKVIVEAAING--RELECGVLEFPDGR---LEASTL
DDL_MYCLE       SSWGQ-------LPSAIAYARRHDPKVIVEAAVNG--RELECGVLEMPDGT---VAASAV
DDL_MYCSM       TAWDE-------LPAAVALARRHDPKVIVEAAVIG--RELECGVLEFPDGR---LEASTV
DDL_MYCS2       TAWDE-------LPAAVALARRHDPKVIVEAAVIG--RELECGVLEFPDGR---LEASTV
DDL_MYCSK       SDWAE-------LPAAIEAARRHDPKVIVEAGIAG--RELECGVLEYPDGR---VDASTI
DDL_MYCSS       SDWAE-------LPAAIEAARRHDPKVIVEAGIAG--RELECGVLEYPDGR---VDASTI
DDL_MYCSJ       SDWAE-------LPAAIEAARRHDPKVIVEAGIAG--RELECGVLEYPDGR---VDASTI
DDL_STRAW       DDLAG-------LDEAVAEAQRHDPKIIVEALLRG--REIECGVLEFEDG----PRASVP
DDL_STRCO       DDLAG-------LDEAIEEARRHDPKILVEAALRG--REIECGVLEFEDG----PRASVP
DDLA_PSEPK      SNALE-------YAAAFAIAAREDTKVLVEAAVCG--REIECGVLELEEGL----MASVV
DDL_LEGPC       NNMDE-------LNAAVADALRYDEEILVEEFIVG--REIELAVLENSIPCGK-PRVSMV
DDL_LEGPA       NNMDE-------LNAAVADALRYDEEILVEEFIVG--REIELAVLENSIPCGK-PRVSMV
DDL_LEGPL       NNMDE-------LNAAVADALRYDEEILVEEFIVG--REIELAVLENSIPCGK-PRVSMV
DDLA_BRADU      KTQDA-------LEAALDDAFRYDVKVLVQQGIDA--REIEVAVLEDETLF-----ASLA
DDLA_BRUME      VTEAD-------YQAAMSDGFIYDDKLLAEEFIQA--REVECGVLEDEGGA---LFVSRA
DDLA_BRUSU      VTEAD-------YQAAMSDGFTYDDKLLAEEFIQA--REVECGVLEDEGGA---LFVSRA
DDLA_RHILO      HDRDG-------FEQAVETALRYDSKALIEEFVDG--REIECSVLERADGS---LTVSPP
DDLB_BRADU      RSEEE-------FAASCALAFRYDRKILVEQALNGA-REIECSVLEESTGD---IRASGL
DDL_VIBCB       TNKQS-------VSQAVNDAFGYSEQVLVEKSVK--PRELEVAAYEMNGELH----ITKP
DDL_VIBPA       AEKQA-------IAKAVNDAFGYSDQVLVEKAVK--PRELEVAAYEMNGELH----ITKP
DDL_VIBVU       TKIEQ-------LSDAIDKAFGFSHQVLVEKAVK--PRELEVSAYEMNGQLH----ISKP
DDL_VIBVY       TNIEQ-------LSDAIDKAFGFSHQVLVEKAVK--PRELEVSAYEMNGQLH----ISKP
DDL_VIBCH       TTEDQ-------IAPAIEAAFGFSEQVLVEQAVK--PRELEVSAYEMNGKLY----ISKP
DDL_AERHH       SNEAD-------LVKGIADAFGYSEQVLIEKAVK--PRELEVAVYQYGDELV----ATYP
DDL_SHEON       DEASK-------VLGVLKDAFGYAPYVIVEKTIK--ARELEVAVYEYQGEVI----ATLP
DDL_LACBA       SNVQE-------YLDGVADAFRYDYKVLVEQTIDG-PQEVEISILGNEQPQA----SKLG
DDL_LACPL       ENEQE-------YLDGLADAFKYDYKILVEESIDN-PREVECSILGNENPKA----SKLG
DDL_LEUME       TNAEE-------YTEALSDSFQYDYKVLIEEAVNG-ARELEVGVIGNDQPLV----SEIG
DDL_LEUMM       TNAEE-------YTEALSDSFQYDYKVLIEEAVNG-ARELEVGVIGNDQPLV----SEIG
DDL_BORBU       YSENQ-------IESFIKEALKYDLTIVIEKFIEA--REIECSIIGNE-----KMKIFSP
DDL_CALS4       KNRDE-------LFDAIEIAIYYDRKIIVEEAVK-DPMEVNCSVMGIDRDLE-----ISL
DDL_THEM4       VDRKN-------FEEAVKNVLLFDNKVLVEKWI--NAREINCAVMGYKNIFV-----SEL
DDL_CAMJE       KDEKD-------LEYAKDVGFEFDNDLVVEEFKNN-IKEYNLAGCMIN-------DEFVF
DDL_WOLSU       KNRQE-------LDYALDVAFEFDEAALLEPFMQG-IKEYNLAGCKIN-------GEYHF
DDL_HELHP       NEEKE-------LDYGRDLAFEYDDTIIAESFKSG-VKEYNLAGCRVKNGSQ---DEYRF
DDL_HELPY       KEEKE-------LVYALDGAFEYSKEVLIEPFIQG-VKEYNLAGCKIK-------KDFCF
DDL_HELPJ       KEEKE-------LIYALDSAFEYSKEVLIEPFIQG-VKEYNLAGCKIK-------KGFCF
                                           . :        :                     

DDL_ACTP2       VQIIPEGE------FYDYHAKYISD----NT-QYLVPA-LSDDR-QAEVAELVKAAYEVV
DDL_HAEDU       VQIIPDGE------FYDYHAKYLSD----KT-QYIVPA-LTNER-QAEVAKIVKAAYDVV
DDL_ACTSZ       VQIVPEGE------FYDYNAKYISD----NT-RYICPMPMSDER-WDELKNLVKRAYEAV
DDL_MANSM       VQIIPEGE------FYDYDAKYISD----NT-RYICPAPMSEES-LQELQKLVKRAYDVV
DDL_HAEI8       IRIVPEGE------FYDYEAKYISD----NT-QYFCPAGLTPER-EQELAILVKRAYDAL
DDL_HAEIG       IRIVPEGE------FYDYEAKYISD----NT-QYFCPAGLTPER-EQELAILVKRAYDAV
DDL_HAEIN       IRIVPEGE------FYDYEAKYISD----NT-QYFCPAGLTPER-EQALSTLVKRAYDAV
DDL_HAES1       IKIVPQGE------FYDYEAKYIAD----NT-QYFCPSGLTEER-EQELRQLVKQAYDVV
DDL_PASMU       IRIVPEGE------FYDYEAKYISD----NT-QYFCPSGLSAER-EDELKQLVKQAYDVV
DDL_YERPE       IRIQPPGV------FYDYDAKYLSD----KT-QYFCPSGLSDES-EQQLAALALQAYHAL
DDL_YERPA       IRIQPPGV------FYDYDAKYLSD----KT-QYFCPSGLSDES-EQQLAALALQAYHAL
DDL_YERPN       IRIQPPGV------FYDYDAKYLSD----KT-QYFCPSGLSDES-EQQLAALALQAYHAL
DDL_YERPP       IRIQPPGV------FYDYDAKYLSD----KT-QYFCPSGLSDES-EQQLAALALQAYHAL
DDL_YERPS       IRIQPPGV------FYDYDAKYLSD----KT-QYFCPSGLSDES-EQQLAALALQAYHAL
DDL_YERP3       IRIQPPGV------FYDYDAKYLSD----KT-QYFCPSGLSDES-EQQLAALALQAYHAL
DDL_PHOLL       IRIQPAAV------FYDYDAKYWSE----ET-QYFCPSGLSDEK-EQQLAELALKAYQSV
DDL_PECAS       IRIQPAGT------FYDYEAKYLSD----DT-QYFCPSGLSDEQ-EQALAALAMAAYRAV
DDLB_ECOLI      IRIQPSGT------FYDYEAKYLSD----ET-QYFCPAGLEASQ-EANLQALVLKAWTTL
DDLB_SHIFL      IRIQPSGT------FYDYEAKYLSD----ET-QYFCPAGLEASQ-EANLQALVLKAWTTL
DDLB_ECO57      VRIQPSGT------FYDYEAKYLSD----ET-QYFCPAGLEASQ-EANLQALVLKAWTTL
DDLB_ECOL6      IRIQPAGT------FYDYEAKYLSD----ET-QYFCPAGLEALQ-EANLQALVLKAWTTL
DDL_SALPA       IRIQPAGT------FYDYEAKYLSD----ET-QYFCPAGLEASQ-EAALQSLVLQAWKAL
DDLB_SALTI      IRIQPAGT------FYDYEAKYLSD----ET-QYFCPAGLEASQ-EAALQSLVLQAWKAL
DDLB_SALTY      IRIQPAGT------FYDYEAKYLSD----ET-QYFCPAGLDASQ-EAALQSLVLQAWKAL
DDL_BUCBP       IRICPENT------FYNYNSKYLSN----RT-TYFCPSGLNKLK-ELELKKITLTAWNII
DDL_BUCAP       IKIITKNN------FYDYSSKYIES----ST-EYICPSGLNYQK-EEELKKIVEIAWNSL
DDL_BORBR       IEIVAPGG------NYDYEHKYFSD----DT-QYFCPA-DLPADVAADVAAVAERAYAAL
DDL_BORPE       IEIVAPGG------NYDYEHKYFSD----DT-QYFCPA-DLPADVAADVAAVAERAYAAL
DDL_BORPA       IEIVAPGG------NYDYEHKYFSD----DT-QYFCPA-DLPADVAADVAAVAERAYAAL
DDL_BORA1       IEIVAPDG------NYDYQNKYFTD----VT-QYFCPA-DLPVGVAEQIEKIAVQAYRAL
DDL_RALSO       IRIVAPQA------NYDYQHKYFTD----DT-RYECPA-PIPAEAAARVQALVVQAYRSL
DDL_JANMA       VEIIAPQG------NYDYEHKYFSD----DT-QYLCPA-PFDAAFTKRVQALAVSAFNAV
DDL_NITEU       VRIDVAEG------LYDYQAKYFSE----ST-RYTCPS-GLSAALTTRIQEQALYAHRIL
DDL_NITEC       VRIDVTEG------LYDYQAKYFSE----ST-RYTCPS-GLSKILTTRIQEQALYAHRIL
DDLB_CHRVO      IKIEPATE------YYDYQAKYFRD----DT-VYRCPS-GLAPEVEARARELALKAFKVL
DDL_METFK       IRIVPANE------FYDYEAKYLRD----DT-QYLCPC-GLDASLEEQIKAEALQAFRIV
DDL_NEIMB       IHIIPATE------FYDYEAKYNRD----DT-IYQCPSEDLTEAEESLMRELAVRGAQAI
DDL_NEIMF       IHIIPATE------FYDYEAKYNRN----DT-IYQCPSEDLTEAEESLMRELAVRGAQAI
DDL_NEIMA       IHIIPATE------FYDYEAKYNRN----DT-IYQCPSEDLTEAEESLMRELAVRGAQAI
DDL_NEIG1       IHIIPATE------FYDYEAKYNRD----DT-IYQCPSEDLTEAEESLMRELAVRGAQAI
DDL_PSEE4       IALGTPHV------FYDYDAKYIAN----DT-QYRIPC-GLDSVKEQELIDLTARACDAI
DDLB_PSEPK      IALGTPHV------FYDYDAKYIVN----DT-QYRIPC-GLDSVKEQELIDLTARACDAI
DDL_PSEPF       IALGTPHT------FYDYDAKYIAN----DT-QYRIPC-GLDAAKEKELMDLTAQACEAL
DDLB_PSESM      IGLGTPHS------FYDYDAKYLAS----DT-QYRIPC-GLDDAQEQQLKQLAARACDAI
DDLB_PSEAE      IRLGTPHT------FYDYDAKYLAS----DT-RYQVPC-GLDEAKERELKELTARACDAL
DDL_SACD2       IGLKTDHV------FYDYDAKYVSN----TT-QYLCPC-GLTQEKEAELQSIAQQAFAAV
DDL_XANAC       IRIVPKGQ------WYDYNAKYIAD----DT-QYLCP--GLEGEAEAQIRQLALDAFRAA
DDLB_XANCP      IRIVPKGQ------WYDYNAKYIAE----DT-QYLCP--GLDGDAEAQIGQLALDAFRAA
DDL_XYLFA       IRIVPQGQ------WYDYNAKYLAE----DT-QYVCP--GLDDVAEAEIARLALAAFRAV
DDL_XYLFT       IRIVPQGQ------WYDYNAKYLAE----DT-QYVCP--GLDDVAEAEIAQLALAAFHSV
DDL_RHIME       TEIIPQGH-----AFYDYDSKYVKG----GS-KHVIPAQISPNI-YQKIQTLALKAHQAI
DDL_SINMW       TEIIPQGH-----AFYDYDSKYVKG----GS-KHVIPAQVSPNI-YQKIQTLALKAHQAI
DDLB_RHILO      CEIIPTGH-----SFYDYDSKYVAG----GS-KHECPAKVSPNI-YQKIQTLALKAHQAV
DDL_AGRFC       TEVVPLGH-----NFYDYDAKYAAG----GS-KHVIPAGISPKI-YQKIQTLAVMAHQAI
DDLB_BRUME      CEIMPVGY-----QFYDYDSKYVAG----AS-THVCPAKILPNI-YQKIQTMALTAHRAI
DDLB_BRUSU      CEIIPVGY-----QFYDYDSKYVAG----AS-THVSPAKILPNI-YQKIQTMALTAHRAI
DDL_OCHA4       CEIIPVGH-----QFYDYDSKYVAG----AS-SHVCPAKILPNI-YQKIQTMALTAHRAI
DDL_CHESB       CEIVPVGH-----SFYDYDSKYAPG----GS-RHVCPAEISPNI-YQKIERLALKAHQAI
