CLUSTAL format seed alignment for MF_00049_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYL_GEOKA       ---------------------------------------------------------MSF
SYL_GEOTN       ---------------------------------------------------------MSF
SYL_BACCZ       ---------------------------------------------------------MSF
SYL_BACAH       ---------------------------------------------------------MSF
SYL_BACAN       ---------------------------------------------------------MSF
SYL_BACHK       ---------------------------------------------------------MSF
SYL_BACC1       ---------------------------------------------------------MSF
SYL_BACCR       ---------------------------------------------------------MSF
SYL_BACCN       ---------------------------------------------------------MSF
SYL_BACSU       ---------------------------------------------------------MSF
SYL_BACVZ       ---------------------------------------------------------MSF
SYL_BACLD       ---------------------------------------------------------MSF
SYL_BACP2       ---------------------------------------------------------MSF
SYL_BACHD       ---------------------------------------------------------MSF
SYL_BACSK       ---------------------------------------------------------MSF
SYL_OCEIH       ---------------------------------------------------------MSF
SYL_STAES       ---------------------------------------------------------MNY
SYL_STAEQ       ---------------------------------------------------------MNY
SYL_STAAW       --------------------------------------------------------MLNY
SYL_STAAS       ---------------------------------------------------------MNY
SYL_STAAN       ---------------------------------------------------------MNY
SYL_STAA1       ---------------------------------------------------------MNY
SYL_STAAM       ---------------------------------------------------------MNY
SYL_STAA9       --------------------------------------------------------MLNY
SYL_STAA2       --------------------------------------------------------MLNY
SYL_STAA3       --------------------------------------------------------MLNY
SYL_STAAC       --------------------------------------------------------MLNY
SYL_STAA8       --------------------------------------------------------MLNY
SYL_STAAT       --------------------------------------------------------MLNY
SYL_STAAE       --------------------------------------------------------MLNY
SYL_STAAB       ---------------------------------------------------------MNY
SYL_STAAR       ---------------------------------------------------------MNY
SYL_STAHJ       ---------------------------------------------------------MGY
SYL_STAS1       ---------------------------------------------------------MNY
SYL_LISMF       ---------------------------------------------------------MTF
SYL_LISMO       ---------------------------------------------------------MTF
SYL_LISIN       ---------------------------------------------------------MTF
SYL_LISW6       ---------------------------------------------------------MTF
SYL_ENTFA       ---------------------------------------------------------MSY
SYL_STRTD       --------------------------------------------------------MSFY
SYL_STRT2       --------------------------------------------------------MSFY
SYL_STRT1       --------------------------------------------------------MSFY
SYL_STRP2       --------------------------------------------------------MSFY
SYL_STRR6       --------------------------------------------------------MSFY
SYL_STRPN       --------------------------------------------------------MSFY
SYL_STRSV       --------------------------------------------------------MAYY
SYL_STRGC       --------------------------------------------------------MSTY
SYL_STRS2       --------------------------------------------------------MSFY
SYL_STRSY       --------------------------------------------------------MSFY
SYL_STRPD       --------------------------------------------------------MTFY
SYL_STRPG       --------------------------------------------------------MTFY
SYL_STRP6       --------------------------------------------------------MTFY
SYL_STRPM       --------------------------------------------------------MTFY
SYL_STRPF       --------------------------------------------------------MTFY
SYL_STRPB       --------------------------------------------------------MTFY
SYL_STRPC       --------------------------------------------------------MTFY
SYL_STRP3       --------------------------------------------------------MTFY
SYL_STRP1       --------------------------------------------------------MTFY
SYL_STRP8       --------------------------------------------------------MTFY
SYL_STRA3       --------------------------------------------------------MTFY
SYL_STRA5       --------------------------------------------------------MTFY
SYL_STRA1       --------------------------------------------------------MTFY
SYL_STRMU       --------------------------------------------------------MVYY
SYL_LACLM       ---------------------------------------------------------MEY
SYL_LACLA       ---------------------------------------------------------MEY
SYL_LACLS       ---------------------------------------------------------MEY
SYL_LACSS       ---------------------------------------------------------MTY
SYL_LACDA       ----------------------------------------------------------MY
SYL_LACDB       ----------------------------------------------------------MY
SYL_LACP3       ---------------------------------------------------------MAY
SYL_LACPL       ---------------------------------------------------------MAY
SYL_LACBA       ---------------------------------------------------------MAY
SYL_PEDPA       ---------------------------------------------------------MAY
SYL_LACS1       ---------------------------------------------------------MSY
SYL_LACRD       ---------------------------------------------------------MAY
SYL_LEUMM       ---------------------------------------------------------MAY
SYL_OENOB       ---------------------------------------------------------MSY
SYL_SALRD       ---------------------------------------------------------MAY
SYL1_RHIL3      ---------------------------------------------------------MPY
SYL_RHOBA       --------------------------------------------------------MVRY
SYL_PELLD       ---------------------------------------------------------MKY
SYL_CHLPM       ---------------------------------------------------------MRY
SYL_CHLCH       ---------------------------------------------------------MKY
SYL_CHLTE       ---------------------------------------------------------MKY
SYL_CHLPD       ---------------------------------------------------------MRY
SYL_LEPBL       ---------------------------------------------------------MQY
SYL_LEPBJ       ---------------------------------------------------------MQY
SYL_LEPIC       ---------------------------------------------------------MQY
SYL_LEPIN       ---------------------------------------------------------MQY
SYL_BACTN       ---------------------------------------------------------MEY
SYL_BACV8       ---------------------------------------------------------MEY
SYL_BACFR       ---------------------------------------------------------MEY
SYL_BACFN       ---------------------------------------------------------MEY
SYL_PARD8       ---------------------------------------------------------MEY
SYL_PORGI       ---------------------------------------------------------MEY
SYL_FLAPJ       ---------------------------------------------------------MKY
SYL_FLAJ1       ---------------------------------------------------------MKY
SYL_GRAFK       ---------------------------------------------------------MSY
SYL_CYTH3       --------------------------------------------------------MADY
SYL_BDEBA       ---------------------------------------------------------MSL
SYL_SORC5       ------------------------------MARRDMAAETMDPRASTEPSPNEPREPARY
SYL_TREDE       ---------------------------------------------------------MAY
SYL_TREPA       ---------------------------------------------------------MGY
SYL_BORAP       --------------------------------------------------------MSKY
SYL_BORBP       --------------------------------------------------------MSKY
SYL_BORBU       --------------------------------------------------------MSKY
SYL_CHLTR       ---------------------------------------------------------MRY
SYL_CHLTA       ---------------------------------------------------------MRY
SYL_CHLMU       ---------------------------------------------------------MRY
SYL_CHLFF       ---------------------------------------------------------MRY
SYL_CHLCV       ---------------------------------------------------------MRY
SYL_CHLAB       ---------------------------------------------------------MRY
SYL_CHLPN       ---------------------------------------------------------MRY
SYL_PARUW       ---------------------------------------------------------MKY
SYL_ALKOO       --------------------------------------------------------MKQY
SYL_UREP2       ----------------------------------------------------------MY
SYL_UREPA       ----------------------------------------------------------MY
SYL_MYCPU       ----------------------------------------------------------MY
SYL_MYCPE       ----------------------------------------------------------MY
SYL_MYCGA       ----------------------------------------------------------MY
SYL_MYCGE       ----------------------------------------------------------MY
SYL_MYCPN       ----------------------------------------------------------MY
SYL_MYCCT       ---------------------------------------------------------MDF
SYL_MYCMS       ---------------------------------------------------------MDF
SYL_MESFL       ---------------------------------------------------------MEF
SYL_ACHLI       --------------------------------------------------------MHKY
SYL_PSEA6       ------------------------------------------------------MAEKIY
SYL_COLP3       -------------------------------------------------------MEAIY
SYL_IDILO       -------------------------------------------------------MQEQY
SYL_PSEHT       -------------------------------------------------------MQEQY
SYL_PSYIN       -------------------------------------------------------MQELY
SYL_SALCH       -------------------------------------------------------MQEQY
SYL_SALTI       -------------------------------------------------------MQEQY
SYL_SALTY       -------------------------------------------------------MQEQY
SYL_SALPB       -------------------------------------------------------MQEQY
SYL_SALPA       -------------------------------------------------------MQEQY
SYL_CITK8       -------------------------------------------------------MQEQY
SYL_SALAR       -------------------------------------------------------MQEQY
SYL_SHIFL       -------------------------------------------------------MQEQY
SYL_SHIF8       -------------------------------------------------------MQEQY
SYL_SHIBS       -------------------------------------------------------MQEQY
SYL_ECOL6       -------------------------------------------------------MQEQY
SYL_ECOL5       -------------------------------------------------------MQEQY
SYL_ECO57       -------------------------------------------------------MQEQY
SYL_SHISS       -------------------------------------------------------MQEQY
SYL_ECOLI       -------------------------------------------------------MQEQY
SYL_ECOLC       -------------------------------------------------------MQEQY
SYL_SHIDS       -------------------------------------------------------MQEQY
SYL_ECOHS       -------------------------------------------------------MQEQY
SYL_ECOUT       -------------------------------------------------------MQEQY
SYL_ECOK1       -------------------------------------------------------MQEQY
SYL_ECO24       -------------------------------------------------------MQEQY
SYL_KLEP7       -------------------------------------------------------MQEQY
SYL_CROS8       -------------------------------------------------------MQEQY
SYL_ENT38       -------------------------------------------------------MQEQY
SYL_YERPA       -------------------------------------------------------MQEQY
SYL_YERP3       -------------------------------------------------------MQEQY
SYL_YERPE       -------------------------------------------------------MQEQY
SYL_YERPN       -------------------------------------------------------MQEQY
SYL_YERPS       -------------------------------------------------------MQEQY
SYL_YERPP       -------------------------------------------------------MQEQY
SYL_YERE8       -------------------------------------------------------MQEQY
SYL_SERP5       -------------------------------------------------------MQEQY
SYL_PECAS       -------------------------------------------------------MQEQY
SYL_SODGM       -------------------------------------------------------MQELY
SYL_PHOLL       -------------------------------------------------------MQEQY
SYL_MANSM       -------------------------------------------------------MQEQY
SYL_ACTSZ       -------------------------------------------------------MQEQY
SYL_HAES1       -------------------------------------------------------MQEQY
SYL_HISS2       -------------------------------------------------------MQEQY
SYL_PASMU       -------------------------------------------------------MQEQY
SYL_HAEIG       -------------------------------------------------------MQEQY
SYL_HAEIN       -------------------------------------------------------MQEQY
SYL_HAEI8       -------------------------------------------------------MQEQY
SYL_HAEIE       -------------------------------------------------------MQEQY
SYL_ACTP2       -------------------------------------------------------MQQQY
SYL_HAEDU       -------------------------------------------------------MQQQY
SYL_SHESA       -------------------------------------------------------MQEQY
SYL_SHESM       -------------------------------------------------------MQEQY
SYL_SHESR       -------------------------------------------------------MQEQY
SYL_SHEON       -------------------------------------------------------MQEQY
SYL_SHEB9       -------------------------------------------------------MQEQY
SYL_SHEB5       -------------------------------------------------------MQEQY
SYL_SHEB8       -------------------------------------------------------MQEQY
SYL_SHESW       -------------------------------------------------------MQEQY
SYL_SHEPC       -------------------------------------------------------MQEQY
SYL_SHEAM       -------------------------------------------------------MQEQY
SYL_SHEHH       -------------------------------------------------------MQEQY
SYL_SHEPA       -------------------------------------------------------MQEQY
SYL_SHELP       -------------------------------------------------------MQEQY
SYL_SHESH       -------------------------------------------------------MQEQY
SYL_SHEDO       -------------------------------------------------------MQELY
SYL_SHEFN       -------------------------------------------------------MQELY
SYL_VIBPA       -------------------------------------------------------MQEQY
SYL_VIBCB       -------------------------------------------------------MQEQY
SYL_VIBVU       -------------------------------------------------------MQEQY
SYL_VIBVY       -------------------------------------------------------MQEQY
SYL_VIBCH       -------------------------------------------------------MQEQY
SYL_VIBC3       -------------------------------------------------------MQEQY
SYL_ALIF1       -------------------------------------------------------MQEQY
SYL_PHOPR       -------------------------------------------------------MQEQY
SYL_AERS4       -------------------------------------------------------MQEQY
SYL_AERHH       -------------------------------------------------------MQEQY
SYL_MARHV       -------------------------------------------------------MDEQY
SYL_HAHCH       -------------------------------------------------------MEELY
SYL_SACD2       -------------------------------------------------------MNEYY
SYL_MARMS       -------------------------------------------------------MQEQY
SYL_ALCBS       -------------------------------------------------------MDVQY
SYL_PSEAB       -------------------------------------------------------MHEQY
SYL_PSEAE       -------------------------------------------------------MHEQY
SYL_PSEA7       -------------------------------------------------------MHEQY
SYL_PSEU5       -------------------------------------------------------MHEQY
SYL_PSEMY       -------------------------------------------------------MHEQY
SYL_PSEP1       -------------------------------------------------------MHEQY
SYL_PSEPK       -------------------------------------------------------MHEQY
SYL_PSEPG       -------------------------------------------------------MHEQY
SYL_PSEE4       -------------------------------------------------------MHEQY
SYL_PSEU2       -------------------------------------------------------MHELY
SYL_PSE14       -------------------------------------------------------MHELY
SYL_PSESM       -------------------------------------------------------MHELY
SYL_NEIMB       -------------------------------------------------------MQEQY
SYL_NEIMF       -------------------------------------------------------MQEHY
SYL_NEIG1       -------------------------------------------------------MQEHY
SYL_NEIM0       -------------------------------------------------------MQEQY
SYL_NEIMA       -------------------------------------------------------MQEQY
SYL_CHRVO       -------------------------------------------------------MQEQY
SYL_THIDA       -------------------------------------------------------MQEKY
SYL_DECAR       -------------------------------------------------------MQDKY
SYL_AZOSB       -------------------------------------------------------MQDKY
SYL_CUPMC       -------------------------------------------------------MQDKY
SYL_CUPPJ       -------------------------------------------------------MQDKY
SYL_RALSO       -------------------------------------------------------MQDKY
SYL_JANMA       -------------------------------------------------------MQDKY
SYL_HERAR       -------------------------------------------------------MQDKY
SYL_BURCH       -------------------------------------------------------MHERY
SYL_BURCA       -------------------------------------------------------MHERY
SYL_BURL3       -------------------------------------------------------MHERY
