CLUSTAL format seed alignment for MF_00048

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y303_AGRFC       ---MAVDGQSNKRRKAERRGHAAEYWAALYLLLKGYRILAIRYRT-RLGEIDLIAR---K
Y1769_BRUME      -----MTDLREKKRIAFFRGHSAERLAAFALMLKGFRIVARRYRT-RLGEIDLIAR---R
Y143_CAUVC       ---MAAGVRQSRGTAARKVGRRAEVIAALWLMAKGYRILGFRLAT-PLGEIDLLAQ---R
Y1796_NOSS1      -------------MSHLNIANLGEDFVAQWLQSTGWIILHRQFSC-RWGEIDIIAQHTRN
Y041_AQUAE       -----------------MKGREYEDLAARYLKSKGYQILGRNLRS-PYGEIDILAE---F
Y148_CAMJE       -----------MGVKAYLDGILGEDKACKFLKKQGFEILKRNFHS-KFGEIDIIAK---K
Y1370_FUSNN      -------------MNTREIGNEYEDKSVEILVKEDYKILERNYQN-KFGEIDIIAE---K
Y935_BIFLO       --------MGDRNLTPKQFGALGEQYAAAWLEEHGWTTLSRNWHT-RYGELDIVML---N
Y2262_CHLTE      ------------MNAPQWLGAEGEKIAARHLAAKGYRIVARNYRF-HRNEIDIIAF---D
Y1920_COREF      -----------MKTEKQKLGAVGENLVATHYVRRGYGIVERNVRY-PFGELDLIVE---D
Y2031_CORGL      -----------MKTQKQYLGAFGEDVALQQYLDDQATLLDRNVRY-SCGELDLIVR---S
Y1763_CLOAB      -----------MHRLNKKAGDYGEKAAEIYLKKSGYTILNRNFRC-FLGEVDIIAK---N
Y1705_CLOPE      -----------MKKYNKSIGFYGEDLSVSFLEKEGYSILEKNFNC-SSGEIDIIAI---K
Y580_VIBCH       ----------MVFVNSRHQGNHYEQMAADYLRRQGLTLVTQNVNY-RFGELDLIMR---D
Y590_VIBVU       ----------MGLFSRRAIGNQYESLAKEYLQRQGLRFIEANFTT-KVGEIDLIFK---E
Y3265_RALSO      ---MHAPQPAPSPPGAAATGEAAEDRALRYLQARGLSVIARNYRC-KTGEIDLVMR---D
Y299_SHEON       ----------------MTLGQQAESLAQSYLEQQGLSFVERNVRY-PFGEIDLVMR---H
Y4424_PSEAE      ---------MTDRESSRDKGRQAEELACAHLRRQGLATLGKNWTC-RRGELDLVML---D
Y341_NEIMA       ------------MRLNHKQGEAGEDAALAFLQSQGCTLLARNWHC-AYGEIDLIVK---N
Y2089_NEIMB      ------------MRLNHKQGEAGEDAALAFLQSQGCTLLARNWHC-AYGEIDLIVK---N
Y2898_MYCTU      -------MTTLKTMTRVQLGAMGEALAVDYLTSMGLRILNRNWRC-RYGELDVIAC---D
Y5602_STRCO      --MIVGAGGGADMNARGAMGRYGETLAARRLTGAGMTVLERNWRCGRTGEIDIVAR---D
Y823_HELPY       --------MRFLNNKHREKGLKAEEEACGFLKSLGFEMVERNFFS-QFGEIDIIAL---K
Y823_HELPJ       --------MRFLNNKHREKGLKAEEEACGFLKTLGFEMIERNFFS-QFGEIDIIAL---K
Y253_THEMA       ----------------MMDWKEAEELACKFLKKKGYKILERNYRT-KYGEIDIVAR---D
Y2381_LEPIN      -----------MSKLKKRKGDEGESIASNFLISLDHEILKRNYRF-LHCEIDIISV---K
Y4633_RHILO      ----MAERPSASRQKAYRRGHRGEWLAAAALMLKGYRILARRHRT-RFGEIDLIAR---R
Y337_RHIME       ---MKAERPDTRKLKALKRGHIAEYRAALCLMLKGYRIVAMRYRT-RLGEIDIIAR---R