DDL_BARHE       CEILPEKHF----QFYDYDSKYKSG----GS-LHVCPAQLSSNI-YQNVQRMSLAAHQAI
DDL_BARQU       CEIFPDKHF----QFYNYDSKYKSG----GS-LHICPAQLSPNI-YQNVQRMSLAAHQAI
DDL_BARBK       CEIVPKECF----QFYDYDSKYKSG----GS-LHICPAKLSSNI-YQNVQRMSLAAHQAI
DDL_GLUOX       TDILPSETA----AFYDFEAKYKAG----GS-RHVVPAELPQAV-TDRALDYALRAHQTL
DDL_GRABC       TDIRPR--S----AFYDYESKYAEG----GS-RHILPAQMHPDA-FKRALDVALAAHHAL
DDL_CAUVC       TDIRAS--T----GFYDYEAKYSEG----GS-IHVLPAPIPNAV-RDRAMRMAELAHTAL
DDL_RICB8       LEIKLLKN-----RFYDYETKYTEG----FA-EHLCPAPLPTDI-YDKLLKESEKIYNTM
DDL_RICBR       LEIKLLKN-----RFYDYETKYTEG----FA-EHLCPAPLPTDI-YDKLLKESEKIYNTM
DDL_RICCN       LEIKLLKN-----RFYDYETKYTEG----FA-DHLCPAPLPANL-YEKLLIESEKIYKTM
DDL_RICRS       LEIKLLKN-----RFYDYETKYTAG----FA-DHLCPAPLPANL-YEKLLIESEKIYKTM
DDL_RICM5       LEIKLLKN-----RFYDYETKYTEG----FA-DHLCPAPLPANL-YEKLLIESEKIYKTM
DDL_RICFE       LEIKLLKN-----RFYDYETKYTEG----FA-EHLCPAPLPTNL-YEKLLVESEKIYKTM
DDL_RICPR       LEIKLLKN-----RFYDYETKYNEG----FA-EHVCPAPLPANL-YKKLLIESEKIYKTI
DDL_RICTY       LEIKLLKN-----RFYDYETKYNKG----FA-KHVCPAQLPANL-YKKLLIESEKIYKTI
DDL_FUSNN       LKIIPQAD-----VLYDYDSKYAKG----GS-VHEFPAKIENKS-YKEAMKIAEKIHSEF
DDL_THEMA       LELRPKRR------FYDYVAKYTKG----ET-EFILPAPLNPSE-ERLVKEMALKAFVEA
DDL_THEP1       LELRPKRR------FYDYVAKYTKG----ET-EFILPAPLNPSE-ERLVKETALKAFVEA
DDL_PSELT       LELKPKRR------FYDYTAKYVSG----MT-EFILPAPLSVEE-YQKVANSSLRAFELC
DDL_FERNB       LELRPKKL------FYDYEAKYTDG----MT-EFIIPAELDGET-TEKINHAVLKIYKSL
DDL_AQUAE       VEIIPKKG------VYDYECKYTKG----MS-EYRILK--DEKL-SKKLQEISLKISKFL
DDL_CARHZ       IEIVSKTR------FYDYEAKYTPG----LS-EHIIP-PRIAPELSQKAIEYARKTYKAL
DDL_MOOTA       IEIVSHTG------FYDYQAKYTPG----LS-DHIIP-PRLPDDVLAAATSLAGRTYALL
DDL_SYNJB       IEIIPAQGD-----FYDYEAKYAPG----GS-RHLIP-CSLSPAGLARCEAAGLKAYQAL
DDL_SYNJA       IEIIPAQGD-----FYDYEAKYAPG----GS-RHLIP-CSLSAAGLARCEAAGLRAYRVL
DDL_GLOVI       IEIVPQGRD-----FYDYEAKYAPG----GS-RHLIP-PNLAADVLKASVDAAYRACRAV
DDL_MAGMM       IEIVPIDG------FYDYDHKYTAG----RT-NYLVPAPNLDDKSLEAVVKIGLAAYHIT
DDL_DESVH       ILIRPAEGA-----FFDYTSKYTPG----GA-TELCPAPLPAEV-TAHVQDVTLRAHRLL
DDL_DESVV       ILIRPAEGA-----FFDYTSKYTPG----GA-TELCPAPLPAEV-TAHVQDVTLRAHRLL
DDL_DESAG       ILIRPLGAG-----FFDYASKYTPG----QA-EELCPAPLPGEV-TAKVREYALRAHRAL
DDL_LAWIP       ILIRS-QGK-----FFDYYNKYAKN----GA-EEICPAPLEPHV-LKHIQEYALRAHNTL
DDLA_PSEAE      GEILLGGQE-----VFDYEHKYQAG----AV-REVFPADLPPAI-AAEAQRLALKVHRAL
DDL_BACAN       ISIRHAAE------FFDYNAKYDDA----STIEEVIELP---AELKERVNKASLACYKAL
DDLA_BACCR      VSIRHAAE------FFDYNAKYDDT----STVEEVIELP---AQIKERVNKASLTCYKAL
DDLA_CLOTE      LSIKTKEE------FFNYKAKYFEG----VAEEKVADLS---LELKDQVEKISNKCWKSF
DDL_CLOB1       LAIRPHAE------FFDYTAKYADG----GSDEVVIELE---ENLHKKVEEMALACWKEL
DDL_CLOBH       LAIRPHAE------FFDYTAKYADG----GSDEVVIELE---ENLHKKVEEMALACWKEL
DDL_CLOBL       LAIRPHAE------FFDYTAKYADG----GSDEVVIELE---ENLHKKVEEMALACWKEL
DDLA_CLOPE      LAIKPKGK------FFDIASKYGDG----GADEFIVELN---EDLHKEVEKMALETYKLL
DDL_CLOPS       LAIKPKGK------FFDIASKYEDG----GADEFIVKLN---EDLHKEVEKMALETYKLL
DDLB_CLOPE      LEIKSKAD------FYDYKQKYAAN----GAEHLPVQLE---KSLYDEVKEMALKTFEVL
DDL_LACSS       IEIEVNDG------WYDFEHKFVTG----NTTKFVTPPNNLPDDVHEAMKQMALDAMHAL
DDL_PEDPA       IEIVVNDG------WYDYEHKFQTG----STTKFVTPPE-IEDDVHDEMKRVAVQTMDAL
DDL_BACFR       TEVVTHNE------FFDYDAKYN-G----QV-DEITPARISEEL-TRRVQTLTSAIYDIL
DDL_BACFN       TEVVTHNE------FFDYDAKYN-G----QV-DEITPARISEEL-TRRVQTLTSAIYDIL
DDL_BACTN       TEVVTHNE------FFDYDAKYN-G----QV-DEITPARISDEL-TNRVQMLTSAIYDIL
DDL_BACV8       TEVVSANE------FFDYGAKYN-G----ES-QEITPARLPEDT-AERVRLLTSAIYDIL
DDL_PORGI       TEVVAHNE------FFDFDAKYN-G----AV-EEITPARISDEA-TRLIQTMTARIYELL
DDL_LEPBJ       TEIVPGGE------FFDFESKYKQG----GS-REITPARISKQE-MTRVQELAIDAHTSL
DDL_LEPBL       TEIVPGGE------FFDFESKYKQG----GS-REITPARISKQE-MTRVQELAIDAHTSL
DDL_LEPIN       TEIVPGGE------FFDFESKYKQG----GS-HEITPARISEQE-MKRVQELAIAAHRSL
DDL_LEPIC       TEIVPGGE------FFDFESKYKQG----GS-HEITPARISEQE-MKRVQELAIAAHRSL
DDL_TROW8       SELVFVKH------SGSKFYDYSAK----YLNPVEFVIPAQFDN-TDGYAEIASKVFFEL
DDL_TROWT       SELVFVKH------SGSKFYDYSAK----YLNPVEFVIPAQFDN-TDGYAEIASKVFFEL
DDL_TREPA       GEVIAQGA------FYDYEEKYADA----SVARVLVTAPLETAQ-YEQITTLALRAYEAL
DDL_NOSS1       GEITFN------SDFYDYETKYT------AGKADLLIPAIIPDDISRQIQNMALQAFAAV
DDL_TRIV2       GEITFN------SDFYDYETKYT------AGKADLLIPAVIPDEISRQIQDMALQAFAAV
DDL_TRIEI       GEITYN------SDFYDYETKYT------EGKADLHIPARVSEAIATKIKEMATQAFLAV
DDL_SYNY3       GEITYD------SDFYDYETKYT------DGRSQMHIPANLPKAVVNQIQTMAIQAFKAV
DDL_SYNP6       GEITYD------SDFYDYETKYT------DGKAQLLIPAQLSAELQQKLQELAIAAFQAV
DDL_SYNE7       GEITYD------SDFYDYETKYT------DGKAQLLIPAQLSAELQQKLQELAIAAFQAV
DDL_THEEB       GEITYS------SEFYDYETKYT------DGRAQLHIPAEIPPAVSEQIRSLSLQAFQAL
DDL_PROM3       GEICFD------ADWYDYDTKYS------ENCSHTLIPAPLPEGVEAQIRTLALQACRCV
DDL_PROMM       GEICFD------ADWYDYDTKYS------ENCSHTLIPAPLPEGVEAQIRTLALQACRCV
DDL_SYNS3       GEISFE------ADWYDYETKYT------DGCSQTLIPAPLPDQVSAQIQAIALQACTAV
DDL_SYNSC       GEVRFD------ADWYDYETKYT------AGRSTTLIPAPLPDPVRDRIREQALQACAAV
DDL_SYNS9       GEVRFD------ADWYDYTTKYT------AGLSTTVIPAELPEGVAERVQQQALEACAAL
DDL_SYNPX       GEVRFD------ADWYDYETKYT------DGRSTTLIPAPLPDGIVEAIRSQSIQACAAV
DDL_PROMA       GEVRYS------SDWYDYDSKYS------KNSTKTLIPAPIPEKISKEVQSLSILACKAI
DDL_PROM1       GEVKFQ------TDWYTYESKYN------ANLSSTIIPADLNIEISNKIQKLAIEACKAI
DDL_PROMT       GEVKFQ------TDWYTYESKYN------ANLSSTIIPADLNIEISNKIQKLAIEACKAI
DDL_PROMS       GEVNYK------SDWYDYNSKYH------SN-NKIIIPAEIDSKISKEIKEIAIKSCRAL
DDL_PROM0       GEVNYE------SDWYDYDSKYH------SN-NKIIIPAEIDSKITNEIKEIAIKSCRAL
DDL_PROM9       GEVEYG------SDWYDYDSKYN------SN-NKITIPAKIDSKITKQIKEIAIQSCRTL
DDL_PROM2       GEIKYE------SDWYDYDSKYY------SN-NKIIIPAEIDSKITKEIKKIAIQSCRAL
DDL_PROM5       GEVSYS------SDWYDYDSKYS------TD-NKIIIPADIDSQISEQIKDLAIRSCRAL
DDL_PROMP       GEVSYS------TDWYDYDSKYS------MD-NQIIIPADIDSQISEQIKDIAIRSCRAL
DDL_DEIGD       GELRFE------ADFYDYETKYT------EGRATMHIPAPLPPEIAERVRMLALTAFRTL
DDL_DEIRA       GELSFD------ADFYDYETKYT------EGRAEMHIPARIPPEVSERIRTEALRAFRAL
DDL_BACLD       GEIAPK------KDFYDYKAKYE------DGDTDLIIPASLTEDEYETMRSMAVKAFQAI
DDL_BACSU       GEIAPK------TDFYDYKAKYE------DGDTDLMIPAIVTDEEYATISDMAIKAFKAI
DDL_BACP2       GEIAPK------TDFYDYKAKYE------DGDTDLIIPASVSEDEYKTIHDMAIKAFKSL
DDLB_BACCR      GEIVPK------KDFYDYKSKYI------DGDTALIIPAEMTEEESNVIKRDAIIAFQSL
DDL_GEOKA       GEIVPK------KEFYDYEAKYE------DGQTELIIPADVTKEQYETIKQMAITAFQVL
DDL_GEOTN       GEIVPK------KEFYDYEAKYE------DGQTELIIPANVTEEQYETIKSMAIAAFKAL
DDL_LISMO       GEILPEG---AVATFYDYKAKYQ------DNNTALIIPTEVDPEILEQMKEYAIQAFLGL
DDL_LISMF       GEILPEG---AVATFYDYKAKYQ------DNNTALIIPTEVDPEILEQMKEYAVQAFLGL
DDL_LISIN       GEILPEG---AVAKFYDYKAKYQ------DNNTALIIPTEVEPEILEQMKEYAVQAFLGL
DDL_LISW6       GEILPEG---AVATFYDYKAKYQ------DNNTALIIPTEVDPEILEQMKEYAVQAFLGL
DDL_STAAB       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAAC       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAA1       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAAM       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAAN       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAA8       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAAE       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAA3       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAAS       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAAW       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAAR       GEVVKD------VAFYDYKSKYK------DGKVQLQIPADLDEDVQLTLRNMALEAFKAT