SYL_BURCM       -------------------------------------------------------MHERY
SYL_BURVG       -------------------------------------------------------MHERY
SYL_BURP0       -------------------------------------------------------MHERY
SYL_BURPS       -------------------------------------------------------MHERY
SYL_BURP6       -------------------------------------------------------MHERY
SYL_BURP1       -------------------------------------------------------MHERY
SYL_BURM7       -------------------------------------------------------MHERY
SYL_BURM9       -------------------------------------------------------MHERY
SYL_BURMA       -------------------------------------------------------MHERY
SYL_BURMS       -------------------------------------------------------MHERY
SYL_BURTA       -------------------------------------------------------MHERY
SYL_PARXL       -------------------------------------------------------MHEKY
SYL_POLAQ       -------------------------------------------------------MSKDY
SYL_BORBR       -------------------------------------------------------MQERY
SYL_BORPA       -------------------------------------------------------MQERY
SYL_BORPE       -------------------------------------------------------MQERY
SYL_BORPD       -------------------------------------------------------MQERY
SYL_BORA1       -------------------------------------------------------MQERY
SYL_METPP       ------------------------------------------------MSTPHPAPASAY
SYL_ACISJ       -------------------------------------------------------MQDKY
SYL_ACIAC       -------------------------------------------------------MQDKY
SYL_RHOFT       -------------------------------------------------------MQEKY
SYL_VEREI       -------------------------------------------------------MQDKY
SYL_POLNA       -------------------------------------------------------MQDKY
SYL_POLSJ       -------------------------------------------------------MQDKY
SYL_METCA       -------------------------------------------------------MEETY
SYL_DICNV       -------------------------------------------------------MQDTY
SYL_PSYCK       ---------------MLWHYKISPHLSVITDSEPTMTNAVTAETANTNHTNNASSDKTQY
SYL_PSYA2       ---------------MLWHYKISPHLSVITNSEPTMSNAVTAETANT---NNTSIENAQY
SYL_PSYWF       ----------------------------MSTTAPEQNNP------------------NHY
SYL_ACIAD       ----------------------------MTTAHID----------------------AEY
SYL_NITEU       -------------------------------------------------------MQEKY
SYL_NITEC       -------------------------------------------------------MQEKY
SYL_NITMU       -------------------------------------------------------MQEKY
SYL_METFK       -------------------------------------------------------MQQQY
SYL_HYDCU       -----------------------------------------------MTTESMPESTNDY
SYL_XYLFA       ----------------------------------------------------MPTEANTY
SYL_XYLFT       ----------------------------------------------------MPTEANTY
SYL_XANC8       ---------------------------------------------------MSTVEPNAY
SYL_XANCP       ---------------------------------------------------MSTVEPNAY
SYL_XANCB       ---------------------------------------------------MSTVEPNAY
SYL_XANC5       ---------------------------------------------------MSTVEPNVY
SYL_XANAC       ---------------------------------------------------MSTVEPNVY
SYL_XANOR       ---------------------------------------------------MSTVEPNVY
SYL_XANOM       ---------------------------------------------------MSTVEPNVY
SYL_NITOC       -------------------------------------------------------MDEHY
SYL_ALKEH       -------------------------------------------------------MDASY
SYL_HALHL       -------------------------------------------------------MDNQY
SYL_CHRSD       -------------------------------------------------------MDAQY
SYL_BUCAI       -------------------------------------------------------MEKEY
SYL_BUCAP       -------------------------------------------------------MEKEY
SYL_BUCCC       ------------------------------------------------------MKNNNY
SYL_BUCBP       -------------------------------------------------------MKQNY
SYL_WIGBR       -------------------------------------------------------MKKEY
SYL_BLOPB       -------------------------------------------------------MRKSY
SYL_BLOFL       -------------------------------------------------------MKKLY
SYL_BAUCH       -------------------------------------------------------MQEFY
SYL_COXBU       -------------------------------------------------------MNESY
SYL_COXBR       -------------------------------------------------------MNESY
SYL_COXBN       -------------------------------------------------------MNESY
SYL_LEGPH       -------------------------------------------------------MDNTY
SYL_LEGPC       -------------------------------------------------------MDNTY
SYL_LEGPA       -------------------------------------------------------MDNTY
SYL_LEGPL       -------------------------------------------------------MDNTY
SYL_FRATT       --------------------------------------------------------MNEY
SYL_FRAT1       --------------------------------------------------------MNEY
SYL_FRATW       --------------------------------------------------------MNEY
SYL_FRATF       --------------------------------------------------------MNEY
SYL_FRATH       --------------------------------------------------------MNEY
SYL_FRATO       --------------------------------------------------------MNEY
SYL_FRATN       --------------------------------------------------------MNEY
SYL_FRAP2       --------------------------------------------------------MSEY
SYL_RUTMC       -------------------------------------------------------MNSEY
SYL_VESOH       -------------------------------------------------------MNIKY
SYL_RICRS       ------------------------------------------------------------
SYL_RICRO       ------------------------------------------------------------
SYL_RICCN       ------------------------------------------------------------
SYL_RICM5       ------------------------------------------------------------
SYL_RICFE       ------------------------------------------------------------
SYL_RICAH       ------------------------------------------------------------
SYL_RICCK       ------------------------------------------------------------
SYL_RICBR       ------------------------------------------------------------
SYL_RICPR       ------------------------------------------------------------
SYL_RICTY       ------------------------------------------------------------
SYL_ORITB       -----------------------------------------------------------M
SYL_WOLPM       ------------------------------------------------------------
SYL_WOLTR       ------------------------------------------------------------
SYL_EHRRW       ------------------------------------------------------------
SYL_EHRRG       ------------------------------------------------------------
SYL_EHRCJ       ------------------------------------------------------------
SYL_EHRCR       ------------------------------------------------------------
SYL_ANAMM       --------------------------------------------------------MEFF
SYL_NEOSM       ------------------------------------------------------------
SYL2_RHIL3      ------------------------------------------------MATE------RY
SYL_RHIEC       ------------------------------------------------MATE------RY
SYL_RHIME       ------------------------------------------------MATE------RY
SYL_SINMW       ------------------------------------------------MATE------RY
SYL_AGRFC       ------------------------------------------------MAIE------RY
SYL_BRUAB       ------------------------------------------------MAAE------RY
SYL_BRUA2       ------------------------------------------------MAAE------RY
SYL_BRUSI       ------------------------------------------------MAAE------RY
SYL_BRUO2       ------------------------------------------------MAAE------RY
SYL_BRUME       ------------------------------------------------MAAE------RY
SYL_BRUSU       ------------------------------------------------MAAE------RY
SYL_BRUC2       ------------------------------------------------MAAE------RY
SYL_OCHA4       ------------------------------------------------MAAE------RY
SYL_CHESB       ------------------------------------------------MATE------RY
SYL_RHILO       ------------------------------------------------MATE------RY
SYL_BART1       ----------------------------------------------MGMTIEHYKIGERY
SYL_BARHE       ------------------------------------------------MTIEHYNLGERY
SYL_BARQU       ------------------------------------------------MTIEHSNVGERY
SYL_BARBK       ------------------------------------------------MTIE------RY
SYL_RHOP2       ------------------------------------------------MSNE------RY
SYL_RHOPS       ------------------------------------------------MSNE------RY
SYL_RHOPA       ------------------------------------------------MSNE------RY
SYL_RHOP5       ------------------------------------------------MTSE------RY
SYL_NITHX       ------------------------------------------------MTSD------RY
SYL_NITWN       ------------------------------------------------MTSE------RY
SYL_BRASB       ------------------------------------------------MTSE------RY
SYL_BRASO       ------------------------------------------------MTSE------RY
SYL_BRADU       ------------------------------------------------MTSE------RY
SYL_RHOPB       ------------------------------------------------MTNE------RY
SYL_AZOC5       ------------------------------------------------MSTD------RY
SYL_PARL1       ------------------------------------------------MSTR-------Y
SYL_CAUVC       --------------------------------------------------------MARY
SYL_CAUSK       --------------------------------------------------------MARY
SYL_MARMM       --------------------------------------------------------MTRY
SYL_HYPNA       -------------------------------------------------------MATRY
SYL_RUEST       --------------------------------------------------------MSRY
SYL_RUEPO       --------------------------------------------------------MSRY
SYL_ROSDO       --------------------------------------------------------MTRY
SYL_JANSC       --------------------------------------------------------MSRY
SYL_DINSH       ----------------------------------------------MPADTPAGSAPARF
SYL_RHOS1       --------------------------------------------------------MSRY
SYL_RHOS4       --------------------------------------------------------MSRY
SYL_RHOS5       --------------------------------------------------------MSRY
SYL_PARDP       ---------------------------------------------------------MPY
SYL_ZYMMO       ------------------------------------------MSESGFSQR--------F
SYL_SPHWW       -----------------------------------------------MSAR--------F
SYL_NOVAD       --------------------------------------MTENTPGTSAPER--------F
SYL_SPHAL       ---------------------------------------------MTRETR--------F
SYL_GRABC       ------------------------------------------MTDSITDLQSDQRPDRSY
SYL_GLUOX       ------------------------------------------MSDTTAPA---------F
SYL_ACICJ       ------------------------------------------MDQTTHDASA-------Y
SYL_MAGSA       ------------------------------------------MSRPDGISGD------RY
SYL_RHORT       -----------------------------------------------MASED------RY
SYL_MAGMM       -------------------------------------------------------MDQKY
SYL_CAMJ8       ---------------------------------------------------------MAY
SYL_CAMJJ       ---------------------------------------------------------MAY
SYL_CAMJR       ---------------------------------------------------------MAY
SYL_CAMJE       ---------------------------------------------------------MAY
SYL_CAMJD       ---------------------------------------------------------MAY
SYL_CAMC1       -----------------------------------------------------MAEKRKY
SYL_CAMC5       -----------------------------------------------------MAQNSKY
SYL_CAMFF       ---------------------------------------------------------MEY
SYL_CAMHC       ----------------------------------------------------------MY
SYL_ARCB4       ---------------------------------------------------------MEY
SYL_NITSB       ---------------------------------------------------------MQY
SYL_WOLSU       ---------------------------------------------------------MEY
SYL_HELHP       ------------------------------------------------------MQERKY
SYL_HELPY       -----------------------------------------------------------M
SYL_HELPH       -----------------------------------------------------------M
SYL_HELPJ       -----------------------------------------------------------M
SYL_HELAH       -----------------------------------------------------------M
SYL_THEMA       --------------------------------------------------------MKEY
SYL_THEP1       --------------------------------------------------------MKEY
SYL_THEM4       --------------------------------------------------------MKEY
SYL_FERNB       --------------------------------------------------------MKEY
SYL_PSELT       --------------------------------------------------------MPRY
SYL_CALS8       ---------------------------------------------------------MEY
SYL_HUNT2       ---------------------------------------------------------MYY
SYL_DESHY       -------------------------------------------------------MQEKY
SYL_SYNWW       -------------------------------------------------------MDRKY
SYL_CARHZ       -------------------------------------------------------MQERY
SYL_PELTS       -------------------------------------------------------MKERY
SYL_MOOTA       -------------------------------------------------------MEARY
SYL_DESRM       -------------------------------------------------------MQEHY
SYL_SYMTH       ------------------------------------------------------MAEERF
SYL_DESVH       ---------------------------------------------------------MKY
SYL_DESVV       ---------------------------------------------------------MKY
SYL_DESAG       ---------------------------------------------------------MKY
SYL_LAWIP       -----------------------------------------------------MIMHSNY
SYL_GEOMG       -------------------------------------------------------MEEKY
SYL_GEOSL       -------------------------------------------------------MQERY
SYL_GEOUR       -------------------------------------------------------MEEKY
SYL_PELPD       -------------------------------------------------------MEQKY
SYL_PELCD       -------------------------------------------------------MEERY
SYL_SYNAS       -------------------------------------------------------MNRKY
SYL_SYNFM       -------------------------------------------------------MDYKY
SYL_DESPS       ---------------------------------------------------MQHPTNARY
SYL_FUSNN       --------------------------------------------------------MRDY
SYL_TRIV2       -------------------------------------------------------MDSRY
SYL_NOSS1       -------------------------------------------------------MDSRY
SYL_ACAM1       -------------------------------------------------------MESRY
SYL_TRIEI       -------------------------------------------------------MDSKY
SYL_SYNY3       -------------------------------------------------------MASPY
SYL_SYNE7       ---------------------------------------MQNGANSRSQEYQGVSVDSRY
SYL_SYNP6       ---------------------------------------MQNGANSRSQEYQGVSVDSRY
SYL_THEEB       -------------------------------------------------------MDDRY
SYL_SYNJB       -------------------------------------------------------MDARY
SYL_SYNJA       -------------------------------------------------------MDARY
SYL_GLOVI       -------------------------------------------------------METRY
SYL_SYNS3       ----------------------------------------MTAFSSPSSNAASSA-TDRY
SYL_SYNPW       ----------------------------------------MTASKSSSATASASDRPDRY
SYL_PROMM       ------------------------------------------MTESFPSTSASSQSSARY
SYL_PROM3       ------------------------------------------MTESFPSTSASSHSSARY
SYL_SYNSC       -----------------------------------MPSAGSVNAANPAVDT--SAQTGRY
SYL_SYNS9       ----------------------------MYGTIAAKPHAGPVNAASSSASANNSPQENRY
SYL_SYNPX       -------------------------------------------------------MNSRY
SYL_SYNR3       ----------------------------------------------------MASSESRY
SYL_PROMT       -----------------------------------------MNNTTSDINDQR------Y
SYL_PROM1       -----------------------------------------MNNTTSDINDQR------Y
SYL_PROMA       -----------------------------------------MASKISQTPEKQP--STAY
SYL_PROM0       -----------------------------------------MISPDQQYETDT----NLY
SYL_PROM9       -----------------------------------------MISPDKQYETDT----NLY
SYL_PROMS       -----------------------------------------MISPDKRYEADT----NLY
SYL_PROM2       -----------------------------------------MISPDKQYESFT----NLY
SYL_PROMP       -----------------------------------------MITSENTDNRAT----NLY
SYL_PROM5       -----------------------------------------MIYSENTDEKSNQHTNNLY
SYL_SOLUE       ------------------------------------------------------MPEKPY
SYL_DEIRA       ------------------------------------------MTQEATKPNIQEPRAERY
SYL_DEIGD       ----------------------------------------------MTKPEIREPRAERY
SYL_RUBXD       ----------------------------------------------MSETFAKRASRRGY
SYL_CLOPE       ---------------------------------------------------------MGN
SYL_CLOPS       ---------------------------------------------------------MGN
SYL_CLOP1       ---------------------------------------------------------MGN
SYL_CLOB8       ---------------------------------------------------------MAN
SYL_CLOB1       ---------------------------------------------------------MGN
SYL_CLOBH       ---------------------------------------------------------MGN
SYL_CLOBL       ---------------------------------------------------------MGN
SYL_CLONN       ---------------------------------------------------------MGN
SYL_CLOAB       ---------------------------------------------------------MST
SYL_CLOK5       -----------------------------------------------------------M
SYL_CLOTE       ---------------------------------------------------------MGN
SYL_CALS4       -------------------------------------------------------MEDMA
SYL_ROSCS       ------------------------------------------------MSDTGTKRRIER
SYL_ROSS1       ------------------------------------------------MSETGAKRRMDR
SYL_THEFY       --------------------------MTAVSG--------------------DQTTSGSY
SYL_ACIC1       --------------------------MAGLGSPLGR---------------LTAVTSEIY