Y1452_CALS4      ----------MKKVNKKTVGSVGEKIAAQYLSKKGYKILEKNFKC-KIGEIDLIAL---Y
Y913_TREPA       -----------MPKHNKLLGAFGEAYAARWLATRGYIIITRNWRR-ATGEIDIIAQ---Q
Y1737_THEEB      ---------------MRHVGDRGEAVVAAWLQTQQCQILAQNWSC-PWGELDIIAC---D
Y189_SYNY3       ---------------MTDLGQAGESLVAAWLEQQGGKILQQRWRS-PWGEIDLITH----
YRAN_ECOLI       MATVPTRSGSPRQLTTKQTGDAWEAQARRWLEGKGLRFIAANVNE-RGGEIDLIMR---E
YRAN_ECOL6       MATVPTRSGSPRQLTTKQTGDAWEAQARRWLEGKGLRFIAANVNE-RGGEIDLIMR---E
YRAN_ECO57       MATVPTRSGSPRQLTTKQTGDAWEVQARRWLEGKGLRFVAANVNE-RGGEIDLIMR---E
YRAN_SALTI       MAQIPARGDCSRQLTRKQAGDAWEAAARLWLESKGLRFIAANVRE-RGGEIDLIMR---D
YRAN_SALTY       MAQIPARGDCSRQLTRKQAGDAWEAAARRWLESKGLRFIAANVRE-RGGEIDLIMR---D
Y3549_YERPE      -------------MSQRDTGAHYENLARRHLERAGLVFQAANVAF-RGGEIDLIMR---D
Y764_XANAC       -----------MPAARQQRGAAVEAAARALLEQAGLRLVVGNANY-RGGELDLVMH---D
Y710_XANCP       -----------MPAARQQRGAAVEAAARAQLEQAGLRLVAGNANY-RGGELDLVMR---D
Y554_XYLFA       ------------MLNRRECGAAVEVAARRHLERAGLRWLASNVCF-RGGELDLVMY---D
Y1656_HAEIN      -----------MFSLKRQQGASFEHQARLFLESKGLIFIAANQNF-KCGELDLIMN---D
Y647_PASMU       -----------MFSLKRQQGARFEYQARLFLESKGLQFVAANQSF-SCGELDLIMR---D
                                        *                 .       *:*::      

Y303_AGRFC       --KD-LIAIIEVKARAS---G---GSAVDAVGFHSQQRIRAAADLWLSRRR-DAGRFSLR
Y1769_BRUME      --GD-LVLIVEVKARAS-----F-EAAQFAVTPQAMRRIEAAADLWLQRQT-DRARLSLR
Y143_CAUVC       --GK-VLAVVEVKQRTT---IE---DALDAVKPTQRERLRRAATHLAAHRA-GLRDLLVR
Y1796_NOSS1      NQES-ILAFVEVKTRSP---GNWDDGGRGAITLKKQAKIERTAKIFLAKYP-DKAEYICR
Y041_AQUAE       --EG-RKVIVEVKGSET-----F--FPAEKVTPHKLSKIIRTAYEVLGEE-------PFS
Y148_CAMJE       --DE-ILHFIEVKFTQN----DY--EVSERLDRKKLEKILKTIEFY---HLKNGISSDFQ
Y1370_FUSNN      --NK-EIIFIEVKYRKT---NKFG-YGYEAVDRRKIMKILKLANYYIQSKK--YQDYKIR
Y935_BIFLO       --PEYTVVFVEVKSRRS---MHYG-YPQEAITPAKQHNLRKAACDWLLDRRNRVPHSAVR
Y2262_CHLTE      --GE-ALCFIEVKTRAS---LGKG-HPAESVTRSKQKEIARAAAGYLASLD--DPWITCR
Y1920_COREF      --SDGTTVFVEVKTRRG---TGFG--AAESVTGRKLTRMRRAATTWLQGR----HYREIR
Y2031_CORGL      --ASGVVVFVEVKTRRG---SAFD--SAAAVNNQKMLRMRRAAALWLEGKP----YTPIR
Y1763_CLOAB      --KD-YITFVEVKSRWS---DTYG-LPCEAVNYRKKLKIYRTAKYYIASK--SLINYNFR
Y1705_CLOPE      --DE-IISFIEVKSRFS---NSFG-NPKESVTCSKQRRIINAAKYYLHIKK--LYNYYIR