DDL_STAES       GEVVKD------VAFYDYKSKYK------DGKIRLDIPADLDQDVQMTLRNMALEAFKAT
DDL_STAEQ       GEVVKD------VAFYDYKSKYK------DGKIRLDIPADLDQDVQMTLRNMALEAFKAT
DDL_STAHJ       GEVIKD------VAFYDYKSKYK------DGKISLQIPAELDEEVQMTLRNMALEAFKAT
DDL_STAS1       GEVIKE------VAFYDYKAKYK------DGKIKLDIPADLDEEVQMTLRNMAVEAFKAT
DDL_ENTFA       GEVVKD------VAFYDYDAKYI------NNTIEMQIPAHVPEEVAHQAQEYAKKAYIML
DDL_ENTHA       GEVVKD------VAFYDYDAKYI------NNKIEMQIPAEVPEEVYQKAQEYAKIAYTML
DDL_LACLM       GEVVKD------VGFYDYNSKYI------DNKIQMDIPAKVSADLAQKIQEYAKKAYKAV
DDL_LACLA       GEVVKD------VEFYDYNSKYI------DNKIQMDIPAKVPADLAQKMQEYAIKAYKAV
DDL_STRA1       GEVVKD------VDFYDYDAKYI------DNKITMDIPAKVDEATMEAMRQYASKAFKAI
DDL_STRA3       GEVVKD------VDFYDYDAKYI------DNKITMDIPAKVDEATMEAMRQYASKAFKAI
DDL_STRA5       GEVVKD------VDFYDYDAKYI------DNKITMDIPAKVDEATMEAMRQYASKAFKAI
DDL_STRT2       GEVVKD------VAFYDYQAKYI------DNKITMDIPARVPVEVMTQMRAYAAKAFRAL
DDL_STRT1       GEVVKD------VAFYDYQAKYI------DNKITMDIPARVPVEVMTQMRAYAAKAFRAL
DDL_STRTD       GEVVKD------VAFYDYQAKYI------DNKITMDIPARVPVEVMTQMRAYAAKAFRAL
DDL_STRP1       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRPM       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRPB       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRPC       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRP8       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRPG       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRPD       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRP3       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRP6       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRPF       GEVIKD------VDFYDYQAKYV------DNKITMAIPADVDQSIVTEMRSYAEVAFKAL
DDL_STRMU       GEIVKD------VAFYDYEAKYI------DNKITMAIPAEIDPVIVEKMRDYAATAFRTL
DDL_STRR6       GEVVKD------VAFYDYDAKYI------DNKVTMDIPAKISDDVVAVMRQNAETAFRAI
DDL_STRP2       GEVVKD------VAFYDYDAKYI------DNKVTMDIPAKISDDVVAVMRQNAETAFRAI
DDL_STRPN       GEVVKD------VAFYDYDAKYI------DNKITMDIPAKISDDVVAVMRQNAETAFRAI
DDL_CLOAB       GEIVPA------KEFYDYEAKYE------NAASKLLIPANLSNENLEKIKNIAIEVYKAL
DDL_CLONN       GEIVPA------NEFYDYEAKYS------NAQSKLLLPANLSPEKLEKVKELAVRIFKML
DDLB_CLOTE      GEIIPA------KEFYDYEAKYQ------NENSELLIPANIDNIKQEEIKELAIKIYKLL
DDL_CALS8       GEIVPS------REFYSYEAKYI------DGSSELIIPAKLEKQVEDEIKELAVKIYKLF
DDL_CHLPD       GEIEPG------SEFYDYADKYI------HNAAKMYIPARISPELQEQVRKDALRAYKAL
DDL_PELLD       GEIEPG------SEFYDYEDKYI------HDTAKLFIPARIPGDLQEKVREAALCAYRAL
DDL_CHLCH       GEIEPG------KEFYDFQDKYM------GNSAKLFIPARIPESLQEEVRRSALTAYRAL
DDL_CHLTE       GEIIPG------SDFYSYEDKYI------KNEAKIVIPADLPEGVAEEVRKAALTVFKAL
DDL_COXBU       GEIIPH------HDYYSYDAKYLD-----PNGATTTTSVDLSESVTKQIQQIAIDAFKMV
DDL_SOLUE       CEILPS------REFYDYEDKYL------LDMARTQVPADLPGERTDEIRRLAVECYRAV
DDL_BACSK       GEILP------QDGFYSYDAKYID-----EDGAKLAIPADLPEDVNRRIQDIAIQAYKTL
DDL_OCEIH       GEILP------TGDFYSYEAKYID-----ETGAVLQIPAKLEEPVVDSIQDIALQAFKAL
DDLA_ECOLI      GEIVL------TSDFYAYDTKYID-----EDGAKVVVPAAIAPEINDKIRAIAVQAYQTL
DDLA_ECO57      GEIVL------TSDFYAYDTKYID-----EDGAKVVVPAAIAPEINDKIRAIAVQAYQTL
DDLA_SHIFL      GEIVL------TSDFYAYDTKYID-----EDGAKVVVPAAIAPEINDKIRAIAVQAYQTL
DDLA_ECOL6      GEIVL------TSDFYAYDTKYID-----EDGAKVVVPAAIAPEINDKIRAIAVQAYQTL
DDLA_SALTI      GEIVL------NSEFYAYDTKYID-----DNGAQVVVPAQIPSEVNDKIRAIAIQAYQTL
DDLA_SALTY      GEIVL------NSEFYAYDTKYID-----DNGAQVVVPAQIPSEVNDKIRAIAIQAYQTL
DDL_BAUCH       GEIVL------SDNFYSYEKKYLN-----EHGAVVVVPAAISKEVSNNIQKIAVRAFQAL
DDLA_CHRVO      GEIVL------SDEFYAYDTKYLN-----EDGARVAVPADIPDEACQRIRGIAIEAFQAL
DDLA_XANCP      GEVVV------HDAFYSYQTKYIR-----DDGAATVIPADIDAHTQHRIQQCALQAYQAL
DDLA_PSESM      GEVVA------NDEFYAYDTKYLN-----GDQARIAIPAELPADLSDQVRDVALQAYKVL
DDL_BLOFL       GEIIKK-----NDDFYTYCDKYVD-----HN-SEIVIPAVLEKSVSSKIRSIAIRVFQIL
DDL_WIGBR       GEIKF------KKIFYDYKEKYIS-----KK-TKIIIPAKISNEISNKIKKIAKLAFISL
DDL_BIFAA       GEIVLDKRAEGDDQFYDFDSKYMD-----AAASHVEVPANLPEETLNLVRETAKKAFVAV
DDL_BIFLO       GEIVLDHQN--DDQFYDFDSKYMD-----ASASHVEVPANLPVSVLEDVRDVARRAFKAV
DDL_CORGL       ALLS--GTESGAGGFYDFDTKYLD------NVVTAEIPAPLDEKTTELIQSLAVESFQAL
DDL_CORGB       ALLS--GTESGAGGFYDFDTKYLD------NVVTAEIPAPLDEKTTELIQSLAVESFQAL
DDL_COREF       AMLR--GTEDGEGGFYDFDTKYLD------NVVTAEIPAPLDEEIIELVQSLAVETFQAL
DDL_MYCTU       GEIRVAGVRGREDSFYDFATKYLD------DAAELDVPAKVDDQVAEAIRQLAIRAFAAI
DDL_MYCTA       GEIRVAGVRGREDSFYDFATKYLD------DAAELDVPAKVDDQVAEAIRQLAIRAFAAI
DDL_MYCBP       GEIRVAGVRGREDSFYDFATKYLD------DAAELDVPAKVDDQVAEAIRQLAIRAFAAI
DDL_MYCBO       GEIRVAGVRGREDSFYDFATKYLD------DAAELDVPAKVDDQVAEAIRQLAIRAFAAI
DDL_MYCUA       GEIRVAGVRGREDGFYDFETKYLD------DAAELDVPAKVEDDVADAVRQLAIRAFEAI
DDL_MYCLE       GEIRVAGVSGSEDSFYDFTTKYLD------DAAELDVPAKVDDDVADEVRQLAIQAFRAI
DDL_MYCSM       GEIRVAGVRGREDGFYDFATKYLE------DAAELDVPAKVDDDVADEIRQLAVRAFTAI
DDL_MYCS2       GEIRVAGVRGREDGFYDFATKYLE------DAAELDVPAKVDDDVADEIRQLAVRAFTAI
DDL_MYCSK       GEIRVAGVRGREDGFYDFATKYLD------DGAELDVPAKVEDDVADEIRRLAIRAFRAI
DDL_MYCSS       GEIRVAGVRGREDGFYDFATKYLD------DGAELDVPAKVEDDVADEIRRLAIRAFRAI
DDL_MYCSJ       GEIRVAGVRGREDGFYDFATKYLD------DGAELDVPAKVEDDVADEIRRLAIRAFRAI
DDL_STRAW       AEIP----PAQSHAYYDFEAKYID------STPGI-VPAPLTPEETAEVRRLAVEAFEAT
DDL_STRCO       AEIP----PPSEHAYYDFEAKYID------STPGI-VPAPLTAEETAEVQRLAVAAFDAA
DDLA_PSEPK      GEII----KKEGHAYYDYQAKYDS-----NSVTGLRVPSLLPPDIVARIQALSVQAFRCL
DDL_LEGPC       GEIK----VNHPDGYYSYTAKYLE-----SSQTDLIIPAQLNNSLEEQLKQAAANIFSYL
DDL_LEGPA       GEIK----VNHPDGYYSYTAKYLE-----SSQTDLIIPAQLNNSLEEQLKQAAANIFSYL
DDL_LEGPL       GEIK----VNHPDGYYSYTAKYLE-----SSQTDLIIPAQLNNSLEEQLKQAAANIFSYL
DDLA_BRADU      SELN----PNAHHEFYSYEAKYLD-----PDGARVDLPARLDAAQMERVRSLATRVFAAL
DDLA_BRUME      GEIV----PAESHCFYSYDAKYID-----ADGTEIKVPAELPEQVENEIRAIAAKAFRVL
DDLA_BRUSU      GEIV----PAESHCFYSYDAKYID-----ADGTEIKVPAELPEQVENEIRAIATRAFRVL
DDLA_RHILO      GEII----PADKHGFYTYEAKYFD-----AEGAVVKVPADVPADVVARTSEMAARAFRAL
DDLB_BRADU      GEIV----RASEHGFYSYQAKYID-----ADGAALHIPADLPLLQARRLQELAVEVFNVL
DDL_VIBCB       GEVIAPD-----GAFYSYDEKYSTS----SHSLTEVEAKNLTEEQVEAIRVASETVFKQM
DDL_VIBPA       GEVIAPD-----GAFYSYDEKYSSS----SHSLTEVEAKNLTQEQIDKIRHASETVFKQM
DDL_VIBVU       GEIIAPD-----GAFYSYDEKYSAG----SHSITEVEAKNLTEQQLATIQLCSEKVFRQM
DDL_VIBVY       GEIIAPD-----GAFYSYDEKYSAG----SHSITEVEAKNLTEQQLATIQLCSEKVFRQM
DDL_VIBCH       GEVIAPE-----GTFYSYEEKYSAN----SHARTVLEAENLTEKHKELIQTYAERVFIHM
DDL_AERHH       GEICVPQ-----DKFYTYEEKYSSA----SHTETALRAEGLTQAQADAIHEYALKAFRQL
DDL_SHEON       GEIICDS-----NTFYTFDEKYAKS----SKARTDVVAQNVPTDISDQIRAYAIKAFKGM
DDL_LACBA       AIRVPES-----DVFYDYNNKFVDA----SGVTFEVPVK-LSDELTQEITQMGLQTYAAL
DDL_LACPL       AIDVPKT-----DTFYDYNNKFVDA----SGVTFELPVE-LPADLTKRIQQMSLDAFKAL
DDL_LEUME       AHTVPNQGS--GDGWYDYNNKFVDN----SAVHFEIPAQ-LSPEVTKEVKQMALDAYKVL
DDL_LEUMM       AHTVPNQGS--GDGWYDYNNKFVDN----SAVHFEIPAQ-LSPEVTKEVKQMALDAYKVL
DDL_BORBU       GEVVVQDFI-----FYDYDAKYSVIP---GNSIIFNIPAHLETNQLLSIKEYAFLTYKNL
DDL_CALS4       CEMPVPW-----EEFLSYQDKYMRKEKGGKGSTTRQIPAPIPEEKTKEIQELAKKVFQIL
DDL_THEM4       EEINKK------NDFFNFEEKYFKK---GKKFSNHIIPARIDENLKNKIKEIAKDTFKIL
DDL_CAMJE       SIIEEPKK----KEFLDFEQKYLSF-----SGHNELIEADLSEELKEKLKDSFKKIYNPL
DDL_WOLSU       SIIEEPQK----KEFLDFDKKYLDF-----SRTQKLLKADLSEASERLLKEAFIKLYDDS
DDL_HELHP       SIIEEPSK----KELLDFERKYLDF-----SRTAQVLQADISSALVAKLQENFMKLYENA
DDL_HELPY       SYVEEPNK----QEFLDFKQKYLDF-----SRN-KAPKANLSNALEEQLKENFKKLYNDL