SYL_ARTS2       --------------------------MSVQPETET-GTA---------AVATEGPEEGTY
SYL_PAEAT       --------------------------MSVKPETET-GTAQ--------TAAAEAPEEGVY
SYL_RENSM       -----------------MVQSRGFSLSSVRNGTEG-NTMSQHTSQPAADVPVDVADENRY
SYL_CLAMS       ----------------------------M-------------------AHETPDTPGETY
SYL_CLAM3       ----------------------------M-------------------AHETPDTPGETY
SYL_LEIXX       --------------------MAHQHDTGT-------------------AAAAAGKTAIHY
SYL_KINRD       --------MRDARTHREDEMTQTDTQATG-------------------PDRAEEQDGQRY
SYL_NOCSJ       ------------------MCPEQPHDTRAERDE----------MSEQTQQAAQPAETAAY
SYL_TROW8       -----------------------MHAL---------------------RALDTLCENMEY
SYL_TROWT       -----------------------MHAL---------------------RALDTLCENMEY
SYL_MYCPA       ---------------MTESPTTSPAT---------------GSGAAAPDSDAPPYRYTAA
SYL_MYCA1       ---------------MTESPTTSPAT---------------GSGAAAPDSDAPPYRYTAA
SYL_MYCLE       ---------------MTELPTTVPGY---------------NSAVAQTDSDAMRYRYTAE
SYL_MYCTA       ---------------MTESPTAGPGG---------------VPRADDADSDVPRYRYTAE
SYL_MYCBO       ---------------MTESPTAGPGG---------------VPRADDADSDVPRYRYTAE
SYL_MYCTU       ---------------MTESPTAGPGG---------------VPRADDADSDVPRYRYTAE
SYL_MYCBP       ---------------MTESPTAGPGG---------------VPRADDADSDVPRYRYTAE
SYL_MYCUA       ---------------MTESPTTTPGSTSGAPSGV-------PSGVNDAESDAPRHRYTAE
SYL_MYCSS       ---------------MTETPTAQPD--------------------RAADADTPQHRYTAE
SYL_MYCSK       ---------------MTETPTAQPD--------------------RAADADTPQHRYTAE
SYL_MYCSJ       ---------------MTETPTAQPD--------------------RAADADTPQHRYTAE
SYL_MYCS2       ---------------MTEPATTPT----------------------TPDEQIPRHRYNAD
SYL_MYCVP       ---------------MTETPTGTQSS------------------RETAADDTPRHRYTAG
SYL_MYCGI       ---------------MTETPIAPL-------------------------DDTPRFRYTAV
SYL_NOCFA       ------------------MQDTRATE-----------------------SDVPEHRYNAA
SYL_RHOJR       ---------------MTEHVQPANPS-----------------------DATPQHRYTAE
SYL_SACEN       ---------------MSGQAEGSTNT-----------------------EEVPRFRYTAQ
SYL_CORGB       ---------------MTNPSEGTTP---------------------------LAFRYTPE
SYL_CORGL       ---------------MTNPSEGTTP---------------------------LAFRYTPE
SYL_COREF       ---------------MTNPSEGTSSS-----------------------AQSLAYRYTPE
SYL_CORDI       -------------MTMTNPSGNTPDT-----------------------SAGPAFRYTAE
SYL_CORJK       ---------------MTNGSTEDNS-----------------------------YRYTPG
SYL_STRCO       ---------------MSETNPAATAPVS---------------------ADAAPHRYTAA
SYL_STRAW       ---------------MSETNPAAASEV------------------------AAPHRYTAA
SYL_SALAI       ------------------MTEAAASDI-------------------------PPFRYTAA
SYL_BIFAA       ---------------MSDTEKSAQAQP--------------------NESAEPSFRYNAK
SYL_BIFLO       ---------------MSDNEKSTQTE-------------------------EPNFRYNAA
SYL_FRACC       --MARAMSETAEPGARTGAADTTVAPTGASGGIIPAAAGTAGGAPAGTGSVEPSFRYDAR
SYL_FRAAA       MSQGRRTNELGWHERMSETAEHGTGAANATASPSGAVPPSGATATAGTGD-EPGFRYDAR
                                                                            

SYL_GEOKA       NHREIEQKWQDYWEKNKTFRTPDDDD---KPK---------FYVLDMFPYPSGAGLHVGH
SYL_GEOTN       NHREIEKKWQDYWEQHKTFRTPDESD---KPK---------FYVLDMFPYPSGAGLHVGH
SYL_BACCZ       NHQEIEKKWQGYWEENKTFRTPDETE---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACAH       NHQEIEKKWQGYWEENKTFRTPDETE---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACAN       NHQEIEKKWQGYWEENKTFRTPDETE---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACHK       NHQEIEKKWQGYWEENKTFRTPDETE---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACC1       NHQEIEKKWQGYWEENKTFRTPDETE---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACCR       NHQEIEKKWQGYWEENKTFRTPDETE---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACCN       NHQEIEKKWQAYWEENKTFRTPDETD---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACSU       QHKEIEKKWQTYWLENKTFATLDNNE---KQK---------FYALDMFPYPSGAGLHVGH
SYL_BACVZ       QHEKIEKKWQNYWLDHKTFAVSEEND---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACLD       DHQTIEKKWQDYWLKNKTFATREDKS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACP2       QHREIEKKWQDYWLTHKTFATSDSED---KPK---------FYALDMFPYPSGAGLHVGH
SYL_BACHD       SHREIESKWQKYWEENKTFKTEEDET---REK---------FYALDMFPYPSGAGLHVGH
SYL_BACSK       SHQEIEKKWQAFWEENKTFKTDEQAE---GPH---------FYALDMFPYPSGAGLHVGH
SYL_OCEIH       QHRQIEKKWQDYWEDNKTFKTDTFSN---KEK---------FYALDMFPYPSGQGLHVGH
SYL_STAES       NHKEIEKKWQNYWEENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAEQ       NHKEIEKKWQNYWEENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAW       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAS       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAN       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAA1       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAM       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAA9       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAA2       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAA3       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAC       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAA8       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAT       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAE       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAB       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAAR       NHNQIEKKWQDYWDENKTFKTNDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAHJ       NHKEIEKKWQNYWADNKTFKTSDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_STAS1       SHNEIEKKWQDYWEANKTFKTSDNLG---QKK---------FYALDMFPYPSGAGLHVGH
SYL_LISMF       NHKKMEPKWQQYWSEHNTFKTTEDKN---KDN---------FYALDMFPYPSGAGLHVGH
SYL_LISMO       NHKKMEPKWQQYWSEHNTFKTTEDKN---KEN---------FYALDMFPYPSGAGLHVGH
SYL_LISIN       NHKKMEPKWQQYWSEHNTFKTTEDKD---KEN---------FYALDMFPYPSGAGLHVGH
SYL_LISW6       NHKKMEPKWQQYWSEHNTFKTTEDKD---KEN---------FYALDMFPYPSGAGLHVGH
SYL_ENTFA       NHKEIEKKWQKYWAKNNCFNTLDDPN---KEK---------FYALDMFPYPSGQGLHVGH
SYL_STRTD       NHKEIEPKWQKYWADHHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRT2       NHKEIEPKWQKYWADHHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRT1       NHKEIEPKWQKYWADHHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRP2       NHKEIEPKWQGYWAEHHTFKTGTDAS---KPK---------FYALDMFPYPSGVGLHVGH
SYL_STRR6       NHKEIEPKWQGYWAEHHTFKTGTDAS---KPK---------FYALDMFPYPSGVGLHVGH
SYL_STRPN       NHKEIEPKWQGYWAEHHTFKTGTDTS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRSV       NHKEIEPKWQKYWAEHHTFKTGTDKD---KPN---------FYALDMFPYPSGAGLHVGH
SYL_STRGC       NHREIEPKWQKYWAEHHTFKTGTDKD---KPN---------FYALDMFPYPSGAGLHVGH
SYL_STRS2       NHKEIEPKWQEFWAKNHTFKTGTDAE---KPN---------FYALDMFPYPSGAGLHVGH
SYL_STRSY       NHKEIEPKWQEFWAKNHTFKTGTDAE---KPN---------FYALDMFPYPSGAGLHVGH
SYL_STRPD       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRPG       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRP6       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRPM       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRPF       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRPB       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRPC       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRP3       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRP1       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRP8       DHTAIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRA3       NHKEIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRA5       NHKEIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRA1       NHKEIEPKWQAFWADNHTFKTGTDAS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_STRMU       NHKAIENKWQKFWEDNHTFKTGTASS---KPK---------FYALDMFPYPSGAGLHVGH
SYL_LACLM       NHQKIEAKWQKYWADNKTFRTGTDKN---KPK---------FYALDMFPYPSGAGLHVGH
SYL_LACLA       NHQEIEAKWQKYWADNKTFRTGTDKN---KPK---------FYALDMFPYPSGAGLHVGH
SYL_LACLS       NHQEIEAKWQKFWADNQTFRTGTDKT---KPK---------FYALDMFPYPSGAGLHVGH
SYL_LACSS       DHRAVEQKWQAYWQSHKSFKTTEDKD---KKN---------FYALDMFPYPSGQGLHVGH
SYL_LACDA       NHKVVEKKWQKYWLENKTFKTGTDPE---KPK---------YYVLDMFPYPSGKGLHVGH
SYL_LACDB       NHKVVEKKWQKYWLENKTFKTGTDPE---KPK---------YYVLDMFPYPSGKGLHVGH
SYL_LACP3       DHHEIDKKWQRYWAEHNEFNTTTDPK---KPN---------YYALDMFPYPSGQGLHVGH
SYL_LACPL       NHKVIERKWQHYWKENKTFKTLDTTD---KKK---------YYALDMFPYPSGQGLHVGH
SYL_LACBA       KHQIIERKWQHYWRANHTFETSDSQT---KPK---------YYVMDMFPYPSGQGLHVGH
SYL_PEDPA       NHKDIEQKWQQFWSDNETFKTVEDAD---KPK---------YYALDMFPYPSGQGLHVGH
SYL_LACS1       KHIEIEKKWQRYWEEHKTFKTTEDDD---KKN---------YYALDMFPYPSGQGLHVGH
SYL_LACRD       DHKTIEKKWQKFWKKNETFKADLNKD---QKK---------YYALDMFPYPSGQGLHVGH
SYL_LEUMM       DHKSIEAKWQKYWDEHETFR-APDKSE--KEK---------YYVMDMFPYPSGQGLHVGH
SYL_OENOB       DHKAIEKRWQTYWDEHKTFKTAPETSG--KPK---------YYVMNMFPYPSGQGLHVGH
SYL_SALRD       PFHDIETKWQQYWEEHQTFRTPDEVPD-DQEE---------FYVLDMFPYPSGSGLHVGH
SYL1_RHIL3      DPTKIEPKWQAYWAGHHIFRVEIDPA---RPK---------FYALDMFPYPSGAGLHVGH
SYL_RHOBA       NPNEIEPRWQAYWDEHHTFATPEKVG---KKK---------RYVLDMFPYPSGDGLHVGH
SYL_PELLD       DFSHTEKKWQAYWQEHGTFQAEEGQE---KPK---------YYVLDMFPYPSGSGLHVGH
SYL_CHLPM       DFSKTEKKWQARWKQQETFKTGEAPE---KPK---------YYVLDMFPYPSGSGLHVGH
SYL_CHLCH       DFTSIEKKWQTRWQAEATFATGTDHS---KPK---------YYVLDMFPYPSGSGLHVGH
SYL_CHLTE       DFSALEKKWQSRWADEQTFASSADQE---KPK---------YYVLDMFPYPSGSGLHVGH
SYL_CHLPD       DFSTIEKKWQSFWLKNNSFSSGESTD---KPK---------YYVLDMFPYPSGSGLHVGH
SYL_LEPBL       PFQEVESFWQKFWEENKSFQTNIRSS---KPK---------FYCLDMFPYPSGAGLHVGH
SYL_LEPBJ       PFQEVESFWQKFWEENKSFQTNIRSS---KPK---------FYCLDMFPYPSGAGLHVGH
SYL_LEPIC       PFQEVESFWQKFWEEHKSFQTNIRSS---KPK---------FYCLDMFPYPSGAGLHVGH
SYL_LEPIN       PFQEVESFWQKFWEEHKSFQTNIRSS---KPK---------FYCLDMFPYPSGAGLHVGH
SYL_BACTN       NFREIEKKWQQRWVEEKTYQVTEDES---KQK---------FYVLNMFPYPSGAGLHVGH
SYL_BACV8       NFREIEKKWQQRWAENHTYQVTEDES---KKK---------FYVLNMFPYPSGAGLHVGH
SYL_BACFR       NFREIEKKWQKIWVDNHTYQVNEDAS---KQK---------FYVLNMFPYPSGAGLHVGH
SYL_BACFN       NFREIEKKWQKIWVDNHTYQVNEDAS---KQK---------FYVLNMFPYPSGAGLHVGH
SYL_PARD8       NFREIEKKWHDYWIAEKVYKVEKDTN---KPK---------YYVLDMFPYPSGAGLHVGH
SYL_PORGI       NFQEIEKRVQGQWRKDKVYRVAEDTS---KKP---------FYVLDMFPYPSGAGLHVGH
SYL_FLAPJ       NPNEIDAKWQKNWANNQTFAASNTSI---KPK---------YYILDMFPYPSGAGLHVGH
SYL_FLAJ1       NPNEIEAKWQKYWAENQTFAAKNNSE---KPK---------HYVLDMFPYPSGAGLHVGH
SYL_GRAFK       HFNKIEEKWQKYWADNQTFKASNDSE---KPK---------YYVLDMFPYPSGAGLHVGH
SYL_CYTH3       HFGEVENKWQSKWNAEKTFKALENSS---KPK---------YFVLDMFPYPSGSGLHVGH
SYL_BDEBA       NFTEYEAKWQKKWADAKAFQAETTSS---KPK---------YYALDMFPYPSASGLHVGH
SYL_SORC5       DHAAVEPRWQRAWEEGETFRAVRSADP-ARGK---------RYVLDMFPYPSGSGLHVGH
SYL_TREDE       PFSTIEPKWQKYWEENKTFKTVEDKN---YPKDK------RLYILDMFPYPSGDGLHVGH
SYL_TREPA       PFRALEKKWQAYWRDKRVFCVSEDER---FPPER------RAYVLDMFPYPSAQGLHVGH
SYL_BORAP       EFIKIEKKWQEFWDNNKTYKVIEDPN---IPKEK------RLYILDMFPYPSANGLHVGH
SYL_BORBP       EFIKIEKKWQEFWDNNKTYKVKEDPN---IPKEK------RLYILDMFPYPSANGLHVGH
SYL_BORBU       EFIKIEKKWQEFWDNNKTYKVEEDPS---IPKEK------RLYILDMFPYPSANGLHVGH
SYL_CHLTR       DPGLIEEKWQKFWENEQVFKAEEDET---KTK---------YYVLDMFPYPSGAGLHVGH
SYL_CHLTA       DPGLIEEKWQKFWKNEQVFKAEEDET---KTK---------YYVLDMFPYPSGAGLHVGH
SYL_CHLMU       DPSLIEEKWQKFWKEEQTFRAEEDET---KTK---------YYVLDMFPYPSGAGLHVGH
SYL_CHLFF       DPSLIEKKWQEFWKEHKSFKANEADD---KPK---------YYVLDMFPYPSGAGLHVGH
SYL_CHLCV       DPSLIEKKWQEFWKEHKSFEADEASD---KPK---------YYVLDMFPYPSGAGLHVGH
SYL_CHLAB       DPSLIEKKWQQFWKEHKSFKADETAD---KPK---------YYVLDMFPYPSGAGLHVGH
SYL_CHLPN       DPNLIEKKWQQFWKEHRSFQANEDED---KVK---------YYVLDMFPYPSGAGLHVGH
SYL_PARUW       DHQQIEAKWQKFWQDNQTYRSDDNFQ---KPK---------YYVLDMFPYPSGAGLHVGH
SYL_ALKOO       NPKEIESKWQNIWEERGVFHASNDKD---KEK---------FYALIEFPYPSGQGLHVGH
SYL_UREP2       NHNKIEKKWQKYWLDNKTFKFVDNPNNP--KK---------FYVLDMFPYPSGKGLHVGH
SYL_UREPA       NHNKIEKKWQKYWLDNKTFKFVDNPNNP--KK---------FYVLDMFPYPSGKGLHVGH
SYL_MYCPU       NHKEIEKKWQKIWDQSKAFKTGNKSD----KK---------YYVLDMFPYPSGSGLHVGH
SYL_MYCPE       NHNLVEKKWRKIWKDSNLHTFKDNLKK---PK---------FYALDMFPYPSGAGLHMGH
SYL_MYCGA       NHNLIEKKWAKIWNDQKIYSFQIDKNK---PK---------YYILDMFPYPSGKGLHVGH
SYL_MYCGE       NHNLIEEKWLKKWKNKDVNRFESDSNK---KK---------YYVLDMFPYPSAAGLHLGH
SYL_MYCPN       NHNLLEEKWLQLWKTKQVNRFFDDKTK---PK---------YYILDMFPYPSAAGLHLGH
SYL_MYCCT       SHKAIEKKWQKYWKENNVYKTTDS-NH---KK---------AYVLDMFPYPSGAGLHVGH
SYL_MYCMS       SHKAIEKKWQKYWKENNIYKTTNN-SE---KK---------AYILDMFPYPSGAGLHVGH
SYL_MESFL       SHKAIEKKWKKYWEENNTNKTTNT-SD---KK---------SYVLDMFPYPSGAGIHVGH
SYL_ACHLI       EHRKIEEKWQKHWLDNKLFKTKNDRFH---QK---------YYVLDMFPYPSASGLHVGH
SYL_PSEA6       EPQKIEQEVQALWETNQTFKATEQED------KE------KFYCLSMFPYPSG-RLHMGH
SYL_COLP3       NPQAIEATVQKFWTDNNTFQAIENPD------KE------KFYCLAMFPYPSG-RLHMGH
SYL_IDILO       NPSKIESAMQKRWQEQDVFTAKEQPG------KD------KFYCLSMFPYPSG-KLHMGH
SYL_PSEHT       NPQKIESKIQRYWEENKVFKVTEDES------KE------KYYCLSMFPYPSG-RLHMGH
SYL_PSYIN       NPKEIEKKFQTNWDENQSFKATEDPS------KE------KYYCLSMFPYPSG-KLHMGH
SYL_SALCH       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SALTI       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SALTY       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SALPB       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SALPA       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_CITK8       RPEEIESKVQQHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SALAR       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SHIFL       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SHIF8       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SHIBS       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECOL6       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECOL5       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECO57       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SHISS       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECOLI       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECOLC       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SHIDS       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECOHS       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECOUT       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECOK1       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ECO24       RPEEIESKVQLHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_KLEP7       RPEEIESKVQLHWDENRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_CROS8       RPEEIESKVQLHWEEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_ENT38       RPEEIETKVQQHWDEKRTFEVTEDES------KE------KYYCLSMLPYPSG-RLHMGH
SYL_YERPA       RPEDIETQVQLHWQEKQTFKVTEDAS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_YERP3       RPEDIETQVQLHWQEKQTFKVTEDAS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_YERPE       RPEDIETQVQLHWQEKQTFKVTEDAS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_YERPN       RPEDIETQVQLHWQEKQTFKVTEDAS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_YERPS       RPEDIETQVQLHWQEKQTFKVTEDAS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_YERPP       RPEDIETQVQLHWQEKQTFKVTEDAS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_YERE8       RPEDIETQVQLHWQEKQTFKVTEDTS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SERP5       RPEDIESNVQLHWQEKQTFKVTEDAS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_PECAS       RPEEIEADVQLHWQEKQTFKVTEQLG------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SODGM       RPEEIESTVQQHWHENDTFKVTEDPC------KE------KYYCLSMLPYPSG-RLHMGH
SYL_PHOLL       RPEDIEPQVQLHWQEKQTFKVTEDNS------KE------KYYCLSMLPYPSG-RLHMGH
SYL_MANSM       RPDLLEQEVQKYWQNNQTFKAVKDSS------KE------KYYCLSMFPYPSG-RLHMGH
SYL_ACTSZ       RPDLIEAEVQKYWQENKTFKAIKDTN------KE------KYYCLSMLPYPSG-RLHMGH
SYL_HAES1       RPDLIEADVQKYWAEKKTFKAVKDPS------KE------KYYCLSMFPYPSG-RLHMGH
SYL_HISS2       RPDLIEADVQKYWAEKKTFKAVKDPF------KE------KYYCLSMFPYPSG-RLHMGH
SYL_PASMU       RPDLIEAEVQQYWAENKTFKAIKDTN------KP------KYYCLSMFPYPSG-RLHMGH
SYL_HAEIG       RPDMIEPKVQQYWVENKVFKAIKDES------KE------KYYCLSMFPYPSG-RLHMGH
SYL_HAEIN       RPDMIEPKVQQYWAENKVFKAIKDES------KE------KYYCLSMFPYPSG-RLHMGH
SYL_HAEI8       RPDMIEPKVQQYWAENKVFKAIKDES------KE------KYYCLSMFPYPSG-RLHMGH
SYL_HAEIE       RPDMIEPKVQQYWAENKVFKAIKDES------KE------KYYCLSMFPYPSG-RLHMGH
SYL_ACTP2       NPSAIEPKVQQFWAENKVFKAVKDVT------KE------KYYCLSMLPYPSG-KLHMGH
SYL_HAEDU       NPSAIESKVQHFWEENKVFKAVKDIT------KE------KYYCLSMLPYPSG-RLHMGH
SYL_SHESA       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHESM       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHESR       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEON       NPSEIEALVQKHWHDTKTFEVTEDQN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEB9       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEB5       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEB8       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHESW       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEPC       NPSEIEALVQKHWHDNKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEAM       IHSEIEAEVQKYWADNKTFEVTEDPA------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEHH       TPSEIEAKVQQHWQDTKTFEVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEPA       TPSEIEAKVQQHWQDTKTFEVTEDEN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHELP       LPSEIEAKVQQHWQDTKTFEVTEDES------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHESH       KPSEIEAKVQQHWQDKKTFEVTEDEN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEDO       NPSEIEALVQKHWQEHKTFEVTEDES------KE------KFYCLSMFPYPSG-RLHMGH
SYL_SHEFN       NPSEIEALVQKHWHEHKTFEVTEDES------KE------KFYCLSMFPYPSG-RLHMGH
SYL_VIBPA       NPQDIEQKVQKHWDDNKTFVVSEDPN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_VIBCB       NPQDLEQKVQKHWDDNKTFVVSEDPN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_VIBVU       NPQDIEQKVQQHWDNNKTFVVTEDPT------KE------KFYCLSMFPYPSG-RLHMGH
SYL_VIBVY       NPQDIEQKVQQHWDNNKTFVVTEDPT------KE------KFYCLSMFPYPSG-RLHMGH
SYL_VIBCH       NPQDIEHKVQQHWDNNKTFVVSEDPN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_VIBC3       NPQDIEHKVQQHWDNNKTFVVSEDPN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_ALIF1       NPQDLEQKIQKHWDDNKTFVVTEDAN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_PHOPR       RPQDIEQKVQEHWDNNKTFVVNEDPN------KE------KFYCLSMFPYPSG-RLHMGH