Y580_VIBCH       --GN-TLVFVEVRYRNN---TQHG-HAAETVTRTKRARLIKAANCWMLANKMNSHSADFR
Y590_VIBVU       --AQ-TIVFVEVKYRKN---SCYG-DAAEMVNPAKANKLIKTAYLWLNKHGYNACNTAMR
Y3265_RALSO      -VAG-TLVFVEVRARVARSAQRFG-GAAASVTPAKQRRLIAAAEDFLAGHPG--EVPACR
Y299_SHEON       --KK-YWVFVEVKYRSA---NQFG-GAIQALSKAQIGRIRMAASHYLQSHK---LDVPCR
Y4424_PSEAE      --GD-TVVFVEVRSRRH---RAWG-GALESIDARKRQRLILSAELFLQQEA-RWAKRPCR
Y341_NEIMA       --GG-MILFVEVKYRKN---RQFG-GAAYSISPSKLLKLQRSVEYYLQQNR--LTNVPCR
Y2089_NEIMB      --GG-MILFVEVKYRKN---RQFG-GVAYSISPSKLLKLQRSVEYYLQQNR--LTNVPCR
Y2898_MYCTU      AATR-TVVFVEVKTRTG---DGYG-GLAHAVTERKVRRLRRLAGLWLADQE--ERWAAVR
Y5602_STRCO      --GD-VLVVCEVKTRRG---GAFE-HPMAAVTPDKAERLRRLAERWIQTHGG-APPGGVR
Y823_HELPY       --KG-VLHFIEVKSGEN-----F--DPIYAITPSKLKKMIKTIRCYLSQK--DPNSDFC-
Y823_HELPJ       --KG-VLHFIEVKSGEN-----F--DPIYAITPSKLKKMIKTIRCYLSQK--DPNSDFC-
Y253_THEMA       --GR-EIVFVEVKSGSG------KVDPLERIDLKKVRNLEQTARFYMIQNK---LKGPAR
Y2381_LEPIN      --EE-VLYFSEVKFWKE---FKFF-DPRFTFNLAKQTKMRKAAKGFLAENL-SFQNHFVS
Y4633_RHILO      --GD-LVVFVEVKARRS---LM---EAMEAIGHESERRIEAAADIWLSRQA-DYGRLSMR
Y337_RHIME       --GD-LVACVEVKARVS------LEDAVFAVTDTAQRRIRAASDLWLSRQ-GDFHRLSVR
Y1452_CALS4      --KN-QIVFVEVKTRTS---VNFG-LPSEAVDFHKQQKIVKIAQVYIASS--NFKQYQPR
Y913_TREPA       --DD-TIVFVEVKTLRC---TSYA-DLAIIVGKRKQKRICETAKHFLASAR-EYNHMCAR
Y1737_THEEB      -PGG-VVLFVEVKTRGS---YNWDRDGLDAISPSKQRKLILAAQAFLESQP-QWQEHPCR
Y189_SYNY3       FPDTKIIAFVEVKTRSG---GNWDQGGLLAVNARKQEKIWQTANHFLASQP-QWSDWNCR
YRAN_ECOLI       --GR-TTIFVEVRYRRS---ALYG-GAAASVTRSKQHKLLQTARLWLARHNGSFDTVDCR
YRAN_ECOL6       --GR-TTVFIEVRYRRS---ALYG-GAAASVTRSKQHKLLQTARLWLARHNGSFDTVDCR
YRAN_ECO57       --GR-TTVFVEVRYRRS---ALYG-GAAASVTRSKQHKLLQTARLWLARHNGSFDTVDCR
YRAN_SALTI       --GK-TTVFVEVRYRRS---GLYG-GAAASVTRSKQHKLLHTARLWLARQNGSFDTVDCR
YRAN_SALTY       --GK-TTVFVEVRYRRS---GLYG-GAAASVTRSKQHKLLHTARLWLARQNGSFDTVDCR
Y3549_YERPE      --GD-AWVFVEVRFRRN---DLFG-GAAASITPRKQQRLHLAAAVWLAQRGASFATTSCR
Y764_XANAC       --GP-SLVFVEVRYRRD---DRFG-GGAASVDWRKRRKLVLAAQLFLGAHP-ALAALPCR
Y710_XANCP       --GP-MLVFVEVRYRRD---ARFG-GGAASVDFRKRRKLVLAAQLFLAAHP-ALAALPCR
Y554_XYLFA       --VM-SVVFVEVRYRQQ---ENHG-SAAQSVDRRKRRKLVMAAQLFLQRHP-FLAQVPCR
Y1656_HAEIN      --KE-TIVFVEVRQRSH---SAYG-SAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCR
Y647_PASMU       --QD-TLVFVEVRQRKN---AVFG-SAVESVDWKKQKKWLNAASLWLAQQNRSLEDTDCR
                           **:                 .      .                      

Y303_AGRFC       FDIVAVLPRRLPQHFIDAF-----------------------------------
Y1769_BRUME      FDMVAVLPRRWPKHVPAFFTAGHYG-----------------------------
Y143_CAUVC       LDLIAMAPGRPPRHLPDAWGGA--------------------------------
Y1796_NOSS1      FDVAIVAYQGISQQDHAAIGEYKFQLQEYIPAAFDCLIY---------------
Y041_AQUAE       IEVVVVYRGKVYHYKDLGLEL---------------------------------
Y148_CAMJE       IDLICIKNDVIQFCENISF-----------------------------------
Y1370_FUSNN      FDCMSYLGDELDWIKNIVWGDEVGF-----------------------------
Y935_BIFLO       FDVVTIVLRVGRPLVHHIENAF--------------------------------
Y2262_CHLTE      FDVIAVLALSIDERSIRKYEIEHIKAAFMVGDKG--------------------
Y1920_COREF      FDVVTVVIDPTTGGYVLDHFEGVDDGAR--------------------------
Y2031_CORGL      FDVVAIVLDPHTGRPEITVYEDVEHGAR--------------------------
Y1763_CLOAB      FDVIEVILNHQNDSYDLKFIENAFQI----------------------------
Y1705_CLOPE      FDVIEINFHIDSSKYELNFLKDAFRV----------------------------
Y580_VIBCH       FDVIAIHQQGQHIDWLKNAITEG-------------------------------
Y590_VIBVU       FDVVAIHSNGHDINWIANAITQG-------------------------------
Y3265_RALSO      FDVIAIDGTRIEWMRDAFGVEA--------------------------------
Y299_SHEON       FDVVAIEDTQIQWLVDAF------------------------------------
Y4424_PSEAE      FDVVTVDTSDGQSPPRLDWIQNAFDA----------------------------
Y341_NEIMA       LDAVLIEGSRPPEWIQNITG----------------------------------
Y2089_NEIMB      LDAVLIEGSRPPEWIQNITG----------------------------------
Y2898_MYCTU      IDVIGVRVGPKNSGRTPELTHLQGIG----------------------------
Y5602_STRCO      IDLVGVLLPQRGAPVVEHARGVA-------------------------------
Y823_HELPY       IDALIVKNGKFELLENITF-----------------------------------
Y823_HELPJ       IDALIVKNGKFELLENITF-----------------------------------
Y253_THEMA       VDFVRVTPEGIDHFEGIWLG----------------------------------
Y2381_LEPIN      FCLVSVNEKKGCKYYLDLF-----------------------------------
Y4633_RHILO      FDMVAVLPWRWPVHVENAFYGRN-------------------------------
Y337_RHIME       YDIVAVTPWRWPRHLPDAF-----------------------------------
Y1452_CALS4      FDIIEVYLNPEKLTLEKVNHILNAF-----------------------------
Y913_TREPA       FDVIVLRSDPFRRQDVDIVHLPHAFEDLV-------------------------
Y1737_THEEB      FDVALVRHQRGAYHLHHYLAQAFTLDSIK-------------------------
Y189_SYNY3       FDVMIVFSQGSVPTGENAEGKFANLPTNFQMGQTIVWQGYRLRLEQYLTDAFGG
YRAN_ECOLI       FDVVAFTGNEVEWIKDAFNDHS--------------------------------
YRAN_ECOL6       FDVVAFTGNEVEWIKDAFNDHS--------------------------------
YRAN_ECO57       FDVVAFTGNEVEWIKDTFNDHS--------------------------------
YRAN_SALTI       FDVLAFTGNEIEWFRDAFNDHS--------------------------------
YRAN_SALTY       FDVLAFTGNEIEWFRDAFNDHS--------------------------------
Y3549_YERPE      FDVVAITGNQLEWLPNAFNTD---------------------------------
Y764_XANAC       FDVVDASGEPPVLHWIRDAFRADDC-----------------------------
Y710_XANCP       FDVVEASGEPPLLHWIRDAFRLDDC-----------------------------
Y554_XYLFA       FDVVEGAGRPLQLHWIRDAFRLDDC-----------------------------
Y1656_HAEIN      FDLIAFGKTPQDIQWIPNFLD---------------------------------
Y647_PASMU       FDLIAFGKTTQDLEWIINFLD---------------------------------