DDL_HELPJ       SYVEEPNK----QEFLDFKQKYLDF-----SRT-KAPKANLSNALEEQLKENFKKLYNDL
                                    .:                                      

DDL_ACTP2       GCRGWSRIDVMEDANG----HFNLVEVNTCPGMTSHSIFPKSAATVGIPFEKLVERVLEL
DDL_HAEDU       GCRGWSRIDVMEDQNQ----NFRLVEVNTNPGMTSHSIFPKSAATMGISFEKLVERVLEL
DDL_ACTSZ       GCRGWSRIDVMTDSEG----NFRLIEVNTTPGMTSHSLFPKSAATVGYSFEKLVEKILEL
DDL_MANSM       GCRGWSRIDVMTDANG----NFRLVEVNTTPGMTSHSLFPKSAATVGYSFEQLVVKILEL
DDL_HAEI8       GCRGWSRIDVMCDAKG----NFRLVEVNTNPGMTSHSLFPKSAATVGISFEQLVVKILEL
DDL_HAEIG       GCRGWSRIDVMCDAKG----NFRLVEVNTNPGMTSHSLFPKSAATVGISFEQLVVKILEL
DDL_HAEIN       GCRGWSRIDVMCDAKG----NFRLVEVNTNPGMTSHSLFPKSAATVGISFEQLVVKILEL
DDL_HAES1       GCRGWSRIDVMLDGEG----KFRLVEVNTNPGMTSHSLFPKSAATVGYSFEQLVVKILEL
DDL_PASMU       GCRGWSRIDVMLDGND----AFRLVEVNTNPGMTSHSLFPKSAATVGYSFEQLVVKILEL
DDL_YERPE       DCSGWGRVDVMQDRDG----HFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILML
DDL_YERPA       DCSGWGRVDVMQDRDG----HFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILML
DDL_YERPN       DCSGWGRVDVMQDRDG----HFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILML
DDL_YERPP       DCSGWGRVDVMQDRDG----HFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILML
DDL_YERPS       DCSGWGRVDVMQDRDG----HFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILML
DDL_YERP3       DCSGWGRVDVMQDRDG----HFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILML
DDL_PHOLL       GCSGWGRVDVMMDTDG----DFYLLEVNTSPGMTSHSLVPMAARQAGLSFSQLVVKILEL
DDL_PECAS       DCSGWGRVDFMLDSDD----AFYLLEVNTSPGMTSHSLVPMAARQRGLTFSQLVVKILEL
DDLB_ECOLI      GCKGWGRIDVMLDSDG----QFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILEL
DDLB_SHIFL      GCKGWGRIDVMLDSDG----QFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILEL
DDLB_ECO57      GCKGWGRIDVMLDSDG----QFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILEL
DDLB_ECOL6      GCKGWGRIDVMLDSDG----QFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILEL
DDL_SALPA       GCTGWGRIDVMLDSDG----QFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILEL
DDLB_SALTI      GCTGWGRIDVMLDSDG----QFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILEL
DDLB_SALTY      GCTGWGRIDVMLDSDG----QFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILEL
DDL_BUCBP       DGTGWGRVDVIMDYKN----KFWLLEANTCPGMTDHSLFPMSAKKAGISYQILVQKILEL
DDL_BUCAP       GCKGCGRIDAILDNKD----KFWLLEINTIPGMTHRSLVPMAAKSIGISFDELILKILKI
DDL_BORBR       GCEGWGRVDFILDREN----RPWLLEMNTSPGMTGHSLVPMAARAVGMSYADLCVAILAE
DDL_BORPE       GCEGWGRVDFILDREN----RPWLLEMNTSPGMTGHSLVPMAARAVGMSYADLCVAILAE
DDL_BORPA       GCEGWGRVDFILDREN----RPWLLEMNTSPGMTGHSLVPMAARAVGMSYADLCVAILAK
DDL_BORA1       GCEGWGRADFILDGQN----QPWLLEMNTSPGMTSHSLVPMAARAVGMSYAELCVAILAD
DDL_RALSO       GCRGWGRADIMLRKHDG---APFLLEMNTSPGMTGHSLVPMAARAVGISYEDFVLQLAAT
DDL_JANMA       GCTGWARVDFLVRESDN---EPFLLEINTSPGMTGHSLVPMSAKVAGTAYEDLCVEILRM
DDL_NITEU       GCTGWSRVDLILDENE----QPFFLETNTSPGMTDHSLVPMAAKAAGISFDELVVQILEL
DDL_NITEC       GCTGWSRVDLILDKNG----QPFFLEANTSPGMTNHSLVPMAAQAAGISFDELVIQILEL
DDLB_CHRVO      GCRGWSRVDFLMDEAG----EIYLLEANTSPGMTSHSLVPMAARAEGIAYEDLCLKVLDT
DDL_METFK       GGRGWGRVDFLMDEAG----RHYFLEVNTSPGMTDHSLVPMGAKAVGLGFDELVLSILEL
DDL_NEIMB       GAEGCVRVDFLKDTDG----KLYLLEINTLPGMTSHSLVPKSAAVTGVGFADLCIEILKT
DDL_NEIMF       GAESCVRVDFLKDTDG----KLYLLEINTLPGMTSHSLVPKSAAVTGVGFADLCIEILKT
DDL_NEIMA       GAEGCVRVDFLKDTDG----KLYLLEINTLPGMTGHSLVPKSAAVMGVGFADLCIEILKT
DDL_NEIG1       GAEGCVRVDFLKDTDG----KLYLLEINTLPGMTGHSLVPKSAAVTGVGFADLCIEILKA
DDL_PSEE4       GIEGWGRLDVMQD-EQG---RFWLLEVNTAPGMTDHSLVPMAARAAGLDFQQLVLAILAD
DDLB_PSEPK      GIEGWGRLDVMQD-EQG---RFWLLEVNTAPGMTDHSLVPMAARAAGLDFQQLVLAILAE
DDL_PSEPF       GIAGWGRADVMQD-ADG---KFWFLEVNTAPGMTDHSLVPMAAKAAGLDFQQLVLAILAA
DDLB_PSESM      GIAGWARTDVMQD-AEG---KFWLLEVNTVPGMTDHSLVPMAARAAGLNFQQLVLAILAD
DDLB_PSEAE      GIQGWGRADVMQD-AEG---RFWLLEVNTAPGMTDHSLVPMAARAAGLDFQQLVLAILAD
DDL_SACD2       GCKGWGRVDFMQD-EAG---NFYLLEVNTVPGMTDHSLVPMAARQSGIEFNELVLEILAQ
DDL_XANAC       GCRGWGRVDVMRDGSSG---QLYLLEVNTAPGMTSHSLVPKAARQLGIDFETLVWRVLEQ
DDLB_XANCP      GCSGWGRVDVMRDGSTG---QLYLLEVNTAPGMTSHSLVPKAARQLGIDFEALVWRVLEQ
DDL_XYLFA       GCRGWGRVDVMRERGSG---RFFLLEVNTAPGMTTHSLVPKAASQLGMGFDDLVWRILEQ
DDL_XYLFT       GCRGWGRVDVMRERGSG---RFFLLEVNTAPGMTTHSLVPKAASQLGMGFDDLVWRILEQ
DDL_RHIME       GCRGVSRSDFRFDDRGDGEGELIWLEINTQPGMTPTSLVPEMAQHAGLQFGEFLRWMVED
DDL_SINMW       GCRGVSRSDFRFDDRGDGEGELIWLEINTQPGMTPTSLVPEMAQHAGLRFGEFLRWMVED
DDLB_RHILO      GCRGVSRSDFRYDDRHSENGEVVWLEVNTQPGMTPTSLVPEIAAHAGHSFGELLSWMVED
DDL_AGRFC       GCRGVSRSDFRYDDRFSEDGEVIWLEVNTQPGMTPTSLVPEMAAHAGRSFGDLVSWMVED
DDLB_BRUME      GCRGVSRSDFRFDDRFSEEGEVVWLEINTQPGMTPTSLVPDIAKAAGISFAELLSWMVED
DDLB_BRUSU      GCRGVSRSDFRFDDRFSEEGEVVWLEINTQPGMTPTSLVPDIAKAAGISFAELLSWMVED
DDL_OCHA4       GCRGVSRSDFRFDDRFSDDGEVIWLEINTQPGMTPTSLVPDIAKAAGISFGELLSWMVED
DDL_CHESB       GCRGVSRSDFRYDDRLPGEEGIVWLEINTQPGMTPTSLVPDIAAQAGIGFGALLSWMVED
DDL_BARHE       GCRGVSRSDFRFDE---ETGELVWLEINTQPGMTPTSLFPDIAKASGRTYGDIVQWMVED
DDL_BARQU       GCRGVSRSDFRFNE---ETGELVWLEINTQPGMTPTSLFPDIAKASGRTYGDIVQWMVED
DDL_BARBK       GCRGVSRSDFRFNE---ETGELIWLEINTQPGMTSTSLVPDIAKASGRTYGDIVKWIVED
DDL_GLUOX       GCQGASRTDFRYDEGTDT---LVILEVNTQPGMTPTSLLPEQAAYCGISYPELCDWMVRE
DDL_GRABC       GCRGATRSDFRYDDTRAEPGRLVLLEVNTQPGLTPTSLLPEQAALMGMDFVSLCRWMVEQ
DDL_CAUVC       GCRGVTRSDFRYDDINDL---LVLLEVNTQPGMTPTSLAPEQADHVGIPFDQLVLWIVED
DDL_RICB8       NCKGAARAEFILED---GTNKLYALEINTHPGMTPLSIVPEIAAYHGIDFVNLIEEILKT
DDL_RICBR       NCKGAARVEFILED---GTNKLYALEINTHPGMTPLSIVPEIAAYHGIDFVNLIEEILKT
DDL_RICCN       NCKGPARAEFILEE---QTNKLYALEINTHPGMMPLSIVPEIAAYAGINFTNLIEEIIKT
DDL_RICRS       NCKGPARAEFILEE---QTNKLYALEINTHPGMMSLSIVPEIAAYAGINFTNLIEEIIKT
DDL_RICM5       NCKGPARAEFILEE---QTNKLYALELNTHPGMTPLSIVPEIAAYAGINFTNLIEEIIKT
DDL_RICFE       NCKGPARAEFILEE---QTNKLYALEINTHPGMTPLSIVPEIAAYAGINFTNLIEEIIKT
DDL_RICPR       NCKGPVRAEFILEE---QTNKLYVLEINTHPGMTPLSIVPEIAAYAGINFTNLIEEIIKM
DDL_RICTY       NCKGPVRAEFILEE---QTNKLYVLEINTHPGMTPLSIVPEIAAYAGISFTNLIEEIIKM
DDL_FUSNN       GMKGISRSDFILSE-----GELYFLEVNSSPGMTKTSLIPDLATLKGYSFDDVVRITVET
DDL_THEMA       GCRGFGRVD-GIFSD----GRFYFLEINTVPGLTETSDLPASAKAGGIEFEELVEIILKS
DDL_THEP1       GCRGFGRVD-GIFSN----GRFYFLEINTVPGLTETSDLPASAKAGGIEFEELVEIILKS
DDL_PSELT       GCEGFARVD-GILKD----NVFYVLELNTIPGLTDLSDMPASAKAAGMSFEELVDAIIQT
DDL_FERNB       GCKHFSRID-GIVKD----GVFYFLEVNTLPGMTELSDLPMSANAFGISFDELVDLIIKE
DDL_AQUAE       SLKDFARIDFRVTKE----GKIFFLEVNTIPGMTELSLLPMAAKEKGMDFKKLISIIIT-
DDL_CARHZ       GCRGFARVDFMIDVRKN---EAYVLEVNTIPGMTATSLFPDAAKAQGISFEDLVEKILML
DDL_MOOTA       GCRGFARVDFIVAGGR----EPQVIEVNSVPGMTATSLVPDAARAAGLDFPDLVQKIVDL
DDL_SYNJB       GCEGLARVDLRVDPEE----NPWVLEVNTLPGMTPTSLCPDAAAALGWTFTELVERMLQD
DDL_SYNJA       GCEGLARVDLRVDADE----NPWVLEVNTLPGMTPTSLCPEAAAALGWTFTELVERMLQD
DDL_GLOVI       GSTGLVRADVRVDPEG----RPWVLEVNTLPGMTATSLAPEAAQAAGIDFEQLIQRIIDR
DDL_MAGMM       GCRGLVRADFILDGEG----TPWLLELNTIPGMTELSLAPKAAHAVGIEMPQLAERILQG
DDL_DESVH       GLRGYSRADYILRDDG----ALFLLEVNTLPGMTPTSLVPQEAAAIGLDFPALIARLIEL
DDL_DESVV       GLRGYSRADYILRDDG----ALFLLEVNTLPGMTPTSLVPQEAAAIGLDFPALIARLIEL
DDL_DESAG       GLRGYSRSDFILTPAG----ALSLLEVNTLPGMTATSLLPQEAAAVGISFDGLIGRLIEL
DDL_LAWIP       NLQGCSRADFILRDDE----LLFLLEVNTIPGMSATSLVPREAAAMGLTFPELVEKLIQL
DDLA_PSEAE      KLSGYSRTDFRLDEQG----RLWCLEVNTLPGMTATSLLPQAAAAAGIGFAELCERICRL
DDL_BACAN       KCSVYARVDMMV-KDGI----PYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIET
DDLA_BACCR      KCSVYARVDMMV-KDGI----PYVMEINTLPGMTQSSLLPKSAEAAGISYSKLLDMIIET
DDLA_CLOTE      KLKVYGRIDMII-KGNE----VYVIEINTLPGMTKYSLFPKSAKAYGLNFSELLDKIIEL
DDL_CLOB1       KCEVYVRVDMIV-KDGI----PYVLELNTLPGMTKNSLFPKSANAVGISFAELLNSIVKY
DDL_CLOBH       KCEVYVRVDMIV-KDGI----PYVLELNTLPGMTKNSLFPKSANAVGISFAELLNSIVKY
DDL_CLOBL       KCEVYVRVDMIV-KDGI----PYVLELNTLPGMTKNSLFPKSANAVGISFAELLNSIVKY
DDLA_CLOPE      KCDVYARVDMLV-KDNI----PYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEK
DDL_CLOPS       KCDVYARVDMLV-RDNV----PYVLEVNTLPGMTKNSLFPKSAAGINMSFEELLDTIIEK
DDLB_CLOPE      KCEVYARVDMIISEEGV----PYILEVNTLPGMTATSLFPQSAESRGISYSKFIDLIIET
DDL_LACSS       GLTNYARIDFFWSPETG----LYVIEGNTLPGMTPLSLIPQEAEVLGISYPDLCEMIVNG
DDL_PEDPA       GMTNYGRVDFL-TNDTG----VYVIEANNLPGMTPLSLLPQEAEAAGISYEDLCESIVLG
DDL_BACFR       GCSGIIRVDYIITEGEK----INLLEVNTTPGMTATSFIPQQVRAAGLDIKDVMTDIIEN
DDL_BACFN       GCSGIIRVDYIITEGEK----INLLEVNTTPGMTATSFIPQQVRAAGLDIKDVMTDIIEN
DDL_BACTN       GCSGIIRVDYIVTAGEK----INLLEVNTTPGMTTTSFIPQQVRAAGLDIKDVMTDIIEN
DDL_BACV8       GCSGLIRIDYIITEGEK----VNLLEINTTPGMTATSFIPQQVRAAGLDIKDVMTDIIEN
DDL_PORGI       NARGIIRVDYIIEADGI----PTLLEVNTTPGMTPTSFIPQQVRAAGMDMKEVLCTIIRD
DDL_LEPBJ       GCRGYSRSDFIIVGGE-----PHILETNTLPGMTETSLIPQQAKAAGITMEEVFADLIEI
DDL_LEPBL       GCRGYSRSDFIIVGGE-----PHILETNTLPGMTETSLIPQQAKAAGITMEEVFADLIEI
DDL_LEPIN       GCSGYSRTDFIIVNGE-----PHILETNTLPGMTETSLIPQQAKAAGISMEEVFSDLIEI
DDL_LEPIC       GCSGYSRTDFIIVNGE-----PHILETNTLPGMTETSLIPQQAKAAGISMEEVFSDLIEI
DDL_TROW8       GCRHYARIDFFVTESGLV-----LNEINTSPGLTQKSIFPSSFKSMQYSQVIETILASAY
DDL_TROWT       GCRHYARIDFFVTESGLV-----LNEINTSPGLTQKSIFPSSFKSMQYSQVIETILASAY
DDL_TREPA       GLTGLARVDFFLLETGEVY----VNEVNTMPGFTSISLFPQICQAAGVAPQDLMAQLLSC
DDL_NOSS1       DAAGLARVDFFYVEATG---EVLINEINTLPGFTATSMYPQLWAHSGIPFPELVDKLVQL
DDL_TRIV2       DAAGLARVDFFYVEATG---EVLINEINTLPGFTATSMYPQLWAYSGIPFPELVDKLVQL
DDL_TRIEI       DAAGLARVDFFYVEKTG---EILINEINTMPGFTSSSMYPMLWEASGIPFSELVDTLIQL
DDL_SYNY3       DAAGLGRLDFFYQPTTG---QIVINEINTLPGFTAFSMYPELWRASGVEFPSLVDRLLQL
DDL_SYNP6       DASGLSRLDFF-LDSQG---QIFINEINTLPGFTALSMYPQLWAASGVAFPDLVHRLIQL
DDL_SYNE7       DASGLSRLDFF-LDSQG---QIFINEINTLPGFTALSMYPQLWAASGVAFPDLVHRLIQL
DDL_THEEB       GAAGLARFDFFYVPSTG---EVLINEVNTLPGFTALSMYPQLWAASGLSFPELVHRLVQL
DDL_PROM3       AAHGMARVDFFYNAARN---EIWLNEINTLPGFTSQSMYPMLWEASGVTLEELVSQLVIT
DDL_PROMM       AAHGMARVDFFYNAARN---EIWLNEINTLPGFTSQSMYPMLWEASGVTLEELVSQLVIT
DDL_SYNS3       HAYGLARVDVFYDEKSG---DIWLNEINTLPGFTSQSMYPMLWEASGVALPDLVAQLVHT
DDL_SYNSC       GVHGMSRVDFFYDETND---QLWINEINTLPGFTAQSMFPMLWAASGVTLEQLVHKLIQT
DDL_SYNS9       GVVGMARVDFFYDNTSH---QLWINEINTLPGFTSQSMYPMLWEASGVTLDQLVHKLVQS
DDL_SYNPX       GVTGMARVDFFYDDSRD---RVWLNEINTLPGFTSQSMYPMLWEASGVTLEQLVHELLES
DDL_PROMA       SAEGIARVDFFYDEEKD---SLWINEINTMPGFTEQSMYPMLWDASGIDISQLVARLIES
DDL_PROM1       NAYGLARVDFFYQESTQ---QIYINEVNTLPGFTKTSMYPTLWEASGLKLEKLVASLIEI
DDL_PROMT       NAYGLARVDFFYQESTQ---QIYINEVNTLPGFTKTSMYPTLWEASGLKLEKLVANLIEI
DDL_PROMS       NIFGFARVDFFLEKSSN---KIFLNEINTIPGFTKNSMFPMLWKASGLKIEQLVAKLVDI
DDL_PROM0       NIFGFARVDFFLEKSSN---KILLNEINTIPGFTKNSMFPMLWEASGLKIEQLVAKLVDI
DDL_PROM9       NIFGFARVDFFLEKSSN---KIFLNEINTIPGFTKKSMFPMLWEASGLNIEQLVAKLVDI
DDL_PROM2       NIFGFARVDFFLEKSSN---KILLNEINTIPGFTTNSMFPMLWKASGLNIEQLVAKLVDI
DDL_PROM5       NIYGFARVDFFLEKISR---KIFLNEINTIPGFTSKSMFPMLWKASGLNIDQLVAKLIDI
DDL_PROMP       NIYGFARVDFFLEKISN---KIFLNEINTIPGFTSKSMFPMLWNASGLNIDQLVAKLVDI
DDL_DEIGD       DCAGLARVDFFYVEQTG---ELFLNEVNTMPGFTTTSMYPKLFEAAGLSYSELVTRLVEL
DDL_DEIRA       DCAGLARVDFFYVEETG---ELFLNEVNTMPGFTTTSMYPKLFEAAGLSYSELVTRLVEL
DDL_BACLD       DGSGLVRADFFLTNEG----RVLINEVNTMPGFTPFSMFPLLWKQSGVEYAELIEKLVAL
DDL_BACSU       DGSGLVRADFFLTADG----EVLINEVNTMPGFTPFSMFPLLWKEAGVEYADLIEQLVEL
DDL_BACP2       DGSGLVRADFFLTEKG----EVLINEVNTMPGFTPFSMFPLLWKHTGVEYPELIEKLVSL
DDLB_BACCR      DGAGLTRADFFLTKDG----EVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRL
DDL_GEOKA       DLSGLARVDFFLAEDG----AVYINEVNTMPGFTPYSMFPLLWQHSGVPYPELIERLIAL
DDL_GEOTN       DLSGLARVDFFLAEDG----TVYINEVNTMPGFTPYSMFPLLWQHSGVPYSELIERLIAL
DDL_LISMO       DASGLVRADFFLTEDN----QLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDL
DDL_LISMF       DASGLVRADFFLTEDN----QLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDL
DDL_LISIN       DASGLVRADFFLTEDN----QLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDL
DDL_LISW6       DASGLVRADFFLTDDN----QLFLNEVNTMPGFTPYSMYPLLWQETGLPYSALIERLVDL
DDL_STAAB       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAAC       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAA1       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAAM       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAAN       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAA8       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAAE       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAA3       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAAS       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAAW       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAAR       DCSGLVRADFFVTEDN----QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIEL
DDL_STAES       DCSGLVRADFFVTDDN----QIYINETNAMPGFTAYSMYPNLWKNMGLSYPDLIAKLIDL
DDL_STAEQ       DCSGLVRADFFVTDDN----QIYINETNAMPGFTAYSMYPNLWKNMGLSYPDLIAKLIDL
DDL_STAHJ       DCSGLVRADFFVTEDN----QIFINETNAMPGFTAFSMYPSLWENMGLSYSDLITKLIDL
DDL_STAS1       DCAGLLRADFFVTDDN----QIFINETNAMPGFTAFSMYPSLWENMGVSYSDLIKKLIEL
DDL_ENTFA       DGSGLSRCDFFLTSKN----ELFLNELNTMPGFTDFSMYPLLWENMGLKYSDLIEELIQL
DDL_ENTHA       GGSGLSRCDFFLTNKN----ELFLNELNTMPGFTQFSMYPLLWENMGLKYGDLIEELIQL
DDL_LACLM       NGAGLSRCDFFVTKDG----NVYLNEVNAIPGFTQWSMYPLLWENMGLSYSDLIEKLVDL
DDL_LACLA       NGTGLSRCDFFVTKDG----NVYLNEINAIPGFTQWSMYPLLWENMGLSYSDLIEKLVDL
DDL_STRA1       GACGLSRCDFFLTKDG----QIFLNELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVML
DDL_STRA3       GACGLSRCDFFLTKDG----QIFLNELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVML
DDL_STRA5       GACGLSRCDFFLTKDG----QIFLNELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVML
DDL_STRT2       GGCGLARCDFFLTEDG----AIYLNELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVVL
DDL_STRT1       GGCGLARCDFFLTEDG----AIYLNELNTMPGFTQWSMYPLLWENMGLSYSDIIKELVVL
DDL_STRTD       GGCGLARCDFFLTEDG----AIYLNELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVVL
DDL_STRP1       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRPM       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRPB       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRPC       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRP8       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRPG       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRPD       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEVLVTL
DDL_STRP3       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRP6       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRPF       GGCGLSRCDFFLTQDG----QVYLNELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTL
DDL_STRMU       GCCGLSRCDFFLTEDG----KVYLNELNTMPGFTQWSMYPLLWENMGLSYSVLIEELVSL
DDL_STRR6       GGLGLSRCDFFYTDKG----EIFLNELNTMPGFTQWSMYPLLWENMGISYPELIERLVDL
DDL_STRP2       GGLGLSRCDFFYTDKG----EIFLNELNTMPGFTQWSMYPLLWENMGISYPELIERLVDL
DDL_STRPN       GGLGLSRCDFFYTDKG----EIFLNELNTMPGFTQWSMYPLLWDNMGISYPKLIERLVDL
DDL_CLOAB       DCSGMSRVDFLVDKDTT---EMYLNEVNTIPGFTSISMYPKLWAAAGKDYSKLIDELIEL