SYL_AERS4       VPQSIEPAVQKHWDAKKTFKAVEKVD------KE------KFYCLSMFPYPSG-RLHMGH
SYL_AERHH       VPQSIEPAVQKHWDAKKTFKAVEKVD------KE------KFYCLSMFPYPSG-RLHMGH
SYL_MARHV       NPREVEQTARTFWETNETFKVKEEPG------KP------KYYCLSMFPYPSG-KLHMGH
SYL_HAHCH       HPKKVEQEAQKFWEETDAFKVDEEPG------KE------KFYCLSMFPYPSG-KLHMGH
SYL_SACD2       QPSEIEAQAQKYWEENKSFNVTEDPT------KE------KFYCLAMFPYPSG-RLHMGH
SYL_MARMS       NPQQIEQAAQSFWDENKVFKAIADSS------KE------KFYCLSMFPYPSG-RLHMGH
SYL_ALCBS       RPDQIEAQAQQYWDDNQSFKVTEDAS------KE------KFYCLSMFPYPSG-RLHMGH
SYL_PSEAB       QPLEIETQAQNYWKEHQSFLVRELPD------KE------KFYCLSMFPYPSG-KLHMGH
SYL_PSEAE       QPLEIETQAQNYWKEHQSFLVRELPD------KE------KFYCLSMFPYPSG-KLHMGH
SYL_PSEA7       QPLEIETQAQNYWKEHQSFLVRELPD------KE------KFYCLSMFPYPSG-KLHMGH
SYL_PSEU5       QPREIEAAAQSHWDSQKSFEVSEQPG------KD------TFYCLSMFPYPSG-KLHMGH
SYL_PSEMY       SPREIEAAAQSHWDAQKSFVVSEQPG------KD------TFYCLSMFPYPSG-KLHMGH
SYL_PSEP1       TPRDIEAAAQKFWDEQQSFAVTEQPG------KD------TYYCLSMFPYPSG-KLHMGH
SYL_PSEPK       TPRDIEAAAQKFWDEQQSFAVTEQPG------KD------TYYCLSMFPYPSG-KLHMGH
SYL_PSEPG       TPRDIEAAAQKFWDEQQSFAVTEQPG------KD------TYYCLSMFPYPSG-KLHMGH
SYL_PSEE4       TPRDVEAAAQNAWDEQQSFAVTEQPG------KE------TYYCLSMFPYPSG-KLHMGH
SYL_PSEU2       QPREIEAAAQTFWDEQKSFEVSEQPG------KD------TFYCLSMFPYPSG-KLHMGH
SYL_PSE14       QPREIEAAAQTFWDEQKSFEVSEQPG------KD------TFYCLSMFPYPSG-KLHMGH
SYL_PSESM       QPREIEAAAQTFWDEQKSFEVSEQPG------KE------TFYCLSMFPYPSG-KLHMGH
SYL_NEIMB       RPAAIEPAAQKKWDDARIFNVSEDAS------KP------KYYCLSMFPYPSG-KLHMGH
SYL_NEIMF       QPAAIEPAAQKKWDDARIFNVSEDAS------KP------KYYCLSMFPYPSG-KLHMGH
SYL_NEIG1       QPAAIEPAAQKKWDDARISNVSEDAS------KP------KYYCLSMFPYPSG-KLHMGH
SYL_NEIM0       RPAAIEPAAQKKWDDARIFNVSEDAS------KP------KYYCLSMFPYPSG-KLHMGH
SYL_NEIMA       QPAAIEPAAQKKWDDARIFNVSEDAS------KP------KYYCLSMFPYPSG-KLHMGH
SYL_CHRVO       SPRAVEAAAQQKWQKTAAFKAVEDAS------RP------KYYALSMFPYPSG-KLHMGH
SYL_THIDA       LPSEIERAGQARWTADQTYRAADASD------RP------KYYCLSMFPYPSG-KLHMGH
SYL_DECAR       TPADIERAAQQHWDKTGAARAVEDAT------KP------KYYCLSMFPYPSG-KLHMGH
SYL_AZOSB       QPAAVETAAQQHWESTAAFRVTEDAT------RP------KYYCLSMFPYPSG-KLHMGH
SYL_CUPMC       LPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKS------KFYACSMLPYPSG-KLHMGH
SYL_CUPPJ       LPSAVEQAAQQHWQAIDAYRVPEHATGPDGKEKP------KFYACSMLPYPSG-KLHMGH
SYL_RALSO       SPSEVEQQAQQHWQAQDAYRVTEHARAADGSDKP------KFYACSMLPYPSG-KLHMGH
SYL_JANMA       SPAEVEKSAHDHWQAIDAYKAVENAKDKNGKDKK------KFYACSMLPYPSG-KLHMGH
SYL_HERAR       SPADVEKSAHDHWQATDAYKAVEHAKDKNGKDKK------KFYACSMLPYPSG-KLHMGH
SYL_BURCH       VPADVEAAAQGDWRAADAYKTKEDS------QKP------KFYCVSMLPYPSG-KLHMGH
SYL_BURCA       VPADVEAAAQGDWRAADAYKTKEDS------QKP------KFYCVSMLPYPSG-KLHMGH
SYL_BURL3       VPADVEAAAQGDWRAADAYKTQEDS------QKP------KFYCVSMLPYPSG-KLHMGH
SYL_BURCM       VPADVEAAAQGDWRAADAYKTREDS------QKP------KFYCVSMLPYPSG-KLHMGH
SYL_BURVG       VPADVEAAAQGDWRAADAYKTKEDS------QKP------KFYCVSMLPYPSG-KLHMGH
SYL_BURP0       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURPS       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURP6       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURP1       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURM7       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURM9       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURMA       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURMS       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_BURTA       VPADVEAAAQSDWRAADAYRSKEDA------NRK------KFYCVSMLPYPSG-KLHMGH
SYL_PARXL       VPSDVESAAQGQWRAIDAYKTTEVT------DKP------KFYCVSMLPYPSG-KLHMGH
SYL_POLAQ       DHRGIEAAAQADWERTQVYRVTENAVNASGKKKP------KYYACSMLPYPSG-KLHMGH
SYL_BORBR       QPNSVEAAAQQTWQARDAYLVHEHAKNPDGSEKP------KFYACSMLPYPSG-KLHMGH
SYL_BORPA       QPNSVEAAAQQTWQARDAYLVHEHAKNPDGSEKP------KFYACSMLPYPSG-KLHMGH
SYL_BORPE       QPNSVEAAAQQTWQARDAYLVHEHAKNPDGSEKP------KFYACSMLPYPSG-KLHMGH
SYL_BORPD       SPTAVEAAAQQDWQARDAYRVTEHARNADGTEKP------KFYACSMLPYPSG-KLHMGH
SYL_BORA1       QPNLVEAAAQQDWQARDAYLVHESAKNADGSEKP------KFYACSMLPYPSG-KLHMGH
SYL_METPP       EPGAIEAAAHAHWTARDAHRVVEDTS------RP------KFYACSMLPYPSG-KLHMGH
SYL_ACISJ       NHTEVERAAHAHWNANDAYRVTEDQA------KP------KFYACSMLPYPSG-KLHMGH
SYL_ACIAC       TPAEVERAAHSHWTARDAYRVTEDAG------KK------KFYACSMLPYPSG-KLHMGH
SYL_RHOFT       TPLDVEQAAQSHWTAMDAYRVTEDSS------KK------KFYACSMLPYPSG-KLHMGH
SYL_VEREI       SPQDIERAAQDDWRARDAYRVTQDAG------KK------KFYACSMLPYPSG-KLHMGH
SYL_POLNA       NHLDVERSAQTHWNAADAYRVTEDAS------RK------KYYACSMLPYPSG-KLHMGH
SYL_POLSJ       NHLDVERSAQAQWIAADAYRVTEDTSGK--KPRG------KYYACSMLPYPSG-KLHMGH
SYL_METCA       NPKTVEETAQRIWEESGVFRAREDSG------RE------KFYCLSMFPYPSG-RLHMGH
SYL_DICNV       QPAQIEAAIQQQWANEERFKAVVNPQ------KE------KFYCLSMFPYPSG-KLHMGH
SYL_PSYCK       QPQLIEAQQQAKWATDKRFEVSNEPS-----DKP------SRYMLSMFPYPSG-KLHMGH
SYL_PSYA2       QPQLIEAAQQAKWATDKRFEVSNEPS-----DKP------SRYMLSMFPYPSG-KLHMGH
SYL_PSYWF       HPQAIEAEQQAKWAADKRFEVSNDISK----DAN------TRYMLSMFPYPSG-KLHMGH
SYL_ACIAD       QANAIESQIQNDWENRKAFKVADTVE------GK------HRYILSMFPYPSG-KLHMGH
SYL_NITEU       HPQEIERQARQSWQETNIFNVTEIPD------RP------KYYCLSMFPYPSG-KLHMGH
SYL_NITEC       HPQEIEQQARQSWQETGIFNTTEIPD------KP------KYYCLSMFPYPSG-KLHMGH
SYL_NITMU       HPQEIESEAQQYWQQTAAFKAVEAPE------KR------KYYCLSMFPYPSG-KLHMGH
SYL_METFK       PFRDIEQQAQQYWESNATFTATEVSD------KP------KYYCLSMFPYPSG-KLHMGH
SYL_HYDCU       QPQSIEAAIQHVWDEQQVFVAKEDDS------KE------KFYCLSMFPYPSG-KLHMGH
SYL_XYLFA       DPQRIESTAQHYWDSTHAFEVNEHSN------KP------KYYCLSMLPYPSG-ALHMGH
SYL_XYLFT       DPQRIESTAQHYWDSTHAFEVNEHSN------KP------KYYCLSMLPYPSG-ALHMGH
SYL_XANC8       DPQQVETSAQQFWDATRAFQVDENSD------KP------KFYCLSMLPYPSG-ALHMGH
SYL_XANCP       DPQQVETSAQQFWDATRAFQVDENSD------KP------KFYCLSMLPYPSG-ALHMGH
SYL_XANCB       DPQQVETSAQQFWDATRAFQVDENSD------KP------KFYCLSMLPYPSG-ALHMGH
SYL_XANC5       DPQQVETSAQQFWDATRAFQVDENSE------KP------KFYCLSMLPYPSG-ALHMGH
SYL_XANAC       DPQQVETSAQQFWDATRAFQVDENSE------KP------KFYCLSMLPYPSG-ALHMGH
SYL_XANOR       DPHQVETSAQQFWDATRAFQVDENSE------KP------KFYCLSMLPYPSG-ALHMGH
SYL_XANOM       DPHQVETSAQQFWDATRAFQVDESSE------KP------KFYCLSMLPYPSG-ALHMGH
SYL_NITOC       QAIQIEAEAQAYWEQHQSFRASEDPS------KE------KFYCLSMFPYPSG-RLHMGH
SYL_ALKEH       QPEQIEAQAQRYWDEQQSFAAREERE------GE------KFYCLSMFPYPSG-RLHMGH
SYL_HALHL       QPKEIEAEAQAYWEQQQTFQAREDSA------RP------KYYCLSMFPYPSG-RLHMGH
SYL_CHRSD       TPHAIESAAQTFWDKNQCFKAVEDAT------RE------KFYCLSMFPYPSG-KLHMGH
SYL_BUCAI       SPKKIENYVQEFWKKNKTFEVKEDPK------KE------KYYCLPMLPYPSG-KLHMGH
SYL_BUCAP       CPKNIEPYVQQYWKDNKVFHVYEDDK------KE------KYYCLPMLPYPSG-KLHMGH
SYL_BUCCC       NPKKIEKYVQKYWVKKKIFFTKIDKE------KK------KFYCLPMLPYPSG-KLHMGH
SYL_BUCBP       CPKTIEPYVQSIWKKKNTFKVTENSN------KE------KFYCLAMIPYPSG-KLHMGH
SYL_WIGBR       SCKEIERFVQKHWEINDTFKVLEDSK------KD------KYYCVSMMPYPSG-KLHMGH
SYL_BLOPB       SPSDIESVVQKHWYKNKTFAVIEDSN------KE------KYYCLSMIPYPSG-NLHMGH
SYL_BLOFL       FPHQIERIVQQHWNDNQTFSVTEDKN------KQ------KFYCLSMLPYPSG-NLHMGH
SYL_BAUCH       DPKNIESTIQQYWHENNTFTVTEDFS------KE------KYYCLSMLPYPSG-NLHMGH
SYL_COXBU       QPTLIEQLAQEYWEENETFEVKEDLS------RE------KFYCLSMLPYPSG-DLHMGH
SYL_COXBR       QPTLIEQLAQEYWEENETFEVKEDLS------RE------KFYCLSMLPYPSG-DLHMGH
SYL_COXBN       QPTLIEQLAQEYWEENETFEVKEDLS------RE------KFYCLSMLPYPSG-DLHMGH
SYL_LEGPH       NPQEVEEQAQQYWHKKQSFNVTEDLN------KE------KFYCLSMFPYPSG-TLHMGH
SYL_LEGPC       NPQEVEEQAQQYWHKKQSFNVTEDLN------KE------KFYCLSMFPYPSG-TLHMGH
SYL_LEGPA       NPQEVEEQAQQYWHKKQSFNVTEDLN------KE------KFYCLSMFPYPSG-TLHMGH
SYL_LEGPL       NPQEVEEQAQQYWHKKQSFNVTEDLN------KE------KFYCLSMFPYPSG-TLHMGH
SYL_FRATT       NFSDIEKSTQEYWRKNDTFKTIEDNT------KE------KFYCLSMLPYPSG-TLHMGH
SYL_FRAT1       NFSDIEKSTQEYWRKNDTFKTIEDNT------KE------KFYCLSMLPYPSG-TLHMGH
SYL_FRATW       NFSDIEKSTQEYWRKNDTFKTIEDNT------KE------KFYCLSMLPYPSG-TLHMGH
SYL_FRATF       NFSDIEKSTQEYWRKNDTFKTIEDNT------KE------KFYCLSMLPYPSG-TLHMGH
SYL_FRATH       NFSDIEKSTQEYWRKNDTFKTIEDNT------KE------KFYCLSMLPYPSG-TLHMGH
SYL_FRATO       NFSDIEKSTQEYWRKNDTFKTIEDNT------KE------KFYCLSMLPYPSG-TLHMGH
SYL_FRATN       NFSDIEKSTQDYWRKNDTFKTIEDNT------KE------KFYCLSMLPYPSG-TLHMGH
SYL_FRAP2       NFTQIEQQAQEYWRENNSFKAVEDKN------KE------KFYCLSMLPYPSG-TLHMGH
SYL_RUTMC       NAQKIEAQAQKYWQENKSFEVSEDTS------KE------KYYCLSMFPYPSG-SLHMGH
SYL_VESOH       DVQKIEKQAQKYWKEKKSFEVIEDYS------KE------KYYCLSMFPYPSG-RLHMGH
SYL_RICRS       -MNQIEQKWQYIWQEEKAFEVS---NA---SSKP------KYYVLEMLPYPSG-KIHVGH
SYL_RICRO       -MNQIEQKWQYIWQEEKAFEVS---NA---SSKP------KYYVLEMLPYPSG-KIHVGH
SYL_RICCN       -MNQIEQKWQYIWQEEKAFEVS---NA---SSKP------KYYVLEMLPYPSG-KIHVGH
SYL_RICM5       -MNQIEQKWQHIWQEEKAFEVS---NA---SSKP------KYYVLEMLPYPSG-KIHVGH
SYL_RICFE       -MNQIEQKWQQIWYDEKAFEVS---NE---SSKP------KYYVLEMLPYPSG-KIHVGH
SYL_RICAH       -MNQIEQKWQQIWHDEKAFEVS---NE---SSKP------KYYVLAMLPYPSG-KIHLGH
SYL_RICCK       -MNQIEQKWQQIWDDEKAFEVS---NE---CNKP------KYYVLEMLPYPSG-KIHVGH
SYL_RICBR       --MNIEQKWQQIWQEEKAFEVP---NE---SSKP------KYYVLEMLPYPSG-KIHVGH
SYL_RICPR       -MHKIEKKWQKIWQEEKAFQVS---NE---SSKP------KYYVLEMLPYPSG-KIHIGH
SYL_RICTY       -MHKIEQKWQKIWKEEKAFQVS---ND---SSKP------KYYVLEMLPYPSG-KIHIGH
SYL_ORITB       NLVKIEKKWQKIWEQNEVFKVK---EI---LNKI------KRYILPMFPYPSG-KAHVGH
SYL_WOLPM       -MKYDFKSVEKFYQDKWDFSVS---KS---GKQE------KCYVLEMFPYPSG-KIHMGH
SYL_WOLTR       -MKYDFKNVEKFYQDRWDFSIG---KN---NEQG------KCYVLEMFPYPSG-KIHMGH
SYL_EHRRW       -MHYNFKEVERDVQEKWDFTV-----N---VKDV------QCYVLEMFPYPSG-NIHMGH
SYL_EHRRG       -MHYDFKEVERDVQEKWDFTV-----N---VKDV------QCYVLEMFPYPSG-NIHMGH
SYL_EHRCJ       -MHYDFKKVEQDIQKKWNFYT-----D---VKKA------QCYVLEMFPYPSG-NIHMGH
SYL_EHRCR       -MHYDFKKVEQDIQGKWNFYT-----D---AKQA------QCYVLEMFPYPSG-NIHMGH
SYL_ANAMM       GMGYNFKLVEQEIQKRWDFKIA----G---NDGI------NCYVLGMFPYPSG-NIHMGH
SYL_NEOSM       MSNYDFKKIEQFSQSLWDFSSC----D---FQRK------KYYVLSMFPYPSG-KLHIGH
SYL2_RHIL3      NPRDAEPRWQQKWNEDKVFET--DNA----DPRE------KYYVLEMFPYPSG-RIHMGH
SYL_RHIEC       NPRDAEPRWQQKWNEDKVFET--DNS----DPRE------KYYVLEMFPYPSG-RIHMGH
SYL_RHIME       NPRDAEPRWQHQWEAGKVFET--KND----DPRD------KYYVLEMFPYPSG-RIHMGH
SYL_SINMW       NPRDAEPRWQQQWEAGKIFET--KND----DPRE------KYYVLEMFPYPSG-RIHMGH
SYL_AGRFC       NPRDAEPRWQQKWNEDKVFVT--DNS----DPRE------KYYVLEMFPYPSG-RIHMGH
SYL_BRUAB       NPRVAEAHWQKVWEENRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_BRUA2       NPRVAEAHWQKVWEENRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_BRUSI       NPRVAEAHWQKVWEENRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_BRUO2       NPRVAEAHWQKVWEENRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_BRUME       NPRVAEAHWQKVWEENRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_BRUSU       NPRVAEAHWQKVWEENRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_BRUC2       NPRVAEAHWQKVWEENRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_OCHA4       NPRVAEAHWQKVWEEDRTFET--DNS----DSRE------KYYVLEMFPYPSG-RIHMGH
SYL_CHESB       NPRTSEPRWQKAWEEARLFET--KND----DGRP------TYYVLEMFPYPSG-RIHIGH
SYL_RHILO       NPRASEPKWQKAWAEKKLFEA--RND----DPKP------KYYVLEMFPYPSG-RIHIGH
SYL_BART1       NPRAREKKWQEIWDEKKIFQT--VQG----DGRE------KYYVLEMFPYPSG-RIHMGH
SYL_BARHE       NPRACERKWQAIWDEKKTFQT--VQE----DRRE------KYYVLEMFPYPSG-RIHMGH
SYL_BARQU       NPRAREQKWQAIWDEKKIFQI--TEE----NCRE------KYYVLEMFPYPSG-RIHMGH
SYL_BARBK       NPRAQEQKWQAIWDEKKIFQT--SHE----DEGE------KYYVLEMFPYPSG-RIHMGH
SYL_RHOP2       NARESEPKWQAKWDEAKIFAT--RND----DPRP------KYYVLEMFPYPSG-RIHMGH
SYL_RHOPS       NARESEPKWQAKWDEAKIFAT--RND----DPRP------KYYVLEMFPYPSG-RIHMGH
SYL_RHOPA       NARESEPKWQAKWDEAKIFAT--RND----DLRK------KYYVLEMFPYPSG-RIHMGH
SYL_RHOP5       NARESEPKWQRRWDDDKIFAT--QND----DPRP------KYYVLEMFPYPSG-RIHMGH
SYL_NITHX       NARDAEPRWQAAWDQQAIFAT--KND----DPRE------KYYVLEMFPYPSG-RIHIGH
SYL_NITWN       NARDAEPRWQAEWDRQAIFAT--KND----DPRE------KYYVLEMFPYPSG-RIHIGH
SYL_BRASB       NAREAEPRWQRQWDEKAIFAT--KND----DPRP------KYYVLEMFPYPSG-RIHIGH
SYL_BRASO       NAREAEPRWQRQWDEKAIFAT--KND----DPRP------KYYVLEMFPYPSG-RIHIGH
SYL_BRADU       NARDSEPRWQAAWDEKAIFVS--KND----DSRP------KYYVLEMFPYPSG-RIHIGH
SYL_RHOPB       NARESEPRWQRQWDDNAIFAT--QND----DPRP------KYYVLEMFPYPSG-RIHMGH
SYL_AZOC5       NARDAEPRWQAIWNERGIFRT--RND----DPRP------KFFVMEMFPYPSG-RIHIGH
SYL_PARL1       NARAAEPKWQKIWEERGDFLM--RDDA---DGKP------KYYVLEMFPYPSG-RIHMGH
SYL_CAUVC       NPKDTEPKWREAWAKADVFKTGEINDG-----RP------KYYVLEMFPYPSG-RIHMGH
SYL_CAUSK       NPKDTEPKWRAAWASANTFLTPITPDA-----RP------KYYVLEMFPYPSG-RIHMGH
SYL_MARMM       NPREAEPKWQSAWDACDAFKAIGPSAS---NNKP------KYYVLEMFPYPSG-RIHVGH
SYL_HYPNA       DPQSAEPRWRDAWEKADIFRTKAPKDA---PGAP------KAFVLEMFPYPSG-RLHMGH
SYL_RUEST       EASDIEARWQKAWEEAAIFQA---KED---HSKP------KYYVLEMFPYPSG-KLHMGH
SYL_RUEPO       SATEIEAKWQEAWDKAGIFRA---ART---ADKP------KYYVLEMFPYPSG-RIHIGH
SYL_ROSDO       TPAEIEARWQKAWRENEVFKA---IRS---ADKP------KYYVLEMFPYPSG-RIHMGH
SYL_JANSC       DPSMIEPKWQKAWAEAGTFTA---SME---GNKP------KYYVLEMFPYPSG-RIHIGH
SYL_DINSH       DPAQIEPKWRAAWDLAGTFTA---TPD---PAKQ------KYYVLEMFPYPSG-RIHMGH
SYL_RHOS1       DPAATESRWQAAWDAAGVFTA---RHD---PARP------KYYVLEMFPYPSG-RIHMGH
SYL_RHOS4       DPAATESRWQAAWDAAGVFTA---RHD---PARP------KYYVLEMFPYPSG-RIHMGH
SYL_RHOS5       DPAATESRWQAAWDEAGVFTA---RHD---PSRP------KYYVLEMFPYPSG-RIHMGH
SYL_PARDP       DPAISEPRWQEAWEQADTFRA---VRD----ERP------KYYVLEMFPYPSG-RIHMGH
SYL_ZYMMO       NPHVVDGRWQKKWEESGCFHAK-DNSD-----RP------HSYILEMFPYPSG-RIHMGH
SYL_SPHWW       NHLKADAHWQGVWESQGTFQAR-DDSP-----KP------KSYVLEMFPYPSG-RIHMGH
SYL_NOVAD       DPATADTRWQRVWDEKQSFRAD-DSST-----KP------RSYVLEMFPYPSG-RIHIGH
SYL_SPHAL       GALAADARWQKAWEAANSFATT-DSGQ-----KP------KAYILEMFPYPSG-RIHMGH
SYL_GRABC       DFASAERRWQLAWTERACFTVP-DVPD---PGAR------TYYVLEMFPYPSG-QIHMGH
SYL_GLUOX       DFQDREPFWQNEWKRRNTFAVP-DVPP---ADRP------KYYVLEMFPYPSG-QLHVGH
SYL_ACICJ       DFTAAEARWQAAWEARNCFATA-DAPQ---GGRR------KCYVLEMFPYPSG-KIHMGH
SYL_MAGSA       NVKETEARWQQAWEAKRCFEAE---IA---PGKP------KYYVLEMFPYPSG-RIHMGH
SYL_RHORT       NVKETEAKWQTAWAEGGCFTAR---ED---RTRP------KYYVLEMFPYPSG-RIHMGH
SYL_MAGMM       NPQAIESKWQKIWHQQKTFATP--ENL---GDKE------TFYLLVMFPYPSG-RIHMGH
SYL_CAMJ8       EASLIEKKWQKIWDENEYFEPK------DDLNLP------KKYILSMFPYPSG-RIHMGH
SYL_CAMJJ       EASLIEKKWQKIWDENEYFEPK------DDLNLP------KKYILSMFPYPSG-RIHMGH
SYL_CAMJR       EASLIEKKWQKIWDENEYFEPK------DDLNLP------KKYILSMFPYPSG-RIHMGH
SYL_CAMJE       EASLIEKKWQKIWDENEYFEPK------DDLNLP------KKYILSMFPYPSG-RIHMGH
SYL_CAMJD       EASLIEKKWQKIWDENEYFEPK------DDLNLP------KKYILSMFPYPSG-RIHMGH
SYL_CAMC1       EPLKIEKKWQEIWDKNEEFEPK------DDLSLP------KKYILSMFPYPSG-RIHMGH
SYL_CAMC5       EAAKIEKKWQEIWHKNGEFEPK------DDYTLP------KKYILSMFPYPSG-RIHMGH
SYL_CAMFF       NAKNIEYKWQQIWKKNGYSEPK------DDYSLP------KKYILSMFPYPSG-RLHMGH
SYL_CAMHC       DSKKLELKWQEIWDKEGIFEPK------KDYNLQ------KKYILSMFPYPSG-RIHMGH
SYL_ARCB4       ISKDIEKKWQNFWSENQSFEPS------SSKTKE------KKYILSMFPYPSG-RIHMGH
SYL_NITSB       DPKAIEQKWQNEWKEKNAFEPQ------ENYSKE------KMYVLSMFPYPSG-RIHMGH
SYL_WOLSU       NPKAIEKKWQEHWKNKRTHEPL------SDTSLP------KKYILSMFPYPSG-RIHMGH
SYL_HELHP       NPKDIESKWQQFWTEHKSFEPFDIDIA-TSDSMK------KKYILSMFPYPSG-AIHMGH
SYL_HELPY       DFINIEKKWQEFWWKNKSFEPK------DDFNLP------KKYILSMLPYPSG-EIHMGH
SYL_HELPH       DFINIEKKWQEFWWKNKSFEPK------DDFNLP------KKYILSMLPYPSG-EIHMGH
SYL_HELPJ       DFINIEKKWQEFWWKNKSFEPK------DDFNLP------KKYILSMLPYPSG-EIHMGH
SYL_HELAH       DFVSIEKKWQEFWHQNESFEPK------DDFNLP------KKYILSMLPYPSG-EIHMGH
SYL_THEMA       RPQEIEKKWQEVWEEKKVFYTPQRSE------KP------KYYALVMFPYPSG-TLHVGH
SYL_THEP1       RPQEIEKKWQEVWEEKKVFYTPQRSE------KP------KYYALVMFPYPSG-TLHVGH
SYL_THEM4       IPGEIEPKWQKVWAESKVFETPQRSD------KK------KFYNLVMFPYPSG-TLHVGH
SYL_FERNB       KPQEIESKWQGVWSEKKVFETPQYSD------KK------KYYALVMFPYPSG-TLHVGH
SYL_PSELT       EPQEIESKWQKFWEKEGLFKTPQHSD------LP------KYYMLVMFPYPSG-TLHVGH
SYL_CALS8       NFREIEKKWQQKWFSQNKYKVTEDSP------KP------KYYVLEMFPYPSG-KLHMGH
SYL_HUNT2       NFVDIEKKWQKKWLEEKAFAVREDES------KK------KYYVLEMFPYPSG-NLHMGH
SYL_DESHY       LFSEIEPKWQKKWVDRKDYQAEEHSD------KP------KFYALAMFPYPSG-NLHMGH
SYL_SYNWW       DFKSIEAKWQAYWENKQLFKVEEDPE------KP------KYYNLEMFPYPSG-HLHMGH
SYL_CARHZ       DFKAIEAKWQKKWEELKLYEVDDFSE------KP------KYYCLEMFPYPSG-KLHMGH
SYL_PELTS       DFKEIEEKWQARWAAQDLYAVPDYSD------RP------KYYCLEMFPYPSG-KLHMGH
SYL_MOOTA       NFKEIEPKWQRRWEASDLYRVTEDPD------KP------KFYCLEMFPYPSG-NLHMGH
SYL_DESRM       DFKEIEKKWQEDWNKENTYQVPDFSE------RP------KYYCLEMFPYPSG-KLHMGH
SYL_SYMTH       DFREAEPRWQRRWDEEGIYKVERDLS------RP------KYYALAMFPYPSG-KLHMGH
SYL_DESVH       DHQSIETRWQKKWEDSGIFQCDTEAD------KP------KYYVLEMFPYPSG-NIHMGH
SYL_DESVV       DHQSIETRWQKKWEDSGIFQCDTEAD------KP------KYYVLEMFPYPSG-NIHMGH
SYL_DESAG       NPQAIEEKWQHIWEEKEMFRSEHGSD------KP------KYYVLEMFPYPSG-NIHMGH
SYL_LAWIP       DPNIIEKKWQRYWEEQHAYACDIDPN------KK------KYYVLEMWPYPSG-NIHMGH
SYL_GEOMG       IPRNVEEKWQKIWEENKTYKVTEDPS------KP------KYYLLEMFPYPSG-RIHMGH
SYL_GEOSL       IPKNVEGKWQEIWEENKTFTVTEDPS------KP------KYYLLEMFPYPSG-RIHMGH
SYL_GEOUR       LPSRVEEKWQKFWEANKSFRATEDKT------RE------KYYLLEMFPYPSG-RIHMGH
SYL_PELPD       NPAAVEQKWQQQWETGASFAVNEQSD------RP------KYYLLEMFPYPSG-RIHMGH
SYL_PELCD       DAGGIEGKWQKRWEQDRTFKAKEKDA------RE------KYYLLEMFPYPSG-RIHMGH
SYL_SYNAS       VPQEIEEKWQRYWEEKNTFKVTEDPS------KK------KYYLLEMFPYPSG-KIHIGH
SYL_SYNFM       APKRIEKKWQEHWEREKLFEVSEIPG------RE------KFYLLEMFPYPSG-RIHMGH
SYL_DESPS       DFKTIESKWQKNWAENKTYSVTEDED------KE------KYYLLEMFPYPSG-RIHMGH
SYL_FUSNN       EFKEIEKKWQERWSKDNIFKTENQVEG-----KE------NYYVLSMLPYPSG-KLHVGH
SYL_TRIV2       NPAILEEKWQKTWVELGLDKTQTQSNKP------------KFYALSMFPYPSG-SLHMGH
SYL_NOSS1       NPATLEEKWQKTWVELGLDKTQTQSNKP------------KFYALSMFPYPSG-SLHMGH
SYL_ACAM1       NPTEIEPKWQASWAKQGLDATPEDTSKP------------KFYALSMFPYPSG-SLHVGH
SYL_TRIEI       NPVSIEQKWQKNWAEQNQDQTPINNNQP------------KFYALSMFPYPSG-NLHMGH
SYL_SYNY3       NAGEIEQKWQQRWAEWGLDKTPIASDLP------------KFYALSMFPYPSG-NLHMGH
SYL_SYNE7       DPQAIETKWQQSWAAAQLDRTPEADDRP------------KFYALSMFPYPSG-NLHMGH
SYL_SYNP6       DPQAIETKWQQSWAAAQLDRTPEADDRP------------KFYALSMFPYPSG-NLHMGH
SYL_THEEB       DPQVIEAKWQQEWAARQLDRTDTDPQKP------------KFYALSMFPYPSG-NLHMGH
SYL_SYNJB       NPQAIESKWQAHWREIGLDRTPELKDGSR-----------KFYALSMFPYPSG-NLHMGH
SYL_SYNJA       NPPAIESKWQAHWRELGLDRTPELTAESR-----------KFYALSMFPYPSG-SLHMGH
SYL_GLOVI       NPHAIEPRRQKQWEEA---PHLAMDGRP------------KFYALSMFPYPSG-ALHMGH
SYL_SYNS3       QPLALEERWQALWKEQRLYETQ-DPKPGQR----------AFYALSMFPYPSG-TLHMGH