DDL_CLONN       DCAGMSRVDFLVDKETE---EVYLNEINTIPGFTKISMYPKMWQAEGKAYGELISEIIEL
DDLB_CLOTE      GCSGLARVDFLMDKESN---EVYFNEVNTLPGFTKISMYPKLWEASGKSYSALIDELIEL
DDL_CALS8       ECSGMARIDFFVDKETN---KVYFNEVNTIPGFTSISMYPKLMEYSGIPYPQLLDKLIQL
DDL_CHLPD       GCRGMSRIDFFVDETSG---TIVLNEVNTIPGFTDISMYPRLFAASGLPFNELVEKLLQF
DDL_PELLD       GCRGMSRVDFFVDETTG---SIVFNEINTIPGFTPVSMYPRLMAAAGTGFMELTDRLIRL
DDL_CHLCH       GCSGMARVDFFVDESTN---SVVLNEVNTIPGFTDISMYPQMMEASGISYRNLITRLLEL
DDL_CHLTE       GCEGMARVDFFVENGTN---RVILNEINTIPGFTDISMYPMMMAASGIGFAELVEKLLLL
DDL_COXBU       HCSGMARVDFFVTP-NN---KVLVNEINTIPGFTNISMYPKMWEASGLPCPNLLDQLIEL
DDL_SOLUE       ECEGMARVDFFLEHGTN---RLYINEINTIPGFTSISMYPKMWEHSGIPFCTLLDQLIEF
DDL_BACSK       NCEGLARVDVFLTETG----EVIINEVNTLPGFTKISMYPKLWEASGVSYQDLITTLIEL
DDL_OCEIH       NCEGLARVDVFLTDDN----EIVINEINTLPGFTKISMYPKLWEESGVSYRELIENLIEL
DDLA_ECOLI      GCAGMARVDVFLTPEN----EVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIEL
DDLA_ECO57      GCAGMARVDVFLTPEN----EVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIEL
DDLA_SHIFL      GCAGMARVDVFLTPEN----EVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIEL
DDLA_ECOL6      GCAGMARVDVFLTPEN----EVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIEL
DDLA_SALTI      GCAGMARVDVFLTADN----EVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIEL
DDLA_SALTY      GCAGMARVDVFLTADN----EVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIEL
DDL_BAUCH       NCTGMARVDVFLTTNN----KVLVNEVNTSPGFTSISMYPKLWQASGISYPALITRLIEL
DDLA_CHRVO      ECSGMARVDVFLTPDG----EVVINELNTLPGFTNISMYPKLWQAAGMSYRELITALIEL
DDLA_XANCP      DCAGMARVDVFLCADG----RIVINEVNTLPGFTRISMYPKLWEASGLDYRSLVTRLIEL
DDLA_PSESM      GCAGLSRVDFFVTEAR----EIIINEVNTLPGFTSISMYPKLWQATGLSYAELIHRLIVL
DDL_BLOFL       NCFGMARVDIFLFGKD----RIIINEVNTLPGFTSDSMYLKLWQATGINISTLLTRLIML
DDL_WIGBR       ECSIMARVDFFLTKNK----KIFLNEINTIPGFTKNSIYPKLWSKSGLDFKSLINKLILL
DDL_BIFAA       DGAGLSRVDTFVTKDG----KVMVNEINTMPGFTSISMYPKAWEATGVRYTDLITKLIEG
DDL_BIFLO       DGAGLSRVDTFVTPDG----TVMVNEINTMPGFTPISMYPKAWDATGVSYTELITRLIEG
DDL_CORGL       ACEGLARVDFFVTANG-----PVLNEINTMPGFTPISMYPQMFTASGVAYEELLDVLVQQ
DDL_CORGB       ACEGLARVDFFVTANG-----PVLNEINTMPGFTPISMYPQMFTASGVAYEELLDVLVQQ
DDL_COREF       ACEGLARVDFFVTANG-----PVLNEINTMPGFTPISMYPQMFAASGVGYEELLDVLVQQ
DDL_MYCTU       DCRGLARVDFFLTDDG-----PVINEINTMPGFTTISMYPRMWAASGVDYPTLLATMIET
DDL_MYCTA       DCRGLARVDFFLTDDG-----PVINEINTMPGFTTISMYPRMWAASGVDYPTLLATMIET
DDL_MYCBP       DCRGLARVDFFLTDDG-----PVINEINTMPGFTTISMYPRMWAASGVDYPTLLATMIET
DDL_MYCBO       DCRGLARVDFFLTDDG-----PVINEINTMPGFTTISMYPRMWAASGVDYPTLLATMIET
DDL_MYCUA       DCQGLARVDFFLTDDG-----PVINELNTMPGFTTISMYPRMWVASGVDYPTLLATMVET
DDL_MYCLE       DCQGLARVDFFLTDDG-----PVINEINTMPGFTMTSMYPKLWAVSSVDYPTLLATMVDT
DDL_MYCSM       GCQGLARVDFFLTDDG-----PVINEINTMPGFTTISMYPRMWAAGGIDYPTLLAAMVDT
DDL_MYCS2       GCQGLARVDFFLTDDG-----PVINEINTMPGFTTISMYPRMWAAGGIDYPTLLAAMVDT
DDL_MYCSK       DCQGLARVDFFLTDDG-----PVVNEINTMPGFTTISMYPRMWAASGVDYPTLLAAMVDT
DDL_MYCSS       DCQGLARVDFFLTDDG-----PVVNEINTMPGFTTISMYPRMWAASGVDYPTLLAAMVDT
DDL_MYCSJ       DCQGLARVDFFLTDDG-----PVVNEINTMPGFTTISMYPRMWAASGVDYPTLLAAMVDT
DDL_STRAW       SCEGLVRADFFLTEDG----DFVINEINTMPGFTPISMYPQMWQASGIAYPELVDRLVEA
DDL_STRCO       SCEGLVRADFFLTEDD----EFVINEINTMPGFTPISMYPQMWQASGVSYPELVDRLVQA
DDLA_PSEPK      ELKGYARVDFFLTEEG----EIILNEINTLPGFTSASMYPKMFECSGYPPPKLVGALVEY
DDL_LEGPC       KCKGMARVDFFVNDKTEE---IYFNEINTLPGFTSISMYPKLWQATGVAYPDLLDELINL
DDL_LEGPA       KCKGMARVDFFVNDKTEE---IYFNEINTLPGFTSISMYPKLWQATGVAYPDLLDELINL
DDL_LEGPL       KCKGMARVDFFVNDKTEE---IYFNEINTLPGFTSISMYPKLWQATGIAYPDLLDELINL
DDLA_BRADU      ECSGFARVDFFLDRKTGE---FCFNEINTLPGFTSISMYPKMMEASGVPYGELLSRLVDL
DDLA_BRUME      GCDSMARVDFFVTADR-R---IVLNEINTIPGFTDMSMYFKVMAVSGVSYPEIINRLVAH
DDLA_BRUSU      GCDSMARVDFFVTADR-R---IVLNEINTIPGFTDMSMYSKVMAVSGVSYPEIINRLVAH
DDLA_RHILO      GCEAMARVDFFLRADG-S---LLVNEVNTLPGFTDISMYAKALAAAGIGYSKVIDVLIEH
DDLB_BRADU      CCEGMARVDFFVQGD--E---VFVNEANTLPGFTSSSMYPKLWEASGLSQTDLMDKLIAH
DDL_VIBCB       NLRHLSRIDFFLTEDGE----IYLNEVNTFPGMTPISMFPKMLQNNGHKFHEFLADCINT
DDL_VIBPA       NLRHLSRIDFFLTEDNE----IYLNEVNTFPGMTPISMFPKMLQNNGHKFHEFLEDCINS
DDL_VIBVU       NLRHLSRIDFFLTSEGE----IYLNEVNTFPGMTKISMFPKMLQHNGHKFHEFLADCIER
DDL_VIBVY       NLRHLSRIDFFLTSEGE----IYLNEVNTFPGMTKISMFPKMLQHNGHKFHEFLADCIER
DDL_VIBCH       KLRHLSRIDFFLTQEGQ----IYLNEVNTFPGMTPISMFPKMLEHNGHRFSEFLVQCVTN
DDL_AERHH       KLTHLSRIDFFLTEEGE----ILLNEINTFPGMTSISMFPKLLEHHGHRFADYLEQILRK
DDL_SHEON       KLRHLSRIDFFLTADNE----ILLNEINTFPGSTPISMFPKMLQNHGHDFTQYLSLVINS
DDL_LACBA       GLKGMARIDYLVSKDGV----PYVGEVNTLPGFTNISLYPQLWQATGINYADLIDRLIEL
DDL_LACPL       GLKGMARVDFLVSEDGE----PYLGEINTLPGFTNISLYPKLWEVSGISYTALIDQLIQL
DDL_LEUME       NLRGEARMDFLLDENNV----PYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLIDY
DDL_LEUMM       NLRGEARMDFLLDENNV----PYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLIDY
DDL_BORBU       ELRGMARVDFFVEKKSG---TIYLNEINTIPGFTDISMFAKMCSNDGLQFKDLVDNLIDY
DDL_CALS4       DCSGLARIDFLLEKETM---KVYVNEINTIPGSFAFYLWKPL----GISFEKLIDRLIEY
DDL_THEM4       ECSGNVRIDFLIAD------KIYVNEINTIPGALSFYIWQKS----GFTFSQIIDNMINM
DDL_CAMJE       FKGALIRCDFFILDNE-----IYLNEINPNPGSLANYLFKDFNTTLNALADQISLEKMIK
DDL_WOLSU       FEGSLIRCDFFVQNQE-----VFLNEINPIPGSLANYLFEDFPKILQSLAHNLPKERGIK
DDL_HELHP       FEGALIRCDFFVIDDE-----VYLNEINPIPGSMANYLFEDFVGVLTELAYNLPKKHSIK
DDL_HELPY       FDGAIIRCDFFVIKNE-----VYLNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQ
DDL_HELPJ       FDGAIIRCDFFVIENE-----VYLNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQ
                      * :                * *  **                            

DDL_ACTP2       SA----------------------------------------------
DDL_HAEDU       SI----------------------------------------------
DDL_ACTSZ       SV----------------------------------------------
DDL_MANSM       SA----------------------------------------------
DDL_HAEI8       SL----------------------------------------------
DDL_HAEIG       SL----------------------------------------------
DDL_HAEIN       SL----------------------------------------------
DDL_HAES1       SL----------------------------------------------
DDL_PASMU       SAE---------------------------------------------
DDL_YERPE       AD----------------------------------------------
DDL_YERPA       AD----------------------------------------------
DDL_YERPN       AD----------------------------------------------
DDL_YERPP       AD----------------------------------------------
DDL_YERPS       AD----------------------------------------------
DDL_YERP3       AD----------------------------------------------
DDL_PHOLL       AD----------------------------------------------
DDL_PECAS       AG----------------------------------------------
DDLB_ECOLI      AD----------------------------------------------
DDLB_SHIFL      AD----------------------------------------------
DDLB_ECO57      AD----------------------------------------------
DDLB_ECOL6      AD----------------------------------------------
DDL_SALPA       AD----------------------------------------------
DDLB_SALTI      AD----------------------------------------------
DDLB_SALTY      AD----------------------------------------------
DDL_BUCBP       AN----------------------------------------------
DDL_BUCAP       NK----------------------------------------------
DDL_BORBR       AACKVRSPARQD------------------------------------
DDL_BORPE       AACKVRSPARQD------------------------------------
DDL_BORPA       AACKVRSPARQD------------------------------------
DDL_BORA1       ASCKLRAPARANG-----------------------------------
DDL_RALSO       ASLELRASHDWKPE----------------------------------
DDL_JANMA       AKLGLKPVQHK-------------------------------------
DDL_NITEU       SCEH--------------------------------------------
DDL_NITEC       SCEYA-------------------------------------------
DDLB_CHRVO      VHVG--------------------------------------------
DDL_METFK       AHVG--------------------------------------------
DDL_NEIMB       AHVG--------------------------------------------
DDL_NEIMF       AHVG--------------------------------------------
DDL_NEIMA       AHVG--------------------------------------------
DDL_NEIG1       AHVG--------------------------------------------
DDL_PSEE4       SVATRG------------------------------------------
DDLB_PSEPK      SVATRG------------------------------------------
DDL_PSEPF       SVDADGKKEARG------------------------------------
DDLB_PSESM      SVQARG------------------------------------------
DDLB_PSEAE      SREARG------------------------------------------
DDL_SACD2       TLV---------------------------------------------
DDL_XANAC       TL----------------------------------------------
DDLB_XANCP      TL----------------------------------------------
DDL_XYLFA       TL----------------------------------------------
DDL_XYLFT       TL----------------------------------------------
DDL_RHIME       ASCLR-------------------------------------------
DDL_SINMW       ASCLR-------------------------------------------
DDLB_RHILO      ASCLR-------------------------------------------
DDL_AGRFC       ASCLR-------------------------------------------
DDLB_BRUME      ASCLR-------------------------------------------
DDLB_BRUSU      ASCLR-------------------------------------------
DDL_OCHA4       ASCLR-------------------------------------------
DDL_CHESB       ASCPR-------------------------------------------
DDL_BARHE       ASCMR-------------------------------------------
DDL_BARQU       ASCMR-------------------------------------------
DDL_BARBK       ASCMR-------------------------------------------
DDL_GLUOX       ALAR--------------------------------------------
DDL_GRABC       ATCRA-------------------------------------------
DDL_CAUVC       AYARCSAGGTA-------------------------------------
DDL_RICB8       ASFES-------------------------------------------
DDL_RICBR       ASFES-------------------------------------------
DDL_RICCN       ASFES-------------------------------------------
DDL_RICRS       ASFES-------------------------------------------
DDL_RICM5       ASFES-------------------------------------------
DDL_RICFE       ASFES-------------------------------------------
DDL_RICPR       ASFES-------------------------------------------
DDL_RICTY       ASFES-------------------------------------------
DDL_FUSNN       FLE---------------------------------------------
DDL_THEMA       AFLKEGVRV---------------------------------------
DDL_THEP1       AFLKGEVRA---------------------------------------
DDL_PSELT       AVR---------------------------------------------
DDL_FERNB       ACRKL-------------------------------------------
DDL_AQUAE       ------------------------------------------------
DDL_CARHZ       GLEGRQK-----------------------------------------
DDL_MOOTA       ALEP--------------------------------------------
DDL_SYNJB       ALQKAQLTGSRHPQSSSATLGNAP------------------------
DDL_SYNJA       ALQRAALTRSAPSGSRPSPQPA--------------------------
DDL_GLOVI       SLD---------------------------------------------
DDL_MAGMM       ARLK--------------------------------------------
DDL_DESVH       GMTAAGR-----------------------------------------
DDL_DESVV       GMTAAGR-----------------------------------------
DDL_DESAG       GLAAHGKQQEKA------------------------------------
DDL_LAWIP       AIRDHRK-----------------------------------------
DDLA_PSEAE      GIERCKGARKARS-----------------------------------
DDL_BACAN       SLRVRKEEGF--------------------------------------
DDLA_BACCR      SLKVRNEEGF--------------------------------------
DDLA_CLOTE      SIKEYEF-----------------------------------------
DDL_CLOB1       SLEVER------------------------------------------
DDL_CLOBH       SLEVER------------------------------------------
DDL_CLOBL       SLEVER------------------------------------------
DDLA_CLOPE      SLKVNRE-----------------------------------------
DDL_CLOPS       SLKVNRE-----------------------------------------
DDLB_CLOPE      SLNKKIK-----------------------------------------
DDL_LACSS       KLALLNEK----------------------------------------
DDL_PEDPA       KQKLYDELKK--------------------------------------
DDL_BACFR       KF----------------------------------------------
DDL_BACFN       KF----------------------------------------------
DDL_BACTN       KF----------------------------------------------
DDL_BACV8       KF----------------------------------------------
DDL_PORGI       GLNETQ------------------------------------------
DDL_LEPBJ       GLKHSIH-----------------------------------------
DDL_LEPBL       GLKHSIH-----------------------------------------
DDL_LEPIN       GLKRSLY-----------------------------------------
DDL_LEPIC       GLKRSLY-----------------------------------------
DDL_TROW8       CQVKR-------------------------------------------
DDL_TROWT       CQVKR-------------------------------------------
DDL_TREPA       ARERFAARAALSTDLHAHVCAPSVTAAHDPDAQGDDWDQRDSNPLPTA
DDL_NOSS1       AIERHNPSH---------------------------------------
DDL_TRIV2       AIERHNPSH---------------------------------------
DDL_TRIEI       ALERHSK-----------------------------------------
DDL_SYNY3       ALDYHGRPGHQ-------------------------------------
DDL_SYNP6       ALER--------------------------------------------
DDL_SYNE7       ALER--------------------------------------------
DDL_THEEB       ALEWHA------------------------------------------
DDL_PROM3       AGE---------------------------------------------
DDL_PROMM       ARE---------------------------------------------
DDL_SYNS3       ARE---------------------------------------------
DDL_SYNSC       AGE---------------------------------------------
DDL_SYNS9       AGE---------------------------------------------
DDL_SYNPX       AGQ---------------------------------------------
DDL_PROMA       A-----------------------------------------------
DDL_PROM1       AKE---------------------------------------------
DDL_PROMT       AKE---------------------------------------------
DDL_PROMS       SLDL--------------------------------------------
DDL_PROM0       SLDL--------------------------------------------
DDL_PROM9       SLDL--------------------------------------------
DDL_PROM2       SLDL--------------------------------------------
DDL_PROM5       SLDS--------------------------------------------
DDL_PROMP       SSDL--------------------------------------------
DDL_DEIGD       ALERR-------------------------------------------
DDL_DEIRA       ALEER-------------------------------------------
DDL_BACLD       AIERHEEKQQIKHTF---------------------------------
DDL_BACSU       AKERHAEKQLIKHTF---------------------------------
DDL_BACP2       AIERHQEKQTIKTTF---------------------------------
DDLB_BACCR      AIERHEEKQKIKYTI---------------------------------
DDL_GEOKA       ALERHQEKQTITYTFKKEKR----------------------------