SYL_SYNPW       DPIALEQRWQSQWQQDDLYATR-SPEPGQN----------AFYALSMFPYPSG-SLHMGH
SYL_PROMM       DPIELETRWQKEWLRQGLDRTP-VAETNQK----------RFYALSMFPYPSG-KLHMGH
SYL_PROM3       DPIELETRWQKEWLRQGLDRTP-VAETNQK----------RFYALSMFPYPSG-KLHMGH
SYL_SYNSC       DPTALEQRWQESWKADGVDTTE-VGG-EKP----------GFFALSMFPYPSG-SLHMGH
SYL_SYNS9       DPSALEQRWRARWKDQGLDTTE-TES-SKP----------GFFALSMFPYPSG-SLHMGH
SYL_SYNPX       SPADLEQRWQTTWRSEGLDVTP-EPE-DGK----------GFYALSMFPYPSG-TLHMGH
SYL_SYNR3       SPTSLEPKWQQRWQEMGLDQTPEPSAERAE----------NFYALSMFPYPSG-NLHMGH
SYL_PROMT       EPREVEAYWQKEWASDDLYRTNTEVNKEN-----------TFYALSMFPYPSG-SLHMGH
SYL_PROM1       EPREVEAYWQKEWANDDLYRTNTEVNKEN-----------TFYALSMFPYPSG-SLHMGH
SYL_PROMA       DPLSIETRWQQSWKEQGLYKTKEPTKSQK-----------TFYALSMFPYPSG-TLHMGH
SYL_PROM0       NPSEIEKKWQSIWTENNLYKTDELTDNSD-----------KFYALSMFPYPSG-NLHMGH
SYL_PROM9       NPSEIEKKWQSIWTENNLYKTDELTENSD-----------KFYALSMFPYPSG-NLHMGH
SYL_PROMS       NPSEIEKKWQSIWTENNLYKTDELTENSD-----------KFYALSMFPYPSG-NLHMGH
SYL_PROM2       NPSEIEKKWQLIWTENNLYKTDELTENSD-----------KFYALSMFPYPSG-NLHMGH
SYL_PROMP       KPSDIEGKWQKIWEDDNLYNTDEQASNKE-----------KFYALSMFPYPSG-NLHMGH
SYL_PROM5       KPCEIENKWQEIWDKENLYKTDDKSSKKE-----------KFYALSMFPYPSG-NLHMGH
SYL_SOLUE       DHIAIELKWHERWQDAQFYKAEENSA------KP------KFYVLEMLPYPSG-TLHIGH
SYL_DEIRA       NPHAIEQKWQGQWQESGLYKFDENAP------GE------KFYALTMFPYPSG-NLHIGH
SYL_DEIGD       NPHAIEPKWQARWEQEGLYTFHEDPS------KT------KHYALTMFPYPSG-NLHIGH
SYL_RUBXD       DPRAIEERWQRRWAETGLYKTDEDPS------KP------KHYALTMLPYPSG-DLHVGH
SYL_CLOPE       YSTAIDKKWQDKWAESGLYKFDPNKE------GE------KLYVLEMFSYPSGSQLHAGH
SYL_CLOPS       YSTAIDKKWQDKWAESGLYKFDPNKE------VE------KLYVLEMFSYPSGSQLHAGH
SYL_CLOP1       YSTAIDKKWQEKWAESGLYKFDPNKE------GE------KLYVLEMFSYPSGSQLHAGH
SYL_CLOB8       YGTKIDEKWQKFWDENEVYKFNPENS------GK------KLYTLEMFSYPSGAQLHAGH
SYL_CLOB1       YSTKIDEKWQKKWEENSLYKFNNKNL------DK------KLYVLEMFSYPSGSKLHAGH
SYL_CLOBH       YSTKIDEKWQKKWEENSLYKFNNKNL------DK------KLYVLEMFSYPSGSKLHAGH
SYL_CLOBL       YSTKIDEKWQKKWEENSLYKFNNDNL------DK------KLYVLEMFSYPSGSKLHAGH
SYL_CLONN       YGTTVDEKWQKKWEESGLHNFDENAP------GE------KLYVLEMFSYPSAAKLHAGH
SYL_CLOAB       YSTKVDEKWQKKWEETSLYKFDENNL------EK------KLYVLEMFSYPSGAKLHAGH
SYL_CLOK5       YSTKTDKKWQQKWDQTNIYTFDEKKS------SK------KLYTLEMFSYPSGSNLHAGH
SYL_CLOTE       YGTNIDRKWQNKWEDSNLYHFDTNNL------DK------KLYVLEMFSYPSGSNLHAGH
SYL_CALS4       YSVEIDRKWQKIWEETKLYKFNPENV------DK------KLYCLEMFPYPSGAKLHIGH
SYL_ROSCS       FDPAIEPKWREFWEREGIFKAGRRAG------AP------RRYILEMFPYPSG-DLHIGH
SYL_ROSS1       FDPSIEPKWREFWAREGIFKAGRRAG------AP------RRYILEMFPYPSG-DLHIGH
SYL_THEFY       DVRALQEKWQARWAKENPFTASEDPADP----RP------RRYVLDMFPYPSG-DLHMGH
SYL_ACIC1       DFAAIQARWLPVWTELDPFRASDDPSDP----RE------RRYMLDMFPYPSG-DLHMGH
SYL_ARTS2       SFAAMEAKWPQVWEDLKVFTPVDDGS------RE------RRYVLDMFPYPSG-DLHMGH
SYL_PAEAT       SFAAMEAKWPQVWEDLKVFTPADDGS------RE------RRYVLDMFPYPSG-DLHMGH
SYL_RENSM       DIAAIEAKWLPRWEEANIFAPLDDGS------KE------RRYVCDMFPYPSG-DLHMGH
SYL_CLAMS       DFRAIEAEWSEVWEREQPFRT-PDASDS----RP------RKYILDMFPYPSG-DLHMGH
SYL_CLAM3       DFRAIEAEWSEVWEREQPFRT-PDASDS----RP------RKYILDMFPYPSG-DLHMGH
SYL_LEIXX       DFAQIQAKWLPVWEKLKPFAT-DDPEDN----RP------RKYVLDMFPYPSG-DLHMGH
SYL_KINRD       DAFALQEKWLPVWDERKPFRS-GEPGDE----RP------KKYVLDMFPYPSG-DLHMGH
SYL_NOCSJ       DVRAIQDKWLPVWERLDPFRADDSSP------RE------KKYALTMFPYPSG-DLHMGH
SYL_TROW8       NFRALEEKWAPIWERDRLFEVDENDSE-----TP------RKYVLDMFSYPSG-DLHMGH
SYL_TROWT       NFRALEEKWAPIWERDRLFEVDENDSE-----TP------RKYVLDMFSYPSG-DLHMGH
SYL_MYCPA       LAGRIEGSWQDTWAKLGTFNVPNPVGSLAPTDGT-PVPEDKLFVQDMFPYPSGEGLHVGH
SYL_MYCA1       LAGRIEGSWQDTWAKLGTFNVPNPVGSLAPTDGT-PVPEDKLFVQDMFPYPSGEGLHVGH
SYL_MYCLE       LAGRIESTWQDNWARLQTFNVPNPVGSLAPPDGS-VVPADKLFVQDMFPYPSGDGLHVGH
SYL_MYCTA       LAARLERTWQENWARLGTFNVPNPVGSLAPPDGA-AVPDDKLFVQDMFPYPSGEGLHVGH
SYL_MYCBO       LAARLERTWQENWARLGTFNVPNPVGSLAPPDGA-AVPDDKLFVQDMFPYPSGEGLHVGH
SYL_MYCTU       LAARLERTWQENWARLGTFNVPNPVGSLAPPDGA-AVPDDKLFVQDMFPYPSGEGLHVGH
SYL_MYCBP       LAARLERTWQENWARLGTFNVPNPVGSLAPPDGA-AVPDDKLFVQDMFPYPSGEGLHVGH
SYL_MYCUA       LAAGVERTWQQNWARLGTFNVPNPVGSLAPSDGS-PVPEDKLFVQDMFPYPSGEGLHVGH
SYL_MYCSS       LAGQIEGAWQQTWAVEGTFNVPNPVGELAPPDG--TVPADKMFVQDMFPYPSGEGLHVGH
SYL_MYCSK       LAGQIEGAWQQTWAVEGTFNVPNPVGELAPPDG--TVPADKMFVQDMFPYPSGEGLHVGH
SYL_MYCSJ       LAGQIEGAWQQTWAVEGTFNVPNPVGELAPPDG--TVPADKMFVQDMFPYPSGEGLHVGH
SYL_MYCS2       LAGQIERAWQETWSDRGTFNVANPVGSLAPTDGS-DVPADKMFVQDMFPYPSGDGLHVGH
SYL_MYCVP       LAGEIERAWQQRWTQDGTFDVANPVGSLAPADGS-AVPADKMFVQDMFPYPSGEGLHVGH
SYL_MYCGI       LAGEIERAWQQQWADSGTFHVDNPVGSLAPADGS-AVPADKMFVQDMFPYPSGEGLHVGH
SYL_NOCFA       LAGRIERRWQQRWLERGTFHAPNPTGPLAGPTA--TLPADKLFVQDMFPYPSGAGLHVGH
SYL_RHOJR       LAGQIEQRWQDRWSEEGTFNAPNPVGPLAG-----DVPADKLFVQDMFPYPSGTGLHVGH
SYL_SACEN       TAAEIEQRWQRRWEELGTFHAPNPAGSLKG-----EVSDEKLFVQDMFPYPSGSGLHVGH
SYL_CORGB       LANKIEGEWQNYWTDNGTFNAPNPVGDLAPADGK-ALPEDKLFVQDMFPYPSGAGLHVGH
SYL_CORGL       LANKIEGEWQNYWTDNGTFNAPNPVGDLAPADGK-ALPEDKLFVQDMFPYPSGAGLHVGH
SYL_COREF       LANAIEREWQNYWTDKGTFNAPNPVGDLAPEDGR-ELPGDKLFVQDMFPYPSGAGLHVGH
SYL_CORDI       LAGEIERSWQQYWIDNGTFNAPNPVGDLAVS-GD-KLPEDKLFVQDMFPYPSGAGLHVGH
SYL_CORJK       LAAKIEAKWQKHWADKGTFNAPNPTGDLAEP-GA-ELPEDRKFIQDMFPYPSGVGLHVGH
SYL_STRCO       MAAEIEARWQDFWDAEGTYAAPNPKGDLAGDPEL-VAKPKK-FIMDMFPYPSGAGLHVGH
SYL_STRAW       VAAEIEARWQDFWDAEGTYEAPNPTGDLAGGPAL-VAKPKK-FVMDMFPYPSGAGLHVGH
SYL_SALAI       LADEIERRWQDIWEREGTFHAPNPTGPLADPEHP-RAGAEKLYVLDMFPYPSGAGLHVGH
SYL_BIFAA       LAQGIEEKWQKIWDDEGTFWAANVNGDLKDGKGHNAEGRPSYFAMDMFPYPSGKGLHVGH
SYL_BIFLO       LAQDIENKWQKIWDEQGTFWAANVNGDLKDGKGRNAEGRTAYFAMDMFPYPSGKGLHVGH
SYL_FRACC       LAADIERRWQRRWADEGTFNSPNPVGPLSTGFEK-VAGREPFYIMDMFPYPSGSGLHVGH
SYL_FRAAA       LAADIERRWQRRWADEGTFNSPNPVGPLAAGFDE-VAGREPFYIMDMFPYPSGTGLHVGH
                                                          :     .***.   * **

SYL_GEOKA       PEGYTATDILARMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPAEFTQKNI------
SYL_GEOTN       PEGYTATDILARMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPAEFTQKNI------
SYL_BACCZ       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNSPAEFTEHNI------
SYL_BACAH       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNSPAEFTEHNI------
SYL_BACAN       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNSPAEFTEHNI------
SYL_BACHK       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNSPAEFTEHNI------
SYL_BACC1       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNSPAEFTEHNI------
SYL_BACCR       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNSPAEFTEHNI------
SYL_BACCN       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNSPAEFTEKNI------
SYL_BACSU       PEGYTATDILSRMKRMQGYDVLHPMGWDAFGLPAEQYAL-DTGNDPAVFTKQNI------
SYL_BACVZ       PEGYTATDILSRMRRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPAEFTKQNI------
SYL_BACLD       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPAVFTEQNI------
SYL_BACP2       PEGYTATDILSRMKRMQGYDVLHPMGWDAFGLPAEQYAL-DTGNDPAVFTEENI------
SYL_BACHD       PEGYTATDILSRMKRMQGYNVLHPMGWDAFGLPAEQYAI-DTGNSPAEFTEKNI------
SYL_BACSK       PEGYTATDILARMKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGKHPATFTKQNI------
SYL_OCEIH       PEGYTATDILARMKRMQGYEVMHPMGWDAFGLPAEQYAI-DTGNSPAEFTNQNI------
SYL_STAES       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTQKNI------
SYL_STAEQ       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTQKNI------
SYL_STAAW       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAS       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAN       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAA1       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAM       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAA9       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAA2       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAA3       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAC       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAA8       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAT       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAE       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAB       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAAR       PEGYTATDIISRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKKNI------
SYL_STAHJ       PEGYTATDIVSRYKRMQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKQNI------
SYL_STAS1       PEGYTATDIISRYKRMLGYNVLHPMGWDAFGLPAEQYAL-DTGNDPREFTKENI------
SYL_LISMF       PEGYTATDILSRMKRMQGKNVLHPIGWDAFGLPAEQYAI-DTGNDPEEFTALNI------
SYL_LISMO       PEGYTATDILSRMKRMQGKNVLHPIGWDAFGLPAEQYAI-DTGNDPEEFTALNI------
SYL_LISIN       PEGYTATDILSRMKRMQGKNVLHPIGWDAFGLPAEQYAI-DTGNDPEEFTALNI------
SYL_LISW6       PEGYTATDILSRMKRMQGKNVLHPIGWDAFGLPAEQYAI-DTGNDPEEFTALNI------
SYL_ENTFA       PEGYTATDILSRMKRAQGYNVLHPMGWDAFGLPAEQYAL-DTGNDPAEFTKKNI------
SYL_STRTD       PEGYTATDILSRFKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPADFTAENI------
SYL_STRT2       PEGYTATDILSRFKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPADFTAENI------
SYL_STRT1       PEGYTATDILSRFKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPADFTAENI------
SYL_STRP2       PEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRR6       PEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRPN       PEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRSV       PEGYTATDILSRYKRTQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPADFTAENI------
SYL_STRGC       PEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPADFTAENI------
SYL_STRS2       PEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPADFTAENI------
SYL_STRSY       PEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGNDPADFTAENI------
SYL_STRPD       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRPG       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRP6       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRPM       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRPF       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRPB       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRPC       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRP3       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRP1       PEGYTATDILSRFKRAQGHNILHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRP8       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRA3       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRA5       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRA1       PEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_STRMU       PEGYTATDILSRFKRAQGYNVLHPMGWDAFGLPAEQYAM-DTGHDPADFTAQNI------
SYL_LACLM       PEGYTATDILSRYKRAQGFNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_LACLA       PEGYTATDILSRYKRAQGFNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_LACLS       PEGYTATDILSRYKRAQGFNVLHPMGWDAFGLPAEQYAM-DTGNDPAEFTAENI------
SYL_LACSS       PEGYTATDILARMKRMQGFNVLHPMGWDAFGLPAEQYAL-DTGNNPADFTQKNI------
SYL_LACDA       PEGYTATDIMARMKRAQGYNVLHPMGWDAFGLPAEQYAL-QTGNDPATFTDENI------
SYL_LACDB       PEGYTATDIMARMKRAQGYNVLHPMGWDAFGLPAEQYAL-QTGNDPATFTDENI------
SYL_LACP3       PEGYTATDIVARMKRMQGFNVLHPMGWDAFGLPAEQYAL-NTGHNPKTFTKQNI------
SYL_LACPL       PEGYTATDIMSRFKRMQGYNVLHPMGWDAFGLPAEQYAL-KTGHNPKDFTAKNI------
SYL_LACBA       PEGYTATDIMARLKRMQGFNVLHPMGWDAFGLPAEQYAL-KTGHNPKDFTAHNI------
SYL_PEDPA       PEGYTATDIMSRMKRMQGYKVLHPMGWDAFGLPAEQYAM-KTGNNPRDFTAKNI------
SYL_LACS1       PEGYTATDIMARMKRMQGYNVLHPMGWDAFGLPAEQYAL-NTGNSPREFTKKNV------
SYL_LACRD       PEGYTATDVMSRMKRMQGFNVLHPMGWDAFGLPAEQYAL-KTGHNPKDFTNKNI------
SYL_LEUMM       PEGYTATDIMSRYKRAKGFNVLHPMGWDAFGLPAEQYAI-KTGNNPAGFTNKNV------
SYL_OENOB       PESYTATDIMARFNRMRGFNVLQPMGWDAFGLPAEQYAI-KTGHNPADFTNENI------
SYL_SALRD       PEGYTATDIVARYKRKQGFNVLHPMGWDAFGLPAEQYAL-KTNTHPRETTEKNI------
SYL1_RHIL3      PLGYTATDIMCRYKRMRGFNVLHPMGWDSFGLPAERHAM-RTGVHPDITTKRNI------
SYL_RHOBA       PEGYTATDIVSRFARARGESVLHPMGFDAFGLPAEEHAI-KTGEHPRVQTQRNI------
SYL_PELLD       LEGYTASDIVARYRRSRGNNVLHPMGWDAFGLPAEQYAI-KTGTHPSLTTENNI------
SYL_CHLPM       LEGYTASDISARYRRSRGYNVLHPMGWDAFGLPAEQFAI-KTGTHPSDTTQKNI------
SYL_CHLCH       LEGYTASDIIARYKRSSGYNVLHPMGWDAFGLPAEQFAI-KTGTHPRITTEANV------
SYL_CHLTE       LEGYTATDIMARYKRCQGHNVLHPMGWDAFGLPAEQFAI-KTGTHPRLTTEKNV------
SYL_CHLPD       LEGYTATDIVARYKRSCGYNVLHPMGWDAFGLPAEQFAI-KTGTHPKNTTEKNI------
SYL_LEPBL       PEGYTATDILSRFKRMKGFEVLHPMGWDAFGLPAERYAM-QTGIHPAITTKNNI------
SYL_LEPBJ       PEGYTATDILSRFKRMKGFEVLHPMGWDAFGLPAERYAM-QTGIHPAITTKNNI------
SYL_LEPIC       PEGYTATDILSRFKRMKGFEVLHPMGWDAFGLPAERYAM-QTGIHPAITTKDNI------
SYL_LEPIN       PEGYTATDILSRFKRMKGFEVLHPMGWDAFGLPAERYAM-QTGIHPAITTKDNI------
SYL_BACTN       PLGYIASDIYARYKRLRGFNVLNPMGYDAYGLPAEQYAI-QTGQHPAITTKANI------
SYL_BACV8       PLGYIASDIYARYKRLQGFNVLNPMGYDAYGLPAEQYAI-QTGQHPAITTVNNI------
SYL_BACFR       PLGYIASDIYARYKRLQGFNVLNPMGYDAYGLPAEQYAI-QTGQHPAITTVNNI------
SYL_BACFN       PLGYIASDIYARYKRLQGFNVLNPMGYDAYGLPAEQYAI-QTGQHPAITTVNNI------
SYL_PARD8       PLGYIASDIYSRFKRLQGFNVLHPMGYDAYGLPAEQYAI-QTGQHPEITTKNNI------
SYL_PORGI       PLGYIASDIFSRYKRLRGFNVLHPMGYDAFGLPAEQYAI-QTGQHPEKTTEENT------
SYL_FLAPJ       PLGYIASDIVARFKRHKGFNVLHPQGYDSFGLPAEQYAI-QTGQHPDKTTKENI------
SYL_FLAJ1       PLGYIASDVYSRFKRHQGFNVLHPMGYDSFGLPAEQYAI-QTGQRPEDTTRVNIDGGVDK
SYL_GRAFK       PLGYIASDIYARFKRHKGFNVLHPQGYDSFGLPAEQYAI-QTGQHPAVTTENNI------
SYL_CYTH3       PLGYIASDIMARYKRIKGYNVLHPMGFDSFGLPAEQYAV-QTGQHPAITTEQNI------
SYL_BDEBA       MASYTPGDIISRYKRVNGFNVLHPMGYDAFGLPAEQYAI-QTGVHPAITTKKAI------
SYL_SORC5       PEGYTATDIMSRYFRMRGIDVLHVMGWDAFGLPAEQHAL-ETGTHPADTTARNI------
SYL_TREDE       PEGYTATDIYSRFLRMSGYNVLHPMGFDSFGLPAENYAI-KTGIHPLITTRKNM------
SYL_TREPA       PEGYTATDIYCRYLRMGGYNVLHPMGFDAFGLPAENFAL-KTGTHPRVSTSANC------
SYL_BORAP       PEGYTATDIFARYKILNGFHVLHPIGFDSFGLPAENYAI-QTGTHPKKSTEENI------
SYL_BORBP       PEGYTATDIFGRYKLLNGFHVLHPIGFDSFGLPAENYAI-QTGTHPQKSTEENI------
SYL_BORBU       PEGYTATDIFGRYKLLNGFHVLHPIGFDSFGLPAENYAI-QTGTHPQKSTEENI------
SYL_CHLTR       LIGYTATDIVARYKRAQGFSVLHPMGWDSFGLPAEQYAI-RTGTHPRETTEKNI------
SYL_CHLTA       LIGYTATDIVARYKRAQGFSVLHPMGWDSFGLPAEQYAI-RTGTHPRETTEKNI------
SYL_CHLMU       LIGYTATDIVARYKRAKGFSVLHPMGWDSFGLPAEQYAI-RTGTHPRETTEKNI------
SYL_CHLFF       LIGYTATDIVARYKRAKGFSVLHPMGWDSFGLPAEQYAV-RTGTHPRETTQKNI------
SYL_CHLCV       LIGYTATDIVARYKRAKGYAVLHPMGWDSFGLPAEQYAV-RTGTHPRETTQKNI------
SYL_CHLAB       LIGYTATDIVARYKRAKGFSVLHPMGWDSFGLPAEQYAV-RTGTHPRETTKKNI------
SYL_CHLPN       LIGYTATDIVARYKRARGFSVLHPMGWDSFGLPAEQYAI-RTGTHPKVTTQKNI------
SYL_PARUW       VVGYTATDIIARYMRTKGYNVMHPMGWDSFGLPAEQYAI-RTGTHPAESTQENI------
SYL_ALKOO       PRPYTALDVVSRKRRLEGYNVLYPMGWDAFGLPTENYAI-KNKIHPKVVTEQNV------
SYL_UREP2       PKGYTATDVISRFKRLNGYDVLHPIGWDAFGLPAEQYAL-ETNNHPHTFTQQNI------
SYL_UREPA       PKGYTATDVISRFKRLNGYDVLHPIGWDAFGLPAEQYAL-ETNNHPHTFTQQNI------
SYL_MYCPU       PEGYTATDIIARFKRLKGFDVLHPMGWDAFGLPAEQYAI-STGNNPNEFTQKNI------
SYL_MYCPE       VKSYTPTDVYARFKRYQGYSVLHPMGWDAFGLPAEQFAL-ATKNHPATFTDQNI------
SYL_MYCGA       VKAYMATDVISRWKNALGFNVLHPIGWDAFGLPAEQYAI-QTNNHPAKFTQENI------
SYL_MYCGE       VRAYTITDVISRYYKAKGFNVIHPIGFDAFGLPAEQYAI-NSNQNPGSWTDQNI------
SYL_MYCPN       VRAYTITDVLSRYHKAKGFNVIHPIGFDAFGLPAEQYAI-ASNKHPGDWTDKNI------
SYL_MYCCT       IKGYTATDVYSRFKRMQGYDVLHPIGWDAFGLPAEQYAL-KTGNDPRDFTLKNI------
SYL_MYCMS       IKGYTATDVYSRFKRMQGYDVLHPIGWDAFGLPAEQYAL-KTGNDPREFTLQNI------
SYL_MESFL       VKGYTATDVFSRYKRMNGYDVLHPMGWDAFGLPAEQYAL-KTGNDPIDFTLENI------
SYL_ACHLI       IEGYTATDIVSRFKRMQGYNVLHPMGWDAYGLPSEQYAL-ATGKDPKSFTYQNI------
SYL_PSEA6       VRNYTIGDVVSRFQRMNGKNVLQPMGWDAFGLPAENAAL-NNNTAPAKWTYQNI------
SYL_COLP3       VRNYSLGDVISRYQRMQGKNVMQPMGWDAFGLPAENAAI-KNKTAPGKWTYENI------
SYL_IDILO       VRNYTLGDVISRHQRMLGKNVMQPMGWDAFGLPAENAAI-QNKTAPAKWTYQNI------
SYL_PSEHT       VRNYTIGDVVSRFQRLKGKNVMQPMGWDAFGLPAENAAI-KNKTAPAKWTYENI------
SYL_PSYIN       VRNYTIGDVISRYQRMQGKNVMQPMGWDAFGLPAENAAI-KNNTAPAGWTYENI------
SYL_SALCH       VRNYTIGDVVARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SALTI       VRNYTIGDVVARYQHMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SALTY       VRNYTIGDVVARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SALPB       VRNYTIGDVVARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SALPA       VRNYTIGDVVARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_CITK8       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SALAR       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SHIFL       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SHIF8       VRNYTIGDVIARYQHMLGKNVLQPIGWDAFGLPAEGAAV-KHHTAPAPWTYDNI------
SYL_SHIBS       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECOL6       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECOL5       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECO57       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SHISS       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECOLI       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECOLC       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SHIDS       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECOHS       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECOUT       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECOK1       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ECO24       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_KLEP7       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_CROS8       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_ENT38       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_YERPA       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_YERP3       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_YERPE       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_YERPN       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_YERPS       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_YERPP       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_YERE8       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_SERP5       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYDNI------
SYL_PECAS       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYANI------
SYL_SODGM       VRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYANI------
SYL_PHOLL       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAV-KNNTAPAPWTYANI------