DDL_GEOTN       ALERHQEKQMITYTFEK-------------------------------
DDL_LISMO       AKERHAAKNALKYKLED-------------------------------
DDL_LISMF       AKERHAAKNALKYKLED-------------------------------
DDL_LISIN       AKERHAAKNALKYKLED-------------------------------
DDL_LISW6       AKERHAAKNALKYKLED-------------------------------
DDL_STAAB       AKERHQDKQKNKYKID--------------------------------
DDL_STAAC       AKERHQDKQKNKYKID--------------------------------
DDL_STAA1       AKERHQDKQKNKYKID--------------------------------
DDL_STAAM       AKERHQDKQKNKYKID--------------------------------
DDL_STAAN       AKERHQDKQKNKYKID--------------------------------
DDL_STAA8       AKERHQDKQKNKYKID--------------------------------
DDL_STAAE       AKERHQDKQKNKYKID--------------------------------
DDL_STAA3       AKERHQDKQKNKYKID--------------------------------
DDL_STAAS       AKERHQDKQKNKYKID--------------------------------
DDL_STAAW       AKERHQDKQKNKYKID--------------------------------
DDL_STAAR       AKERHQDKQKNKYKID--------------------------------
DDL_STAES       AKERYEDKKKNKYKIDY-------------------------------
DDL_STAEQ       AKERYEDKKKNKYKIDY-------------------------------
DDL_STAHJ       AKERHEDKKKNKYTID--------------------------------
DDL_STAS1       AKEKHEDKKQNKYKID--------------------------------
DDL_ENTFA       ALNRFK------------------------------------------
DDL_ENTHA       GINRFNQRQGFFEANE--------------------------------
DDL_LACLM       AKETFETRENHLL-----------------------------------
DDL_LACLA       AKETFETRENHLL-----------------------------------
DDL_STRA1       AKEMFEKRESHLI-----------------------------------
DDL_STRA3       AKEMFEKRESHLI-----------------------------------
DDL_STRA5       AKEMFEKRESHLI-----------------------------------
DDL_STRT2       GQEMFDKRESHLI-----------------------------------
DDL_STRT1       GQEMFDKRESHLI-----------------------------------
DDL_STRTD       GQEMFDKRESHLI-----------------------------------
DDL_STRP1       AQEMFDQRESHLI-----------------------------------
DDL_STRPM       AQEMFDQRESHLI-----------------------------------
DDL_STRPB       AQEMFDQRESHLI-----------------------------------
DDL_STRPC       AQEMFDQRESHLI-----------------------------------
DDL_STRP8       AQEMFDQRESHLI-----------------------------------
DDL_STRPG       AQEMFDQRESHLI-----------------------------------
DDL_STRPD       AQEMFDQRESHLI-----------------------------------
DDL_STRP3       AQEIFDQRESHLI-----------------------------------
DDL_STRP6       AQEIFDQRESHLI-----------------------------------
DDL_STRPF       AQEIFDQRESHLI-----------------------------------
DDL_STRMU       AKEMFDKRESHLV-----------------------------------
DDL_STRR6       AKESFDKREAHLI-----------------------------------
DDL_STRP2       AKESFDKREAHLI-----------------------------------
DDL_STRPN       AKESFDKREAHLI-----------------------------------
DDL_CLOAB       AASRNNA-----------------------------------------
DDL_CLONN       AVERDNK-----------------------------------------
DDLB_CLOTE      AINNK-------------------------------------------
DDL_CALS8       AIEKNQQKQSIKYSKEG-------------------------------
DDL_CHLPD       ALETPSGARS--------------------------------------
DDL_PELLD       AMEPEAGASA--------------------------------------
DDL_CHLCH       ALEPLRR-----------------------------------------
DDL_CHLTE       ALEKRSITHKI-------------------------------------
DDL_COXBU       AIDRHQEQQKLIRCYEVKARSL--------------------------
DDL_SOLUE       ALDRHRQKQ-VTRFAR--------------------------------
DDL_BACSK       AIERHERDKQLKSSVFDRN-----------------------------
DDL_OCEIH       AIERNQRDQQLKSSRSDG------------------------------
DDLA_ECOLI      ALERHAADNALKTTM---------------------------------
DDLA_ECO57      ALERHAADNALKTTM---------------------------------
DDLA_SHIFL      ALERHAADNALKTTM---------------------------------
DDLA_ECOL6      ALERHAADNALKTTM---------------------------------
DDLA_SALTI      ALERHTANNALKTTM---------------------------------
DDLA_SALTY      ALERHTANNALKTTM---------------------------------
DDL_BAUCH       AIERYYAEQKKISHRDIYNKIDTGSA----------------------
DDLA_CHRVO      ALEKGRMDEALSRSCQY-------------------------------
DDLA_XANCP      ALERHADDGRLYSSVVTHA-----------------------------
DDLA_PSESM      ALERADEARLLKRDIFA-------------------------------
DDL_BLOFL       ALDRYYKYN---------------------------------------
DDL_WIGBR       TIYKK-------------------------------------------
DDL_BIFAA       VLR---------------------------------------------
DDL_BIFLO       VLR---------------------------------------------
DDL_CORGL       ALHRDN------------------------------------------
DDL_CORGB       ALHRDN------------------------------------------
DDL_COREF       ALHRSSN-----------------------------------------
DDL_MYCTU       TLARGVGLH---------------------------------------
DDL_MYCTA       TLARGVGLH---------------------------------------
DDL_MYCBP       ALARGVGLH---------------------------------------
DDL_MYCBO       ALARGVGLH---------------------------------------
DDL_MYCUA       ALSRGIGLR---------------------------------------
DDL_MYCLE       ALARGVGMR---------------------------------------
DDL_MYCSM       AIARGTGLR---------------------------------------
DDL_MYCS2       AIARGTGLR---------------------------------------
DDL_MYCSK       AVARGTGLR---------------------------------------
DDL_MYCSS       AVARGTGLR---------------------------------------
DDL_MYCSJ       AVARGTGLR---------------------------------------
DDL_STRAW       ALRRSTGLR---------------------------------------
DDL_STRCO       ALRRPTGLR---------------------------------------
DDLA_PSEPK      GLSSASKERL--------------------------------------
DDL_LEGPC       AMVHHNCRQHLVTNYL--------------------------------
DDL_LEGPA       AMVHHNCRQHLVTNYL--------------------------------
DDL_LEGPL       AMIHHNCRQHLVTNYL--------------------------------
DDLA_BRADU      ALDRHRQRQSLERGYAS-------------------------------
DDLA_BRUME      GLARGS------------------------------------------
DDLA_BRUSU      GLARGS------------------------------------------
DDLA_RHILO      ALARHRAR----------------------------------------
DDLB_BRADU      AFARHERRRALSFG----------------------------------
DDL_VIBCB       AI----------------------------------------------
DDL_VIBPA       AK----------------------------------------------
DDL_VIBVU       SL----------------------------------------------
DDL_VIBVY       SL----------------------------------------------
DDL_VIBCH       TLVNAK------------------------------------------
DDL_AERHH       AV----------------------------------------------
DDL_SHEON       QLAAK-------------------------------------------
DDL_LACBA       ALSEFHYQDELAYDFIPLDDHSAASTYKPKA-----------------
DDL_LACPL       GFDEFKRQSDIHYDFVALDAE---------------------------
DDL_LEUME       GFEDFAQNKKLSYSFVSLGEEKIGKFN---------------------
DDL_LEUMM       GFEDFAQNKKLSYSFVSLGEEKIGKFN---------------------
DDL_BORBU       AFQSYINRKKRIDFEN--------------------------------
DDL_CALS4       AVERHKEYARNMYTFETTLLLKAADRGTKM------------------
DDL_THEM4       GLERFKD--KKIVSIDTNILKIKVGK----------------------
DDL_CAMJE       INYNFLHSINGQKGKL--------------------------------
DDL_WOLSU       IDYRYIHQIQKAKGK---------------------------------
DDL_HELHP       VSYKYIEQIHYAKGK---------------------------------
DDL_HELPY       IKNSYLLQIQKNK-----------------------------------
DDL_HELPJ       VKNSYLLQIQKNK-----------------------------------