SYL_MANSM       VRNYTIADVVSRYQRMNGKNVLQPVGWDAFGLPAEGAAV-KNKTAPAKWTYENI------
SYL_ACTSZ       VRNYTIGDVVSRYQRMIGKNVLQPMGWDAFGLPAEGAAV-KNNTAPAKWTYENI------
SYL_HAES1       VRNYTIGDVISRYQRMNGKNVLQPMGWDAFGLPAEGAAI-KNKTAPAKWTYENI------
SYL_HISS2       VRNYTIGDVISRYQRMNGKNVLQPMGWDAFGLPAEGAAI-KNKTAPAKWTYENI------
SYL_PASMU       VRNYTIGDVVSRYQRMNGKNVLQPMGWDAFGLPAEGAAI-KNKTAPAKWTYENI------
SYL_HAEIG       VRNYTIGDVISRYQRMLGKNVLQPFGWDAFGLPAEGAAI-KNKTAPAKWTYENI------
SYL_HAEIN       VRNYTIGDVISRYQRMLGKNVLQPFGWDAFGLPAEGAAI-KNKTAPAKWTYENI------
SYL_HAEI8       VRNYTIGDVISRYQRMLGKNVLQPFGWDAFGLPAEGAAI-KNKTAPAKWTYENI------
SYL_HAEIE       VRNYTIGDVISRYQRMLGKNVLQPFGWDAFGLPAEGAAI-KNKTAPAKWTYENI------
SYL_ACTP2       VRNYTIGDVVSRYQRMIGKNVLQPMGWDAFGLPAEGAAV-KNNTAPAKWTYENI------
SYL_HAEDU       VRNYTIGDVISRYQRMIGKNVLQPMGWDAFGLPAEGAAV-KNNTAPAKWTYENI------
SYL_SHESA       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYQNI------
SYL_SHESM       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYQNI------
SYL_SHESR       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYQNI------
SYL_SHEON       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYQNI------
SYL_SHEB9       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYENI------
SYL_SHEB5       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYENI------
SYL_SHEB8       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYENI------
SYL_SHESW       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYENI------
SYL_SHEPC       VRNYTIGDVVARFQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYENI------
SYL_SHEAM       VRNYTIGDVVARFQRLQGKNVLQPIGWDAFGLPAENAAI-KNATAPAPWTYENI------
SYL_SHEHH       VRNYTIGDVVSRYQRLQGKNVLQPIGWDSFGLPAENAAI-KNSTAPAPWTYENI------
SYL_SHEPA       VRNYTIGDVVSRYQRLQGKNVLQPIGWDSFGLPAENAAI-KNNTAPAPWTYENI------
SYL_SHELP       VRNYTIGDVVARYQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTAPAPWTYENI------
SYL_SHESH       VRNYTIGDVVARYQRLQGKNVLQPIGWDSFGLPAENAAI-KNNTAPAPWTYENI------
SYL_SHEDO       VRNYTIGDVVARYQRLQGKNVLQPIGWDSFGLPAENAAI-NNKTSPAPWTYENI------
SYL_SHEFN       VRNYTIGDVVARYQRLQGKNVLQPIGWDSFGLPAENAAI-NNKASPAPWTYENI------
SYL_VIBPA       VRNYTIGDVVSRFQRLQGKNVMQPIGWDAFGLPAENAAV-KNNTAPAPWTYENI------
SYL_VIBCB       VRNYTIGDVVSRFQRLQGKNVMQPIGWDAFGLPAENAAV-KNNTAPAPWTYENI------
SYL_VIBVU       VRNYTIGDVVSRFQRLQGKNVMQPIGWDAFGLPAENAAV-KNNTAPAPWTYENI------
SYL_VIBVY       VRNYTIGDVVSRFQRLQGKNVMQPIGWDAFGLPAENAAV-KNNTAPAPWTYENI------
SYL_VIBCH       VRNYTIGDVVSRFQRLQGKNVLQPIGWDAFGLPAENAAV-KNNTAPAPWTYENI------
SYL_VIBC3       VRNYTIGDVVSRFQRLQGKNVLQPIGWDAFGLPAENAAV-KNNTAPAPWTYENI------
SYL_ALIF1       VRNYTIGDVVSRYQRLQGKNVMQPIGWDAFGLPAENAAV-KNKTAPAPWTYENI------
SYL_PHOPR       VRNYTIGDVVSRYQRLQGKNVMQPIGWDAFGLPAENAAV-KNKTAPAPWTYENI------
SYL_AERS4       VRNYTIGDVISRYQRLNGKNVLQPIGWDAFGLPAENAAV-KNNTAPAPWTYENI------
SYL_AERHH       VRNYTIGDVISRYQRLNGKNVLQPIGWDAFGLPAENAAI-KNNTAPAPWTYENI------
SYL_MARHV       VRNYTIGDVISRYQRMQGKNVMQPMGWDAFGLPAENAAI-ANKSAPAKWTRSNI------
SYL_HAHCH       VRNYTIGDVISRYQRMQGKNVLQPMGWDAFGLPAENAAL-KNNVAPAKWTYENI------
SYL_SACD2       VRNYTISDVISRFHRMQGKNVLHPMGWDAFGLPAENAAI-KNNTAPAKWTYSNT------
SYL_MARMS       VRNYTIGDVISRYQRMQGKNVLQPMGWDAFGLPAENAAI-KHKTAPAKWTTENI------
SYL_ALCBS       VRNYSIGDVVSRYQRMLGKNVLQPMGWDAFGLPAENAAI-KNKVAPAKWTFENI------
SYL_PSEAB       VRNYTIGDVISRYHRMQGRNVLQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_PSEAE       VRNYTIGDVISRYHRMQGRNVLQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_PSEA7       VRNYTIGDVISRYHRMQGRNVLQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_PSEU5       VRNYTIGDVIARYQRMQGKNVLQPMGWDAFGMPAENAAM-KNQVAPAKWTYENI------
SYL_PSEMY       VRNYTIGDVIARYQRMQGKNVLQPMGWDAFGMPAENAAM-KNQVAPAKWTYENI------
SYL_PSEP1       VRNYTIGDVIARYQRMLGKNVLQPMGWDAFGMPAENAAM-KNNVAPAKWTYENI------
SYL_PSEPK       VRNYTIGDVIARYQRMLGKNVLQPMGWDAFGMPAENAAM-KNNVAPAKWTYENI------
SYL_PSEPG       VRNYTIGDVIARYQRMLGKNVLQPMGWDAFGMPAENAAM-KNNVAPAKWTYENI------
SYL_PSEE4       VRNYTIGDVIARYQRMLGKNVLQPMGWDAFGMPAENAAM-KNNVAPAKWTYENI------
SYL_PSEU2       VRNYTIGDVISRYQRMLGKNVLQPLGWDAFGMPAENAAI-DNNVAPAKWTYENI------
SYL_PSE14       VRNYTIGDVISRYQRMLGKNVLQPLGWDAFGMPAENAAI-DNNVAPAKWTYENI------
SYL_PSESM       VRNYTIGDVISRYQRMLGKNVLQPLGWDAFGMPAENAAI-DNNVAPAKWTYENI------
SYL_NEIMB       VRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_NEIMF       VRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_NEIG1       VRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_NEIM0       VRNYTIGDVLSRFKRLNGFNVMQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_NEIMA       VRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAM-KNNVAPAAWTYDNI------
SYL_CHRVO       VRNYTITDVLARFKRLQGFNVLQPMGWDAFGLPAENAAM-KNGGAPAAWTYANI------
SYL_THIDA       VRNYTIGDVLARYHALRGFNVMQPMGWDAFGLPAENAAI-ANGVPPAQWTYANI------
SYL_DECAR       VRNYTIGDVLSRFHKMQGYNVLQPMGWDAFGMPAENAAL-QNNVPPAGWTYSNI------
SYL_AZOSB       VRNYTIGDVLARFHRMRGYNVLQPMGWDAFGMPAENAAI-QNNVPPAKWTYANI------
SYL_CUPMC       VRNYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAAL-NNGVAPAAWTYDNI------
SYL_CUPPJ       VRNYTINDVMARYLRMNGNNVLMPMGWDAFGMPAENAAL-NNGVAPAAWTYDNI------
SYL_RALSO       VRNYTINDVMMRQLRMKGYNVLMPMGWDAFGMPAENAAL-NNGVAPAAWTYDNI------
SYL_JANMA       VRNYTINDVMYRYLRMNGYNVLMPMGWDAFGMPAENAAM-ANNVPPAQWTYANI------
SYL_HERAR       VRNYTINDVMYRYLRMNGYNVLMPMGWDAFGMPAENAAM-ANNVPPAQWTYANI------
SYL_BURCH       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAKWTYDNI------
SYL_BURCA       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAKWTYDNI------
SYL_BURL3       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAKWTYDNI------
SYL_BURCM       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAKWTYDNI------
SYL_BURVG       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAKWTYDNI------
SYL_BURP0       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURPS       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURP6       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURP1       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURM7       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURM9       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURMA       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURMS       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYENI------
SYL_BURTA       VRNYTINDVMYRYLRMNGYNTLMPMGWDAFGMPAENAAM-ANGVPPAQWTYDNI------
SYL_PARXL       VRNYTINDVMYRYLRMNGYNVLMPMGWDAFGMPAENAAM-ANNVPPAKWTYDNI------
SYL_POLAQ       VRNYTINDVMARQLRMQGYNVLMPMGWDAFGMPAENAAI-QNKVPPAKWTYDNI------
SYL_BORBR       VRNYTINDMMARQLRMRGYNVLMPMGWDAFGMPAENAAI-KSKVPPAKWTYDNI------
SYL_BORPA       VRNYTINDMMARQLRMRGYNVLMPMGWDAFGMPAENAAI-KSKVPPAKWTYDNI------
SYL_BORPE       VRNYTINDMMARQLRMRGYNVLMPMGWDAFGMPAENAAI-KSKVPPAKWTYDNI------
SYL_BORPD       VRNYTINDMMARQLRMRGYNVLMPMGWDAFGMPAENAAI-KSKVPPAKWTYDNI------
SYL_BORA1       VRNYTINDMMARQLRMRGYNVLMPMGWDAFGMPAENAAI-KSKVPPAKWTYDNI------
SYL_METPP       VRNYTINDMMARYLRMKGYNVLMPMGWDAFGLPAENAAI-DKKVAPAQWTRDNI------
SYL_ACISJ       VRNYTINDMLTRSLRMKGHNVLMPMGWDAFGLPAENAAL-KNGVPPAQWTYDNI------
SYL_ACIAC       VRNYTINDMLTRYLRMNGHNVLMPMGWDAFGLPAENAAL-KNGVPPAQWTYDNI------
SYL_RHOFT       VRNYTINDMLTRYLRMNGYNVLMPMGWDAFGLPAENAAL-KNGVPPAQWTFENI------
SYL_VEREI       VRNYTINDMLTRYLRMNGYNVLMPMGWDAFGLPAENAAI-KNGMPPARWTRENI------
SYL_POLNA       VRNYTINDMLSRYLRMKGYNVLMPMGWDAFGLPAENAAL-KNGVPPAQWTYDNI------
SYL_POLSJ       VRNYTINDMLTRYLRMKGYNVLMPMGWDAFGLPAENAAM-KNGVPPAQWTYDNI------
SYL_METCA       VRNYTIGDVIARYQRMRGKNVLQPMGWDAFGLPAENAAM-QNGVTPAAWTDANA------
SYL_DICNV       VRNYTIGDVISRYQRMLGKNVLQPMGWDAFGMPAENAAM-KNQVAPAQWTYQNI------
SYL_PSYCK       VRNYTISDVLSRYYRLKGYEVMQPMGWDGFGLPAENAAI-ANQTPPAKWTFENI------
SYL_PSYA2       VRNYTISDVLSRYYRLKGYEVMQPMGWDGFGLPAENAAI-ANQTPPAKWTFENI------
SYL_PSYWF       VRNYTISDVLSRYYRLKGDQVLQPMGWDAFGMPAENAAI-ANQVAPAKWTFSNI------
SYL_ACIAD       VRNYTIGDVISRFYRLKGETVLQPMGWDAFGLPAENAAI-AHQVAPAKWTFENI------
SYL_NITEU       VRNYTIGDVLSRYRRMQGYNVMQPMGWDAFGLPAENAAI-QKGVPPAKWTYDNI------
SYL_NITEC       VRNYTIGDVLSRYRRMQGYNVMQPMGWDAFGLPAENAAI-QKGVPPAKWTYDNI------
SYL_NITMU       VRNYTIGDVLSRYHRMQGYNVLQPMGWDAFGLPAENAAM-QNNVPPAKWTYDNI------
SYL_METFK       VRNYTIGDVLSRFHRMRGYNVMQPMGWDAFGLPAENAAI-KHNVAPAGWTYSNI------
SYL_HYDCU       VRNYTIGDVVSRFQRMQGKNVLQPMGWDAFGLPAENAAM-DNQVAPAKWTYQNI------
SYL_XYLFA       VRNYTIGDVISRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKVAPAQWTYKNI------
SYL_XYLFT       VRNYTIGDVISRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKVAPAQWTYKNI------
SYL_XANC8       VRNYTISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKTAPAKWTYANI------
SYL_XANCP       VRNYTISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKTAPAKWTYANI------
SYL_XANCB       VRNYTISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKTAPAKWTYANI------
SYL_XANC5       VRNYTISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKTAPAKWTYANI------
SYL_XANAC       VRNYTISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKTAPAKWTYANI------
SYL_XANOR       VRNYTISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKTAPAKWTYANI------
SYL_XANOM       VRNYTISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAI-KNKTAPAKWTYANI------
SYL_NITOC       VRNYTIGDVISRYQRMRGRNVLQPMGWDAFGLPAENAAI-QNRVPPAQWTYENI------
SYL_ALKEH       VRNYTIGDVISRYQRMQGRNVLQPMGWDAFGLPAENAAM-KHGVPPARWTRENI------
SYL_HALHL       VRNYTIGDVVSRYKRMQGYNVLQPMGWDAFGLPAENAAM-ERGVPPAAWTRENI------
SYL_CHRSD       VRNYTIGDVVSRFQRMQGKNVLQPMGWDAFGMPAENAAI-KNRVPPGAWTYDNI------
SYL_BUCAI       VRNYTISDVISRYQRMLGKNVLQPMGWDAFGLPAEEAAI-RNNTDPFSWTQKNI------
SYL_BUCAP       VRNYTISDVISRYQRMLGKNVLQPIGWDAFGLPAEEAAI-KNKTKPSDWTQKNI------
SYL_BUCCC       VRNYTISDVISRFHRMLGKNVLQPIGWDSFGLPAEETAI-KNNISPKKWTFKNI------
SYL_BUCBP       VRNYTISDVIARYQRMLGKNVLHPMGWDAFGLPAENAAI-KNNTHPAQWTYENI------
SYL_WIGBR       VRNYVLGDVIARYQRMLGKNVLHPIGWDAFGLPAETAAI-NNKISPEKWTISSI------
SYL_BLOPB       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEHAAI-KNNTDPSIWTYSNI------
SYL_BLOFL       VRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEQAAI-IHKKNPSDWTYSNI------
SYL_BAUCH       VRNYTIGDVLSRYHRMLGKNVMQPIGWDAFGLPAERAAL-KNQTAPATWTYANI------
SYL_COXBU       VRNYTIGDVIARYQIHKGRNVLQPMGWDAFGLPAENAAI-QRELPPAEWTRKNI------
SYL_COXBR       VRNYTIGDVIARYQIHKGRNVLQPMGWDAFGLPAENAAI-QRELPPAEWTRKNI------
SYL_COXBN       VRNYTIGDVIARYQIHKGRNVLQPMGWDAFGLPAENAAI-QRELPPAEWTRKNI------
SYL_LEGPH       VRNYTLGDVIARYQRALGKNVLQPIGWDAFGLPAENAAI-KNKIPPAEWTRKNI------
SYL_LEGPC       VRNYTLGDVIARYQRALGKNVLQPIGWDAFGLPAENAAI-KNKIPPAEWTRKNI------
SYL_LEGPA       VRNYTLGDVIARYQRALGKNVLQPIGWDAFGLPAENAAI-KNKIPPAEWTRKNI------
SYL_LEGPL       VRNYTLGDVIARYQRALGKNVLQPIGWDSFGLPAENAAI-KNKIPPAEWTRKNI------
SYL_FRATT       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_FRAT1       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_FRATW       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_FRATF       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_FRATH       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_FRATO       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_FRATN       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_FRAP2       VRNYTIGDVIARYQKMQGKNVLHPMGWDAFGLPAENAAI-KHKKSPYEWTKSNI------
SYL_RUTMC       VRNYSIGDVISRYQKMQGKNVMQPIGWDGFGLPAENAAL-ENKVSPAKWTYENI------
SYL_VESOH       VRNYSIGDVISRFQRMQGKNVMQPIGWDGFGLPAENAAL-KNKESPAKWTYKNI------
SYL_RICRS       VRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-NNNSHPKKWTYSNI------
SYL_RICRO       VRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-NNNSHPKKWTYSNI------
SYL_RICCN       VRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-KNNSHPKKWTYSNI------
SYL_RICM5       VRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-KNNSHPKKWTYSNI------
SYL_RICFE       VRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-KNNSHPKDWTYSNI------
SYL_RICAH       VRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-KNNSHPKDWTYSNI------
SYL_RICCK       VRNYSIGDVIARFMNMQGFNVLHPMGWDAFGLPAENAAI-KNNVHPKEWTYSNV------
SYL_RICBR       VRNYSIGDVVARFMTMQGFNVLHPMGWDSFGLPAENAAI-KNNSHPKEWTYSNI------
SYL_RICPR       VRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-KNNSRPQDWTYSNI------
SYL_RICTY       IRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAI-QNNSRPQDWTYSNI------
SYL_ORITB       VRNYTICDVIARFERSQGHNVLHAMGWDAFGLPAENAAM-QNNTYPNSWVSSNV------
SYL_WOLPM       LRNYAIGDVIARYKRANGFEVLHPIGWDAFGLPAENAAR-DNNISPETWTKENI------
SYL_WOLTR       LRNYVIGDVIARYKRACGFEVLHPIGWDAFGLPAENAAR-DNNVNPAAWTKENI------
SYL_EHRRW       LRNYTIGDVIARYKRACGLHVFHPIGWDAFGLPAENAAL-SYNISPQVWTRKNI------
SYL_EHRRG       LRNYTIGDVIARYKRACGLHVFHPIGWDAFGLPAENAAL-SYNISPQVWTRKNI------
SYL_EHRCJ       LRNYTIGDVIARYKRACGINVFHPIGWDAFGLPAENAAL-SYNINPQTWTKNNI------
SYL_EHRCR       LRNYTIGDVIARYKRACGINVFHPIGWDAFGLPAENAAL-SYNINPHTWTESNI------
SYL_ANAMM       IRNYTIGDVIARYKRAHGLKVLHPIGWDAFGLPAENAAL-SYGVNPAVWTERNI------
SYL_NEOSM       LRNYVIGDVLARYKRSQGYNVLHPIGWDAFGLPAEKAAI-NSNIHPRIWTEKNI------
SYL2_RHIL3      VRNYAMGDVVARYKRARGYNVLHPMGWDAFGMPAENAAM-ERGVHPASWTYQNI------
SYL_RHIEC       VRNYAMGDVVARYKRARGYNVLHPMGWDAFGMPAENAAM-ERGVHPASWTYQNI------
SYL_RHIME       VRNYTMGDVVARYKRARGFNVLHPMGWDAFGMPAENAAM-ERGVHPASWTYQNI------
SYL_SINMW       VRNYTMGDVVARYKRARGFNVLHPMGWDAFGMPAENAAM-ERGVHPASWTYQNI------
SYL_AGRFC       VRNYAMGDVVARYKRARGFNVLHPMGWDAFGMPAENAAM-QNKVHPKDWTYQNI------
SYL_BRUAB       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_BRUA2       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_BRUSI       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_BRUO2       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_BRUME       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_BRUSU       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_BRUC2       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_OCHA4       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_CHESB       TRNYTMGDVVARYKRAKGYNVLHPMGWDAFGMPAENAAI-QNKIHPKEWTYDNI------
SYL_RHILO       TRNYTMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKEWTYQNI------
SYL_BART1       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAL-QSKVHPKTWTYENI------
SYL_BARHE       VRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAM-QNKVHPKTWTYQNI------
SYL_BARQU       VRNYTMGDVVARYKRAKGFDVLHPMGWDAFGMPAENAAL-QSKVHPKTWTYQNI------
SYL_BARBK       VRNYTMGDVVARYKRAKGMNVLHPMGWDAFGMPAENAAM-QNKVHPKAWTYQNI------
SYL_RHOP2       VRNYTMGDVVARTMRARGHNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYDNI------
SYL_RHOPS       VRNYTMGDVVARTMRARGHNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYANI------
SYL_RHOPA       VRNYTMGDVVARTMRARGYNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYDNI------
SYL_RHOP5       VRNYTMGDVVARTMRARGFNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYDNI------
SYL_NITHX       VRNYTLGDVIARYMRAKGYNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYDNI------
SYL_NITWN       VRNYTLGDVIARYMRARGYNVLHPMGWDAFGLPAENAAI-ERKIAPKAWTYDNI------
SYL_BRASB       VRNYTLGDVLARFMRAKGFNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYDNI------
SYL_BRASO       VRNYTLGDVLARFMRAKGFNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYDNI------
SYL_BRADU       VRNYTLGDVLARFMRAKGFNVLHPMGWDAFGLPAENAAI-ERKVAPKAWTYDNI------
SYL_RHOPB       VRNYTMGDVVARTMRARGYNVLHPMGWDAFGMPAENAAM-ANKVHPKSWTYANI------
SYL_AZOC5       GRNYVMGDVLARYKRMQGFNVLHPMGWDSFGLPAENAAI-ERGIHPKSWTYENI------
SYL_PARL1       VRNYTMGDVIARYKKARGFNVLHPMGWDAFGMPAENAAM-EKNVHPKGWTYDNI------
SYL_CAUVC       VRNYAMGDVVARYKRAQGFNVLHPMGWDAFGMPAENAAM-ERGVHPKGWTYDNI------
SYL_CAUSK       VRNYAMGDVVARYKRAQGFNVLHPMGWDAFGMPAENAAM-ERGVHPKGWTYDNI------
SYL_MARMM       SRNYTMGDVVARYKRARGFDVLHPMGWDAFGLPAENAAR-DRGVHPGAWTHDNI------
SYL_HYPNA       VRNYAMGDVVARHKRAKGYNVLHPMGWDAFGMPAENAAM-ERKVHPGKWTYANI------
SYL_RUEST       VRNYTMGDVIARYKLSTGHNVLHPMGFDAFGMPAENAAM-ASGGHPKDWTYSNI------
SYL_RUEPO       VRNYTMGDVIARYKLSNGFNVLHPMGFDAFGMPAENAAM-ASGGHPKDWTYKNI------
SYL_ROSDO       VRNYTMGDVIARYKLATGHNVLHPMGWDAFGMPAENAAM-AIGGHPKDWTYGNI------
SYL_JANSC       VRNYTMGDVIARHKKAMGHNVLHPMGFDAFGLAAENAAM-DRGIHPKDWTYKNM------
SYL_DINSH       VRNYTMGDVIARYKASCGFSVLHPMGWDAFGMPAENAAM-ATGGHPKDWTYANI------
SYL_RHOS1       VRNYTMGDVVARQKAAAGFSVLHPMGWDAFGMPAENAAM-ERGGHPKDWTYGNI------
SYL_RHOS4       VRNYTMGDVVARQKAAAGFSVLHPMGWDAFGMPAENAAM-ERGGHPKDWTYGNI------
SYL_RHOS5       VRNYTMGDVVARQKAAAGYSVLHPMGWDAFGMPAENAAM-ERGGHPKDWTYGNI------
SYL_PARDP       VRNYTMGDVVARFKRAQGFSVLHPMGWDAFGMPAENAAM-EQGGHPRDWTYGNI------
SYL_ZYMMO       VRNYTMGDVLARYYRMKGHEVLHPMGWDAFGMPAENAAM-ERKIHPREWTMSNI------
SYL_SPHWW       VRNYTMGDVLARYRRMKGFEVLHPMGWDAFGMPAENAAM-EKKVHPGDWTRANI------
SYL_NOVAD       VRNYTMGDVLARYKRMRGFEVLHPMGWDAFGMPAENAAM-EKGVHPGGWTRDNI------
SYL_SPHAL       VRNYAMGDVLARFKRMTGHDVLHPMGWDAFGMPAENAAM-EKGVHPGGWTRANI------
SYL_GRABC       VRNYTLGDVVARYKRAQGYQVLHPMGWDAFGLPAENAAR-ERGVHPGQWTWNNI------
SYL_GLUOX       VRNYTLGDVVARYKRARGFAVMHPMGWDAFGLPAENAAR-ERNVHPGKWTMDNI------
SYL_ACICJ       VRNYAIGDVIARARRAQGYDVLHPMGWDAFGLPAENAAR-ERNVDPAKWTRDNI------
SYL_MAGSA       VRNYTLGDVVARYKRAKGFNVLHPMGWDAFGLPAENAAI-QNNVHPAKWTRENI------
SYL_RHORT       VRNYTLGDVVARFKRAQGFNVLHPMGWDAFGLPAENAAI-QRGVHPATWTRQNI------
SYL_MAGMM       VRNYAIGDVIARYQRMQGKAVLHPMGWDAFGMPAENAAA-QRKVHPRDWTYENI------
SYL_CAMJ8       VRNYTIGDALARYYRKIGFNVLHPIGFDSFGMPAENAAI-KHKIHPKSWTYENI------
SYL_CAMJJ       VRNYTIGDALARYYRKIGFNVLHPIGFDSFGMPAENAAI-KHKIHPKSWTYENI------
SYL_CAMJR       VRNYTIGDVLARYYRKIGFNVLHPIGFDSFGMPAENAAI-KHKIHPKSWTYENI------
SYL_CAMJE       VRNYTIGDALARYYRKIGFNVLHPIGFDSFGMPAENAAI-KHKIHPKSWTYENI------
SYL_CAMJD       VRNYTIGDALARYYRKIGFNVLHPIGFDSFGMPAENAAI-KHKIHPKSWTYENI------
SYL_CAMC1       VRNYSIGDALARSYRKSGYNVLHPIGFDSFGMPAENAAI-KHKIHPKIWTYENI------
SYL_CAMC5       VRNYSIGDALARYYRKNCFNVLHPIGFDSFGMPAENAAI-KHKIHPKKWTYENI------
SYL_CAMFF       VRNYSIGDALSRYYRNRGYNVLQPIGFDSFGMPAENAAI-KHKIHPKIWTYDNI------
SYL_CAMHC       VRNYTIGDAISRYYRMQGYNVLQPIGFDSFGMPAENAAI-KHKIHPKKWTYDNI------
SYL_ARCB4       VRNYCIGDAFARHFRKSDFNVLHPIGWDSFGMPAENAAI-KHKLHPKKWTYENI------
SYL_NITSB       VRNYTIGDAIARYYRKTGANVLHPIGWDAFGMPAENAAI-KHKVHPKKWTYENI------
SYL_WOLSU       VRNYCIGDAIARHFRKQNFNVLHPIGWDAFGMPAENAAI-KHKSHPKKWTYDNI------
SYL_HELHP       VRNYCIGDALARNYRQNGYNVLHPMGWDAFGMPAENAAI-KHKTHPKTWTYSNI------
SYL_HELPY       VRNYTIGDALARYYRLHHYNVLHPMGFDSFGMPAENAAI-KHGIHPKTWTYENI------
SYL_HELPH       VRNYTIGDALARYYRLHHYNVLHPMGFDSFGMPAENAAI-KHGIHPKTWTYENI------
SYL_HELPJ       VRNYTIGDALARYYRLHHYNVLHPMGFDSFGMPAENAAI-KHGIHPKTWTYENI------
SYL_HELAH       VRNYTIGDALVRYYRLHHYNVLHPMGFDSFGMPAENAAI-KHGIHPKTWTYENI------
SYL_THEMA       VKNYVIGDIVARYKRMRGYNVLHPFGYDAFGLPAENAAI-EKGIHPEEWTRKNI------
SYL_THEP1       VKNYVIGDIVARYKRMRGYNVLHPFGYDAFGLPAENAAI-EKGIHPEEWTRKNI------
SYL_THEM4       VKNYVIGDIVARYKRMKGYNVLHPFGYDAFGLPAENAAI-KNKIHPEVWTFKNI------
SYL_FERNB       VKNYVIGDIVARYKRMQGYNVLHPFGYDAFGLPAENAAI-AHKIHPKKWTLDNI------
SYL_PSELT       VKNYVIGDAVARYKRMRAYNVLHPFGYDAFGLPAENAAI-ERKIHPKDWTLNNI------
SYL_CALS8       VRNYSIGDVFARFMRLKGYNVLHPMGWDAFGLPAENAAI-KHGIHPSDWTWSNI------
SYL_HUNT2       VRNYSIGDVVARFKRMNGFNVLHPMGWDAFGLPAENAAI-KRGVHPNDWTWSNI------
SYL_DESHY       VRNYSIVDVIARFKRMRGYNVLHPIGWDSFGLPAENAAI-KNQTPPAEWTWKNI------
SYL_SYNWW       VRNYAIGDVVARFKSMNGFNVLHPMGWDAFGLPAENAAI-KNAIHPATWTYSNI------
SYL_CARHZ       VRNYSIGDVVARYKRMRGYAVLHPMGWDAFGLPAENAAIKHGNVHPADWTWDNI------
SYL_PELTS       VRNYSIGDVVARFKTMQGYHVLHPMGWDAFGLPAENAAIKHGGVHPAEWTLDNI------
SYL_MOOTA       VRNYSIGDVVARVKRMRGYNVLHPMGWDAFGLPAENAAI-HRGIPPAEWTWSNI------
SYL_DESRM       VRNYSIGDVVARFKTMQGYDVLHPMGWDAFGLPAENAAI-KHGIAPATWTWDNI------
SYL_SYMTH       VRNYTIVDVIARYRRMKGYNVLHPMGFDSFGMPAENAAI-QHGANPAVWTRENI------
SYL_DESVH       VRNYSIGDVVARFKRMQGFNVLHPMGWDAFGLPAENAAI-KNGTHPAKWTFANI------
SYL_DESVV       VRNYSIGDVVARFKRMQGFNVLHPMGWDAFGLPAENAAI-KNGTHPAKWTFANI------
SYL_DESAG       VRNYSIGDVVARFKRMQGFNVLHPMGWDAFGLPAENAAI-KHDTHPAKWTYSNI------
SYL_LAWIP       VRNYSIGDVIARIKRMQGYNVLHPMGWDAFGLPAELAAI-KHHTQPADWTYTNI------
SYL_GEOMG       VRNYSIGDVVGRFKRLRGFNVLHPMGWDAFGMPAENAAI-QHKSHPAKWTYENI------
SYL_GEOSL       VRNYSIGDVVGRFKRMRGFNVLHPMGWDAFGMPAENAAI-KHGSHPAKWTYENI------
SYL_GEOUR       VRNYSIGDVIARFKRMKGFNVLHPMGWDAFGMPAENAAI-QNKSHPAKWTYENI------
SYL_PELPD       VRNYSIGDVIGRFKRMRGFNVLHPMGWDAFGMPAENAAI-QNKSHPAKWTYENI------
SYL_PELCD       VRNYSIGDVVARFKRLQGYNVLHPMGWDAFGMPAENAAI-QHKTHPGKWTYENI------
SYL_SYNAS       VRNYTIGDVVARYKRMEGYNVLHPMGWDSFGMPAENAAI-ERGIHPSLWTNENI------
SYL_SYNFM       VRNYSIGDVVARFLRMRGYNVLHPMGWDAFGMPAENAAI-KAKTHPARWTYENI------
SYL_DESPS       VRNYTIGDVVARYKRMRGFNVLHPMGWDAFGLPAENAAQ-KNNTHPSVWTYDNI------
SYL_FUSNN       ARNYTIGDVISRYKRMKGYNVLQPMGWDSFGLPAENAAI-QNGTHPAIWTKSNI------
SYL_TRIV2       VRNYTITDVIARLKRMQGYRVLHPMGWDAFGLPAENAAI-DRGVPPANWTYQNI------
SYL_NOSS1       VRNYTITDVIARLKRMQGYRVLHPMGWDAFGLPAENAAI-DRGVPPAKWTYQNI------
SYL_ACAM1       TRNYVITDVIARLKRMQGYRVLQPMGWDAFGLPAENAAI-ARGIHPAEWTYANM------
SYL_TRIEI       VRNYTITDVIARLKRMQGYRVLHPMGWDAFGLPAENAAI-DRGIPPAKWTLENI------
SYL_SYNY3       VRNYTITDVIARLKRMQGYQVLHPMGWDAFGLPAENAAI-ERGIPPKQWTEKNI------
SYL_SYNE7       VRNYTITDAIARVKRRQGFRVLHPMGWDAFGLPAENAAI-DRGVQPADWTYQNV------
SYL_SYNP6       VRNYTITDAIARVKRRQGFRVLHAMGWDAFGLPAENAAI-DRGVQPADWTYQNV------
SYL_THEEB       VRNYTITDVIARCRRMQGYRVLHPMGWDAFGLPAENAAI-ERGIHPRVWTQQNI------
SYL_SYNJB       VRNYTITDVIARHKRMQGYAVLHPMGWDAFGLPAENAAI-DRGIPPAKWTYQNI------
SYL_SYNJA       VRNYTITDVIARHKRMQGYAVLHPMGWDAFGLPAENAAI-DRGIPPAKWTYQNI------
SYL_GLOVI       VRNYSITDVISRYKRMRGFNVLHPIGWDAFGLPAENAAI-DRGIHPAQWTEQNI------
SYL_SYNS3       VRNYVITDVIARVQRMRGDAVLHPMGWDAFGLPAENAAI-ERKIEPGVWTDSNI------
SYL_SYNPW       VRNYVITDVIARAQRMRGDSVLHPMGWDAFGLPAENAAI-ERQVDPGVWTDRNI------
SYL_PROMM       VRNYVITDVIARVQRMRGDAVLHPMGWDAFGLPAENAAI-ARNVDPGDWTDQNI------
SYL_PROM3       VRNYVITDVIARVQRMRGDAVLHPMGWDAFGLPAENAAI-ARNVDPGDWTDQNI------
SYL_SYNSC       VRNYVITDVIARVQRMLGHAVLHPMGWDAFGLPAENAAI-ERNVDPGEWTDRNI------
SYL_SYNS9       VRNYVITDVIARVQRMRGDSVLHPMGWDAFGLPAENAAI-ERNIDPGEWTDRNI------
SYL_SYNPX       VRNYVITDVIARVQRMRGHSVLHPMGWDAFGLPAENAAI-ERNVDPGDWTDRNI------
SYL_SYNR3       VRNYVITDVIARLMRLKGKRVLHPMGWDAFGLPAENAAI-ERGVDPADWTDRNI------
SYL_PROMT       VRNYVITDVLARYKRMKGFNVLHPMGWDSFGLPAENAAI-EREISPSTWTDKNI------
SYL_PROM1       VRNYVITDVLARYKRMKGLNVLHPMGWDSFGLPAENAAI-ERETSPSTWTDKNI------
SYL_PROMA       VRNYVITDVIARLHRMKGDSVLHPMGWDAFGLPAENAAI-ERGIPADIWTYKNI------
SYL_PROM0       VRNYVITDLIARFQRFKGKSVLHPMGWDAFGLPAENAAI-ERGISPSVWTKKNI------
SYL_PROM9       VRNYVITDLIARFQRFKGKSVLHPMGWDAFGLPAENAAI-ERGISPSVWTKKNI------
SYL_PROMS       VRNYVITDLIARFQRFKGKSVLHPMGWDAFGLPAENAAI-ERGISPSVWTKKNI------
SYL_PROM2       VRNYVITDLIARFHRFKGKSVLHPMGWDAFGLPAENAAI-ERGISPSVWTKQNI------
SYL_PROMP       VRNYVITDLIARFQRFQGKVVLHPMGWDAFGLPAENAAI-ERGINPDKWTKQNI------
SYL_PROM5       VRNYVITDLIARFQRFQGKSLLHPMGWDAFGLPAENAAI-ERGINPNDWTKKNI------
SYL_SOLUE       IRNYSIGDALARYKWMRGFNVLHPMGWDAFGLPAENAAI-ANKVPPRQWTLQNI------
SYL_DEIRA       WYANVAPDARARWLRMRGYNVLFPMAFDAFGLPAENAAI-KNNTNPATWTYANI------
SYL_DEIGD       WYANVAPDAHARWMRMRGYNVFFPMGFDAFGLPAENAAI-KHGLNPATWTSSNI------
SYL_RUBXD       WYAMTPSDTRARFMRMRGYRVFFPIGFDAFGLPAENAAI-KRGIHPRDWTYSNI------
SYL_CLOPE       WFNYGPVDSWARFKRMQGYNVFQPMGFDAFGLPAENFAI-KTGIHPQDSTIKNI------
SYL_CLOPS       WFNYGPVDSWARFKRMQGYNVFQPMGFDAFGLPAENFAI-KTGIHPQDSTIKNI------
SYL_CLOP1       WFNYGPVDSWARFKRMQGYNVFQPMGFDAFGLPAENFAI-KTGIHPQDSTIKNI------
SYL_CLOB8       WFNYGPTDSWARLKRMQGYNVFQPMGFDAFGLPAENYAI-KTGIHPQDSTLKNI------
SYL_CLOB1       WFNYGPVDSWARFKRMQGYNVFQPMGFDAFGLPAENYAI-KTGIHPKDSTFKNI------
SYL_CLOBH       WFNYGPVDSWARFKRMQGYNVFQPMGFDAFGLPAENYAI-KTGIHPKDSTFKNI------
SYL_CLOBL       WFNYGPVDSWARFKRMQGYNVFQPMGFDAFGLPAENYAI-KTGIHPKDSTFKNI------
SYL_CLONN       WFNYGPTDSWARFKKMNGYNVFQPMGFDAFGLPAENFAI-KTGIHPQDSTMKNI------
SYL_CLOAB       WFNYAPVDSWARFKKMTGYNVFQPMGFDAFGLPAENYAI-KTGIHPKDSTLKNI------
SYL_CLOK5       WFNYAPVDSWARMKRMQGYNVFQPMGFDAFGLPAENYAI-KTGIHPKDSTEKNI------
SYL_CLOTE       WFNYGPSDSWARFKRMQGFNVFQPMGFDSFGLPAENYAI-KTGVHPKDSTMKNI------
SYL_CALS4       WYNYGPTDSWARMKRMQGYEVFHPMGFDAFGLPAENYAI-KTGIHPYDSTMENI------
SYL_ROSCS       LKNYVIGDALTRYYVIRGYDVLHPFGWDAFGLPAENAAI-KYGRHPREWTYGNI------
SYL_ROSS1       LKNYVIGDALTRYYVIRGYDVLHPFGWDAFGLPAENAAI-KYGRHPREWTYSNI------
SYL_THEFY       AEAFAIGDVIARYHFARGENVLHPIGWDSFGLPAENAAI-KHNFHPAEWTYTNI------
SYL_ACIC1       AEAFAIGDVVARYWFQRGYNVLHPIGWDAFGLPAENAAI-QRNLHPADWTYRNI------
SYL_ARTS2       AEAFAMGDVVARYLRQKGYDVLHPIGWDSFGLPAENAAI-KRNAHPSEWTYANI------
SYL_PAEAT       AEAFAMGDVVARYLRQKGFDVLHPIGWDSFGLPAENAAI-KRNAHPSEWTYANI------
SYL_RENSM       AEAFVMGDVVGRYWKLKGFDVLHPVGWDSFGLPAENAAI-KRNAHPAEWTYANI------
SYL_CLAMS       AEAFALGDAVARYWRQQGFNVLHPIGWDSFGLPAENAAI-KRGVDPREWTYANI------
SYL_CLAM3       AEAFALGDAVARYWRQQGFNVLHPIGWDSFGLPAENAAI-KRGVDPREWTYANI------
SYL_LEIXX       AEAYALGDVIARYWRHQGFSVLHPIGWDAFGLPAENAAI-KRGLDPRGWTYDNI------
SYL_KINRD       AEAYALGDVIARYWLQRGFDVMHPIGWDAFGLPAENAAI-KRGLDPRRWTYDNI------
SYL_NOCSJ       AEVTALHDVVARYWWQRGYEVLNPMGWDSFGLPAENAAI-RNDEHPATYTYANI------
SYL_TROW8       AETYAYGDFIARYWRHRGYNVLHPVGWDSFGLPAENAAI-KHGSDPKVWTYRNI------
SYL_TROWT       AETYAYGDFIARYWRHRGYNVLHPVGWDSFGLPAENAAI-KHGSDPKVWTYRNI------
SYL_MYCPA       PLGYIATDVYARYFRMTGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANV------
SYL_MYCA1       PLGYIATDVYARYFRMTGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANV------
SYL_MYCLE       PLGYIATDVYARYFRMTGHNVLHAMGFDAFGLPAEQYAM-QTGTHPRILTEANV------
SYL_MYCTA       PLGYIATDVYARYFRMVGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANV------
SYL_MYCBO       PLGYIATDVYARYFRMVGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANV------
SYL_MYCTU       PLGYIATDVYARYFRMVGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANV------
SYL_MYCBP       PLGYIATDVYARYFRMVGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANV------
SYL_MYCUA       PLGYIATDVFARYHRMKGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANV------
SYL_MYCSS       PLGYIATDVYARYYRMTGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANI------
SYL_MYCSK       PLGYIATDVYARYYRMTGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANI------
SYL_MYCSJ       PLGYIATDVYARYYRMTGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANI------
SYL_MYCS2       PLGYIATDVYARYYRMLGRNVLHALGFDAFGLPAEQYAV-QTGTHPRTRTEANI------
SYL_MYCVP       PLGYIATDVYARYYRMTGRNVLHALGFDAFGLPAEQYAI-QTGTHPRTRTEANI------
SYL_MYCGI       PLGYIATDVYARYYRMTGRNVLHALGFDAFGLPAEQYAI-QTGTHPRTRTEANI------
SYL_NOCFA       PLGYIATDVFARYHRMRGRNVLHALGYDAFGLPAEQYAV-QTGAHPRDTTESNI------
SYL_RHOJR       PLGYIATDVFARYHRMQGHNVLHTLGYDAFGLPAEQYAV-QTGTHPRTTTEANI------
SYL_SACEN       PLGFIGTDVYARFNRMLGKNVLHTMGFDSFGLPAEQYAV-QTGTHPRTTTEKNI------
SYL_CORGB       PLGYIATDVFARYNRMLGKNVLHTLGYDAFGLPAEQYAI-QTGTHPRTTTMANI------
SYL_CORGL       PLGYIATDVFARYNRMLGKNVLHTLGYDAFGLPAEQYAI-QTGTHPRTTTMANI------
SYL_COREF       PLGYIATDVFARYNRMLGKNVLHTLGYDAFGLPAEQYAI-QTGTHPRTTTMANI------
SYL_CORDI       PLGYIATDVFARFNRMLGKNVLHTLGYDAFGLPAEQYAI-QTGTHPRTTTMANI------
SYL_CORJK       PLGYIGTDVFARFHRMKGANVLHTLGYDAFGLPAEQYAV-QTGTHPRTTTMANI------
SYL_STRCO       PLGYIATDVFARFQRMTGHNVLHTLGFDAFGLPAEQYAV-QTGTHPRVSTEANM------
SYL_STRAW       PLGYIATDVFARFQRMTGHNVLHTLGFDAFGLPAEQYAV-QTGTHPRVSTEANI------
SYL_SALAI       PLGYIGTDCFARYQRMAGRNVLHAMGFDAFGLPAEQYAV-QTGTHPRTTTEANI------
SYL_BIFAA       PLGYLATDVVSRYHRMKGENVLHAMGYDAFGLPAEQYAV-QTGQHPRITTEQNI------
SYL_BIFLO       PLGYLASDVVSRYHRMKGENVLHAMGYDAFGLPAEQYAV-QTGQHPRVTTEANI------
SYL_FRACC       PLGYIGTDVFARYLRMSGRHVLHPFGYDSFGLPAEQYAI-NTGQHPRDTTNANI------
SYL_FRAAA       PLGYIGTDVFARYLRMSGRHVLHPFGYDAFGLPAEQYAI-NTGQHPRTTTDANI------
                       *   *         :   .:*.:*:.:*  *       .   .          

SYL_GEOKA       -----DNFRRQIKSLGFSYDWDREINTTDPNYYKWTQWIFLKLYE---------------
SYL_GEOTN       -----DNFRRQIKSLGFSYDWDREINTTDPNYYKWTQWIFLKLYE---------------
SYL_BACCZ       -----NTFRNQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLFE---------------
SYL_BACAH       -----NTFRNQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLFE---------------
SYL_BACAN       -----NTFRNQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLFE---------------
SYL_BACHK       -----NTFRNQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLFE---------------
SYL_BACC1       -----NTFRNQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLFE---------------
SYL_BACCR       -----NTFRNQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLFE---------------
SYL_BACCN       -----NTFRNQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLFE---------------
SYL_BACSU       -----DNFRRQIQALGFSYDWDREINTTDPEYYKWTQWIFLKLYE---------------
SYL_BACVZ       -----DNFRRQIQSLGFSYDWDREINTTDPDYYKWTQWIFTKLYE---------------
SYL_BACLD       -----DNFRRQIRALGFSYDWDREVNTTDPDYYKWTQWIFLKLYE---------------
SYL_BACP2       -----NNFRRQIQSLGFSYDWDREINTTDPNYYKWTQWIFLKLYE---------------
SYL_BACHD       -----NTFRRQIKSLGFSYDWDREVNTTDPDYYKWTQWIFIQLYN---------------
SYL_BACSK       -----DTFKRQIKELGFSYDWDREISTTDPHYYKWTQWIFLKLYE---------------
SYL_OCEIH       -----NTFKRQIKELGFSYDWDREINTTDPNYYKWTQWIFKKLYE---------------
SYL_STAES       -----QTFKRQIQELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAEQ       -----QTFKRQIQELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAW       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAS       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAN       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAA1       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAM       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAA9       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAA2       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAA3       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAC       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAA8       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAT       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAE       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAB       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAAR       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAHJ       -----QTFKRQIQELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_STAS1       -----QTFKRQIKELGFSYDWDREVNTTDPEYYKWTQWIFIQLYN---------------
SYL_LISMF       -----ANFTRQIKSLGFSYDWDREINTTDPEYYKWTQWIFEKLYE---------------
SYL_LISMO       -----ANFTRQIKSLGFSYDWDREINTTDPEYYKWTQWIFEKLYE---------------
SYL_LISIN       -----ANFTRQIKSLGFSYDWDREINTTDPEYYKWTQWIFEKLYE---------------
SYL_LISW6       -----ANFTRQIKSLGFSYDWDREINTTDPEYYKWTQWIFEKLYE---------------
SYL_ENTFA       -----ETFRRQINSLGFSYDWNREINTTDPEYYKWTQWIFTKLYE---------------
SYL_STRTD       -----ANFKRQINALGFSYDWDREINTTDPNYYKWTQWIFTKLYE---------------
SYL_STRT2       -----ANFKRQINALGFSYDWDREINTTDPNYYKWTQWIFTKLYE---------------
SYL_STRT1       -----ANFKRQINALGFSYDWDREINTTDPNYYKWTQWIFTKLYE---------------
SYL_STRP2       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRR6       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRPN       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRSV       -----ANFKRQINALGFSYDWDREINTTDPNYYKWTQWIFTKLYE---------------
SYL_STRGC       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRS2       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRSY       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRPD       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRPG       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRP6       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRPM       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRPF       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRPB       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRPC       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRP3       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRP1       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRP8       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRA3       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRA5       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRA1       -----ANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYE---------------
SYL_STRMU       -----ATFKRQIKSLGFSYDWDREINTTDPNYYKWTQWIFTKLYE---------------
SYL_LACLM       -----ANFKRQINSLGFSYDWEREVNTTDPNFYKWTQWIFTKLYE---------------
SYL_LACLA       -----ANFKRQINSLGFSYDWEREVNTTDPNFYKWTQWIFTKLYE---------------
SYL_LACLS       -----ANFKRQINSLGFSYDWEREVNTTDPNFYKWTQWIFTKLYE---------------
SYL_LACSS       -----NTFKRQINSLGFSYDWDREVNTTDPDFYKWTQWIFEKMYE---------------
SYL_LACDA       -----AHFKKQLQALGFSYDWDREIKTTDPNYYKWTQWIFEQMYK---------------
SYL_LACDB       -----AHFKKQLQALGFSYDWDREIKTTDPNYYKWTQWIFEQMYK---------------
SYL_LACP3       -----ETFKRQINSLGFSYDWNREINTTDPNYYKWTQWIFEQLYK---------------
SYL_LACPL       -----KNFKRQIRSLGFSYDWDREVNTTDPSYYKWTQWIFEQLYK---------------
SYL_LACBA       -----KNFKRQIRSLGFSYDWSREINTTDESYYKWTQWIFEQLYK---------------
SYL_PEDPA       -----QNFKRQIQSLGFSYDWSREVNTTDPAYYKWTQWIFEQLYK---------------
SYL_LACS1       -----NNFRRQIKSLGLSYDWDREVNTTDPAYYKWTQWIFEQLYK---------------
SYL_LACRD       -----DHFRDQIQSLGFSYDWDREVNTTDPKFYKWTQWIFEQLYK---------------
SYL_LEUMM       -----QVFKNQIKSLGFSIDWSREINTTDPEYYKWSQWIFEKLYE---------------
SYL_OENOB       -----KHFKKQVKSLGFSYDWDREINTTDPEYYKWTQWIFEQLYK---------------
SYL_SALRD       -----AQFKRQLKRLGFSYDWQREINTTDPDYYKWTQWIFLQLYE---------------
SYL1_RHIL3      -----ETFRGQVQRLGFSYDWSREFATTDPAYVRWTQWIFLKLFE---------------
SYL_RHOBA       -----DNFTRQLKMLGFSYDWDRVLATTDEEYFRWTQWIFGVLYDTWFDHDQQKGRPISE
SYL_PELLD       -----RSFRETLQAMGFSYDWSREINTTDPGYFRWTQWIFLKLY----------------
SYL_CHLPM       -----ANFKETLQAMGFSYDWSREINTTDPGYFQWTQWIFLKLH----------------
SYL_CHLCH       -----KNFKGTLQAMGFSYDWEREINTTDSGYFKWTQWIFLQLY----------------
SYL_CHLTE       -----ASFRETLKSMGFSYDWSREINTTDPNYFKWTQWIFLKLY----------------
SYL_CHLPD       -----SSFRETLQAMGFSYDWSREINTTSPDYFRWTQWIFIKLY----------------
SYL_LEPBL       -----DNFRRQIQMIGLSYDWSRELSTTDPDYYKFTQWIFIQLYQSWFNPELKKAESIET
SYL_LEPBJ       -----DNFRRQIQMIGLSYDWSRELSTTDPDYYKFTQWIFIQLYQSWFNPELKKAESIET
SYL_LEPIC       -----DNFRRQIQMIGLSYDWSRELSTTDPDYYKFTQWIFIQLYQSWFNPELKKAESINE
SYL_LEPIN       -----DNFRRQIQMIGLSYDWSRELSTTDPDYYKFTQWIFIQLYQSWFNPELKKAESINE
SYL_BACTN       -----DRYREQLDKIGFSFDWSREIRTCEPEYYHWTQWAFQKMFNSYYCNDEQQARPIQE
SYL_BACV8       -----NRYREQLDKIGFSFDWNREVRTCEPGYYHWTQWAFQQMFNSYYCNDTQQARPISE
SYL_BACFR       -----NRYREQLDKIGFSFDWNREIRTCDPEYYHWTQWAFIKMFNSYYCNDEKQARPIEE
SYL_BACFN       -----NRYREQLDKIGFSFDWNREIRTCDPEYYHWTQWAFIKMFNSYYCNDEKQARPIEE
SYL_PARD8       -----ARYREQLEKIGFCYDWSREIRTCDPEYYKWTQWAFIRMFNSYYCNDEKQARPISE
SYL_PORGI       -----ARYREQLDKIGFSYDWEREIRTCDPNYYKWTQWAFLKMFDSYYCNQAQQARPISE
SYL_FLAPJ       -----ARYREQLDKIGFSFDWSREIRTSNANYYKHTQWIFIQLFNSWYNKSNDKAEDITT
SYL_FLAJ1       EGKQIAGYRKQLDKIGFSFDWAREVRTSNPDYYKHTQWIFIQLFNSWYCRKQGKAFDISE
SYL_GRAFK       -----ARYREQLDKIGFSFDWSREVRTSEPDYYKWTQWIFIQLFESWYDQEAEKSRAITE
SYL_CYTH3       -----ARYIEQLNKIGFSFDWDREIRTSDPAYYKWTQWIFIQLFNHWYNKASDKAEPITN
SYL_BDEBA       -----DSFRKTLQTFGFSFDWSREISTCEPDYYKWTQFIFLKLYER--------------
SYL_SORC5       -----ATFKRQLKMLGFSYDWSRELSTTDPRYVRWTQWIFLQLFK---------------
SYL_TREDE       -----ETFRKQIKSIGLSYDWDREISTSEESYYKWTQWIFLQLFK---------------
SYL_TREPA       -----DTFRRQIQSFGFSYDWEREISTADPEYYRWTQWLFLKLYE---------------
SYL_BORAP       -----NKFKKQIKALGFAYDWDREIRTHDENYYKWTQWIFLQLYK---------------
SYL_BORBP       -----NKFKKQIKALGFAYDWDREIRTHDENYYKWTQWIFLELYK---------------
SYL_BORBU       -----NKFKKQIKALGFAYDWDREIRTHEENYYKWTQWIFLQLYK---------------
SYL_CHLTR       -----ANFKKQLTAMGFSYDESREFATSDPEYYKWTQKLFLILYE---------------
SYL_CHLTA       -----ANFKKQLTAMGFSYDESREFATSDPEYYKWTQKLFLILYE---------------
SYL_CHLMU       -----ANFKQQLTSMGFSYDESREFATSDPEYYKWTQKLFLILYE---------------
SYL_CHLFF       -----ENFRKQLSAMGFSYDEGREFATSDPEYYRWTQKLFLLLYE---------------
SYL_CHLCV       -----ENFRKQLSAMGFSYDEGREFATSDPDYYRWTQKLFLFLYE---------------
SYL_CHLAB       -----ENFRKQLSAMGFSYDEAREFATSDPEYYRWTQKLFLFLYE---------------
SYL_CHLPN       -----ANFKKQLSAMGFSYDEGREFATSDPDYYHWTQKLFLFLYD---------------
SYL_PARUW       -----NNYRRQLRALGFSYDWNRELATSDPNYYKWTQWIFTKLYE---------------
SYL_ALKOO       -----ARFKKQLQGLGMSFDWSREINTTDPEYYKWTQWIFLKLFE---------------
SYL_UREP2       -----KIFRKQLQMIGFDFDYDKEVDTTDPQFYQWTQWIFVQLYK---------------
SYL_UREPA       -----KIFRKQLQMIGFDFDYDKEVDTTDPQFYQWTQWIFVQLYK---------------
SYL_MYCPU       -----ATFKKQIKSLGLSYDFDKEVNTTDPKFYEQTQWIFKELYK---------------
SYL_MYCPE       -----NNFKLQIDQLGFWFDWNKEVNTTDPNFYKWTQWIFIKLFE---------------
SYL_MYCGA       -----NNFRTQLKRLGFNYDYRLEVDTTNKNYFKWTQWIFKKLYE---------------
SYL_MYCGE       -----NNFINQLTSFGFDYDYHLSLKTTDPRYYKYTQWIFSELFK---------------
SYL_MYCPN       -----TNFIEQLTAFGFDYDYQLSLKTTDPRYYQYTQWIFGQLFE---------------
SYL_MYCCT       -----ENFKAQLVKMGFSYDYDKEINTADPNYYKVTQWIFKELYK---------------
SYL_MYCMS       -----ENFKIQLNKMGFSYDYDKEINTADPNYYKTTQWIFKQLYK---------------
SYL_MESFL       -----KTFKRQLKMMGFSYDFDKEISTANPNYYKITQWIFNQLYK---------------
SYL_ACHLI       -----SNFKRQIIEMGKGVDWDKELATTDPEYFKWTQWIFKRLYE---------------
SYL_PSEA6       -----DYMKNQLKSLGFGYDWDREVATCKKDYYRWEQWFFTRLYE---------------
SYL_COLP3       -----DYMRNQLQSLGFGYDWGRELATCKPDYYRWEQWFFTQLFE---------------
SYL_IDILO       -----DYMREQLKSLGFGYDWNRELATCSPDYYRWEQWFFTKLYE---------------
SYL_PSEHT       -----DYMRTQLKQLGFGYDWDREIATCHPEYYKWEQWFFTKLYE---------------
SYL_PSYIN       -----AYMKTQLKQLGFGYDWSRELATCQPEYYRWEQWFFTKLVE---------------
SYL_SALCH       -----AYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYK---------------
SYL_SALTI       -----AYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYK---------------
SYL_SALTY       -----AYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYK---------------
SYL_SALPB       -----AYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYK---------------
SYL_SALPA       -----AYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYK---------------
SYL_CITK8       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_SALAR       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_SHIFL       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_SHIF8       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_SHIBS       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECOL6       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECOL5       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECO57       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_SHISS       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECOLI       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECOLC       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_SHIDS       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECOHS       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECOUT       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECOK1       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_ECO24       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_KLEP7       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_CROS8       -----NYMKNQLKMLGFGYDWSRELATCTPEYYRWEQQFFTELYK---------------
SYL_ENT38       -----AYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYK---------------
SYL_YERPA       -----EYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYE---------------
SYL_YERP3       -----EYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYE---------------
SYL_YERPE       -----EYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYE---------------
SYL_YERPN       -----EYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYE---------------
SYL_YERPS       -----EYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYE---------------
SYL_YERPP       -----EYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYE---------------
SYL_YERE8       -----EYMKNQLKLLGFGYDWDREIATCSPDYYRWEQWFFTKLYE---------------
SYL_SERP5       -----EYMKNQLKLLGFGYDWDREIATCDPDYYRWEQWFFTKLYE---------------
SYL_PECAS       -----DYMKNQLKLLGFGYDWDREIATCKPDYYRWEQWFFTKLYE---------------
SYL_SODGM       -----DYMKNQLKLLGFGYDWSREVTTCRPDYYRWEQWFFTRLYE---------------
SYL_PHOLL       -----EYMKGQLKTLGFGYDWDREVTTCTPEYYHWEQWFFTKLYE---------------
SYL_MANSM       -----DYMKNQLKMLGFSYDWDREIATCKPEYYKWEQWFFTELYK---------------
SYL_ACTSZ       -----EYMKNQLKVLGFSYDWEREVTTCRPEYYKWEQWFFTELYK---------------
SYL_HAES1       -----EYMKNQLKVLGFGFDWDREITTCKPEYYKWEQWFFTELYK---------------
SYL_HISS2       -----EYMKNQLKVLGFGFDWDREITTCKPEYYKWEQWFFTELYK---------------
SYL_PASMU       -----DYMKNQLKILGFGFDWDREVTTCKPDYYKWEQWFFTELYK---------------
SYL_HAEIG       -----AYMKKQLQLLGFGFDWDREIATCKPEYYKWEQWFFTELYK---------------
SYL_HAEIN       -----AYMKKQLQLLGFGFDWDREIATCKPEYYKWEQWFFTELYK---------------
SYL_HAEI8       -----AYMKKQLQLLGFGFDWDREIATCKPEYYKWEQWFFTELYK---------------
SYL_HAEIE       -----AYMKKQLQLLGFGFDWDREIATCKPDYYKWEQWFFTELYK---------------
SYL_ACTP2       -----EYMKGQLKMLGFSYDWDREVTTCRPEYYKWEQWFFTELYK---------------
SYL_HAEDU       -----EYMKNQLKVLGFSYDWDREITTCRPEYYKWEQWFFTELYK---------------
SYL_SHESA       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHESM       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHESR       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEON       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEB9       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEB5       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEB8       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHESW       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEPC       -----EYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEAM       -----DYMKNQLKMLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEHH       -----DYMKNQLKMLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEPA       -----DYMKNQLKMLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHELP       -----DYMKNQLKMLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHESH       -----DYMKNQLKMLGFGYDWSREIATCTPEYYRWEQWFFTKLFE---------------
SYL_SHEDO       -----DYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTKLYE---------------
SYL_SHEFN       -----DYMKNQLKLLGFGYDWSREIATCTPEYYRWEQWFFTQLYA---------------
SYL_VIBPA       -----EYMKNQLKLLGFGYDWNREFATCTPEYYRWEQEFFTKLYE---------------
SYL_VIBCB       -----EYMKNQLKLLGFGYDWNREFATCTPEYYRWEQEFFTKLYE---------------
SYL_VIBVU       -----EYMKNQLKLLGFGYDWNREFATCTPEYYRWEQEFFTKLYE---------------
SYL_VIBVY       -----EYMKNQLKLLGFGYDWNREFATCTPEYYRWEQEFFTKLYQ---------------
SYL_VIBCH       -----EYMKNQLKLLGFGYDWNREFATCRPEYYRWEQEFFTKLFA---------------
SYL_VIBC3       -----EYMKNQLKLLGFGYDWNREFATCRPEYYRWEQEFFTKLFA---------------
SYL_ALIF1       -----EYMKNQLKLLGFGYDWNREFATCTPEYYRWEQEFFTKLYN---------------
SYL_PHOPR       -----EYMKNQLKLLGFGYDWSREFATCTPEYYRWEQEFFTKLYN---------------
SYL_AERS4       -----EYMKNQLKMLGLGYDWDRELATCKPDYYRWEQWFFTKLYE---------------
SYL_AERHH       -----EYMKNQLKMLGLGYDWDRELATCKPDYYRWEQWFFTKLYE---------------
SYL_MARHV       -----DYMKNQLKQLGFGYDWSRELATCDPEYYRWEQWFFARLYE---------------
SYL_HAHCH       -----AYMKNQLKLLGFGYDWNRELATCRPEYYKWEQWFFTRLYE---------------
SYL_SACD2       -----DYMRKQLTELGFGFDWSREVTTCKPDYYKWEQWFFTRLYE---------------
SYL_MARMS       -----AYMKGQLKELGFGYDWDREIATCTPEYYKWEQWFFTQLVE---------------
SYL_ALCBS       -----DYMRGQLQRLGFGYDWGRELATCTPEYYRWEQWFFTKLYE---------------
SYL_PSEAB       -----AYMKSQLDSLGLAIDWSREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEAE       -----AYMKSQLDSLGLAIDWSREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEA7       -----AYMKSQLDSLGLAIDWTREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEU5       -----AYMKAQLKSLGLAIDWSREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEMY       -----AYMKSQLKSLGLAIDWTREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEP1       -----DYMKTQLKSLGLAIDWAREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEPK       -----DYMKTQLKSLGLAIDWAREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEPG       -----DYMKTQLKSLGLAIDWAREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEE4       -----DYMKTQLKSLGLAIDWSREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSEU2       -----DYMKTQLKSLGLAVDWSREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSE14       -----AYMKNQLKSLGLAVDWSREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_PSESM       -----AYMKNQLKSLGLAVDWSREVTTCKPDYYRWEQWLFTRLFE---------------
SYL_NEIMB       -----EYMKTQLKSLGFAIDWARETATCKPEYYRWEQWLFTKLFE---------------
SYL_NEIMF       -----EYMKTQLKSLGFAIDWARETATCKPEYYRWEQWLFTKLFE---------------
SYL_NEIG1       -----EYMKTQLKSLGFAIDWEREVATCKPEYYRWEQWLFTKLFE---------------
SYL_NEIM0       -----EYMKTQLKSLGFAIDWARETATCKPEYYRWEQWLFTKLFE---------------
SYL_NEIMA       -----EYMKTQLKSLGFAIDWARETATCKPEYYRWEQWLFTKLFE---------------
SYL_CHRVO       -----EYMKTQLDSLGFALDWERELATCKPDYYRWEQWLFTRLFE---------------
SYL_THIDA       -----DHMRTQLQALGFAIDWSRELATCKPDYYRWEQWLFTRLFE---------------
SYL_DECAR       -----DYMRQQLKSLGFAIDWEREFATCTPEYYRWEQWLFTRLYE---------------
SYL_AZOSB       -----DYMKGQLKRLGFAIDWSREVATCTPEYYRWEQWLFTRLFE---------------
SYL_CUPMC       -----AYMKKQMQSMGLAIDWSREVATCSPEYYRWNQWLFLKMLE---------------
SYL_CUPPJ       -----AYMKKQMQSMGLAIDWSREVATCSPDYYRWNQWLFLKMLE---------------
SYL_RALSO       -----AYMKKQMQSMGLAIDWSREVATCSPDYYKWNQWLFLKMLE---------------
SYL_JANMA       -----DYMKTQMASMGLAIDWSREMTACRPEYYKWNQWMFLKMLE---------------
SYL_HERAR       -----EHMKTQMASMGLAIDWSREMTACKPEYYKWNQWMFLKMLE---------------
SYL_BURCH       -----DYMKGQMQSMGLAIDWSREIATCKPDYYKWNQWLFLKMLE---------------
SYL_BURCA       -----DYMKGQMQSMGLAIDWSREIATCKPDYYKWNQWLFLKMLE---------------
SYL_BURL3       -----DYMKGQMQSMGLAIDWSREIATCKPDYYKWNQWLFLKMLE---------------
SYL_BURCM       -----DYMKGQMQSMGLAIDWSREIATCKPDYYKWNQWLFLKMLE---------------
SYL_BURVG       -----DYMKGQMQSMGLAIDWSREIATCKPDYYKWNQWLFLKMLE---------------
SYL_BURP0       -----AYMKKQMQSMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURPS       -----AYMKKQMQSMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURP6       -----AYMKKQMQSMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURP1       -----AYMKKQMQSMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURM7       -----AYMKKQMQAMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURM9       -----AYMKKQMQAMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURMA       -----AYMKKQMQAMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURMS       -----AYMKKQMQAMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_BURTA       -----AYMKKQMQSMGLAIDWSREVTTCKPDYYKWNQWLFLKMLE---------------
SYL_PARXL       -----AYMKKQMQSMGLAIDWSREVATCSPDYYKWNQWLFLKMLE---------------
SYL_POLAQ       -----AYMKKQMAAMGLAIDWSREVATCSPDYYRWNQWLFLKMLE---------------
SYL_BORBR       -----AYMKKQMKAMGLAIDWSREMCACDPKYYKWNQWLFLKMLE---------------
SYL_BORPA       -----AYMKKQMKAMGLAIDWSREMCACDPKYYKWNQWLFLKMLE---------------
SYL_BORPE       -----AYMKKQMKAMGLAIDWSREMCACDPKYYKWNQWLFLKMLE---------------
SYL_BORPD       -----AYMKKQMQAMGLAIDWSREMCACDPEYYKWNQWLFLKMLE---------------
SYL_BORA1       -----AYMKKQMKAMGLAIDWSREMCACDPAYYKWNQWLFLKMLE---------------
SYL_METPP       -----ADMKSQMQPLGLAFDWSREVATCDPDYYKWNQWFFLKLLE---------------
SYL_ACISJ       -----AYMKKQMQAMGLAIDWSREIATCDPDYYKWNQWLFLKMLD---------------
SYL_ACIAC       -----AYMKKQMQAMGLAIDWSREVATCDPDYYKWNQWLFLKMLE---------------
SYL_RHOFT       -----AYMKQQMQAMGLAIDWSREVATCDPSYYKWNQWLFLKMLD---------------
SYL_VEREI       -----AYMKQQMQALGLAIDWSRELATCDPGYYKWNQWLFLKMLD---------------
SYL_POLNA       -----AYMKKQMQAMGLAVDWSREIATCDPSYYKWNQWLFLKMLE---------------
SYL_POLSJ       -----AYMKKQMQAMGLAIDWSREVATCDPSYYKWNQWLFLKMLE---------------
SYL_METCA       -----DYMRKQLKSLGLAVDWDREIATCKPEYYRWEQWLFTRLFE---------------
SYL_DICNV       -----AEMKKQLQSLGFAIDWSREITTCRPDYYRWEQWLFTRLYQ---------------
SYL_PSYCK       -----DSMRAQLKLLGLSIDWSREFATCSPEYYQWEQWLFLQLYK---------------
SYL_PSYA2       -----DSMRAQLKLLGLSIDWSREFATCSPEYYQWEQWLFLQLYK---------------
SYL_PSYWF       -----DNMRAQLKTLGLSIDWSREFATCTPEYYRWEQWFFLQLYK---------------
SYL_ACIAD       -----AYMRDQLKKLGLSIDWDREFATCTPEYYHWEQWLFVQLYK---------------
SYL_NITEU       -----AYMRSQLQSLGFAIDWQRELATCDPQYYRWNQWLFLRMLE---------------
SYL_NITEC       -----AYMRSQLQSLGLAIDWKRELATCDPEYYRWNQWLFLRMLE---------------
SYL_NITMU       -----AYMRKQLQSLGLAMDWDRELATCQPDYYRWNQWLFLRMLE---------------
SYL_METFK       -----EHMKGQLKSLGLAVDWQREIATCKPDYYRWEQWLFTELYK---------------
SYL_HYDCU       -----DYMRNQLKRLGLGYDWTREVATCHPEYYRWEQWLFTRLME---------------
SYL_XYLFA       -----ERMRTQLKSLGYAIDWSREFATCQPDYYVHEQHMFTRLMR---------------
SYL_XYLFT       -----ERMRTQLKSLGYAINWSREFATCQPDYYVHEQHMFTRLMR---------------
SYL_XANC8       -----EHMRAQLKSLGYAIDWSREFATCTPDYYVHEQRMFTRLMR---------------
SYL_XANCP       -----EHMRAQLKSLGYAIDWSREFATCTPDYYVHEQRMFTRLMR---------------
SYL_XANCB       -----EHMRAQLKSLGYAIDWSREFATCTPDYYVHEQRMFTRLMR---------------
SYL_XANC5       -----EHMRAQLKSLGYAIDWSREFATCTPDYYVHEQRMFTRLMR---------------
SYL_XANAC       -----EHMRAQLKSLGYAIDWSREFATCTPDYYVHEQRMFTRLMR---------------
SYL_XANOR       -----AHMRAQLKSLGYAIDWSREFATCTPDYYVHEQRMFTRLMR---------------
SYL_XANOM       -----AHMRAQLKSLGYAIDWSREFATCTPDYYVHEQRMFTRLMR---------------
SYL_NITOC       -----DHMRRQLKRLGFAYDWSRELATCQPDYYRWEQWLFTKLFA---------------
SYL_ALKEH       -----ETMRGQLQRLGFAYDWDREFATCDPEYYRWEQWLFTRLYK---------------
SYL_HALHL       -----GAMREQLKGLGFGYDWSRELATCDPEYYRWEQWLFIRLYR---------------
SYL_CHRSD       -----DAMRRQLKALGFAYDWNREFATCDVDYYRWEQWFFTKLVE---------------
SYL_BUCAI       -----KYMKKQLQSLGFSYDWSREITTCHPEYYHWEQWFFTKLYE---------------
SYL_BUCAP       -----KYMKKQLQSLGFSYDWSREITTCKPDYYCWEQWFFIQLYK---------------
SYL_BUCCC       -----KTMKKQLQSLGFSYDWNKEITTCNPEYYRWEQLFFIKLFK---------------
SYL_BUCBP       -----KYMKQQLISLGLSYDWDREITTCKPEYYQWEQWFFIELYK---------------
SYL_WIGBR       -----EYMKNQLKLLGCSYDWSREIITCDPKYYKWEQLLFTKLYN---------------
SYL_BLOPB       -----NYMKSQLQSLGFAYDWNRELITCHPDYYRWEQWFFTVLYK---------------
SYL_BLOFL       -----QYMKQQLKSLGFAYDWKRELITNDPQYYRWEQWFFIILYE---------------
SYL_BAUCH       -----ETMKKQLKQLGFSYDWSREITTCRPEYYRWEQWFFIQLYE---------------
SYL_COXBU       -----KKMRKQLKQLGFAYDWSREITTCDSTYYRWEQWLFLQLYK---------------
SYL_COXBR       -----KKMRKQLKQLGFAYDWSREITTCDSTYYRWEQWLFLQLYK---------------
SYL_COXBN       -----KKMRKQLKQLGFAYDWSREITTCDSTYYRWEQWLFLQLYK---------------
SYL_LEGPH       -----AAMKEQFLRLGNAYDWKREITTCDPEYYRWEQWFFIRLFE---------------
SYL_LEGPC       -----AAMKEQFLRLGNAYDWKRELTTCDPEYYRWEQWFFIRLFE---------------
SYL_LEGPA       -----AAMKEQFLRLGNAYDWKREITTCDPEYYRWEQWFFIRLFE---------------
SYL_LEGPL       -----AAMKEQFLRLGNAYDWKREITTCDPEYYRWEQWFFIRLFE---------------
SYL_FRATT       -----AYMRSQFDSLGFSFDWSREITTCDEDYYKWEQWFFIQLYK---------------
SYL_FRAT1       -----AYMRSQFDSLGFSFDWSREITTCDEDYYKWEQWFFIQLYK---------------
SYL_FRATW       -----AYMRSQFDSLGFSFDWSREIATCDEDYYKWEQWFFIQLYK---------------
SYL_FRATF       -----AYMRSQFDSLGFSFDWSREIATCDEDYYKWEQWFFIQLYK---------------
SYL_FRATH       -----AYMRSQFDSLGFSFDWSREIATCDEDYYKWEQWFFIQLYK---------------
SYL_FRATO       -----AYMRSQFDSLGFSFDWSREIATCDEDYYKWEQWFFIQLYK---------------
SYL_FRATN       -----AYMRSQLDSLGFSFDWSREIATCDEDYYKWEQWFFIQLYK---------------
SYL_FRAP2       -----AYMRSQLDSLGFSFDWSREVATCDESYYKWEQWFFIQLYK---------------
SYL_RUTMC       -----DYMRDQLSKLGFGYDWSREIATCHQKYYRWEQWLFIKLFE---------------
SYL_VESOH       -----NYMKTQLNQLGFGYDWAREITTCHPKYYRWEQWLFIKLFK---------------
SYL_RICRS       -----KNMKKQLKSMGFSYDWSREINSCDPEYYKHEQKFFLELYE---------------
SYL_RICRO       -----KNMKKQLKSMGFSYDWSREINSCDPEYYKHEQKFFLELYE---------------
SYL_RICCN       -----KNMKKQLKSMGFSYDWSREINSCDPEYYKHEQKFFLELYE---------------
SYL_RICM5       -----ENMKKQLKSMGFSYDWSREINSCDPEYYKHEQKFFLELYE---------------
SYL_RICFE       -----ENMKKQLKSMGFSYDWSREINSCDPQYYKHEQKFFLELYE---------------
SYL_RICAH       -----ENMKKQLKSMGFSYAWSREINSCDPQYYKHEQKFFLELYE---------------
SYL_RICCK       -----DNMQQQLKSMGFAYDWSRVINSCDPQYYKYEQKFFLELYE---------------
SYL_RICBR       -----ENMKKQLKSMGFSYDWSREINSCDPDYYKHEQKFFLELYE---------------
SYL_RICPR       -----EYMKKQLQSMGFAYDWTREINSCDPEYYKHEQKFFLELYD---------------
SYL_RICTY       -----EYMKKQLQSMGFSYDWTREINSCDPQYYKHEQKFFLELYD---------------
SYL_ORITB       -----DVMRQQLKAIGLSYDWSREIITCSSQYYVHEQRFFLEMLK---------------
SYL_WOLPM       -----DNMRTQLKSIGLSYNWERELSTCEPDYYKHEQKFFLDFLK---------------
SYL_WOLTR       -----DNMRAQLKSIGLSYNWERELSTCEADYYKHEQKFFLDFLK---------------
SYL_EHRRW       -----DNMRSQLKSIGLSYNWDKEFATCDAEYYKYEQEFFLDFLK---------------
SYL_EHRRG       -----DNMRSQLKSIGLSYNWDKEFATCDAEYYKYEQEFFLDFLK---------------
SYL_EHRCJ       -----DNMRCQLKSIGLSYDWNKELATCDADYYKHEQAFFLDFLK---------------
SYL_EHRCR       -----DNMRCQLKSIGLSYDWDKELATCDPSYYKHEQAFFLDFLK---------------
SYL_ANAMM       -----ESMRKQLKSIGISYNWDRELATCKEDYYKHEQAFFLDFLQ---------------
SYL_NEOSM       -----AKMRTSLKSIGLSYDWSRELSTCSPKYYEHEQKFFLAFLK---------------
SYL2_RHIL3      -----GSMKAQLKAMGLSLDWSREFATCDVEYYQHQQHLFLDFLE---------------
SYL_RHIEC       -----ASMKAQLKAMGLSLDWSREFATCDVDYYQHQQHLFLDFLE---------------
SYL_RHIME       -----ASMKAQLKVMGLSLDWSREFATCDPEYYQRQQHLFLDFLE---------------
SYL_SINMW       -----ASMKAQLKVMGLSLDWSREFATCDPEYYQRQQHLFLDFLE---------------
SYL_AGRFC       -----ATMRGQLKSMGLSLDWTREFATCDVEYYHRQQALFVDFME---------------
SYL_BRUAB       -----ATMKRQLKSMGLSLDWSREFATCDVEYYHRQQMLFIDLYE---------------
SYL_BRUA2       -----ATMKRQLKSMGLSLDWSREFATCDVEYYHRQQMLFIDLYE---------------
SYL_BRUSI       -----ATMKRQLKSMGLSLDWSREFATCDVEYYHRQQMLFIDLYE---------------
SYL_BRUO2       -----ATMKRQLKSMGLSLDWSREFATCDVEYYHRQQMLFIDLYE---------------
SYL_BRUME       -----ATMKRQLKSMGLSLDWSREFATCDVEYYHRQQMLFIDLYE---------------
SYL_BRUSU       -----ATMKRQLKSMGLSLDWSREFATCDVEYYHRQQMLFIDLYE---------------
SYL_BRUC2       -----ATMKRQLKSMGLSLDWSREFATCDVEYYHRQQMLFIDLYE---------------
SYL_OCHA4       -----ATMRSQLKSMGLSLDWAREFATCDVEYYHRQQMLFIDLFE---------------
SYL_CHESB       -----ATMRSQLKMMGLSLDWAREFATCDVDYYHRQQMLFIDFYK---------------
SYL_RHILO       -----ATMREQLKVMGLSLDWAREFATCDVDYYHRQQMLFLDFVE---------------
SYL_BART1       -----AVMRGQLKQLGLSLDWAREFATCDVDYYHRQQMLFLDFYQ---------------
SYL_BARHE       -----AVMRGQLKQLGLSVDWSREFATCDVDYYHRQQMLFLDFYQ---------------
SYL_BARQU       -----AVMRGQLKQLGLSLDWSREFATCDVAYYHRQQMLFLDLYQ---------------
SYL_BARBK       -----AAMRKQLQKLGLSIDWSREFATCDVDYYHRQQMIFLDLYQ---------------
SYL_RHOP2       -----ASMKKQLQTMGLSLDWAREFATCDPTYYKHQQKMFLDFLK---------------
SYL_RHOPS       -----AAMKKQLQTMGLSLDWAREFATCDPTYYKHQQKMFLDFLK---------------
SYL_RHOPA       -----AAMKKQLQTMGLSLDWAREFATCDPSYYKHQQKMFLDFLK---------------
SYL_RHOP5       -----AAMKKQLQTMGLSLDWAREFATCDPSYYKHQQKMFLDFLK---------------
SYL_NITHX       -----KAMKKQLRSIGLSLDWAREFATCDPSYYKHQQKMFLDFLR---------------
SYL_NITWN       -----KAMKKQLRSIGLSLDWSREIATCDPAYYKHQQKMFLDFLR---------------
SYL_BRASB       -----AAMKKQLRSIGLSLDWAREFATCDPSYYKHQQKMFLDFMQ---------------
SYL_BRASO       -----AAMKKQLRSIGLSLDWAREFATCDPSYYKHQQKMFLDFMQ---------------
SYL_BRADU       -----AAMKKQLRSIGLSLDWSREIATCDPSYYKHQQKMFLDFLR---------------
SYL_RHOPB       -----ATMKAQLKSMGLSLDWSREFATCDPSYYKHQQRMFIDFLA---------------
SYL_AZOC5       -----ASMKEQLQLLGLSLDWNREVATCDPSYYAEQQRLFLDLFE---------------
SYL_PARL1       -----AAMREQLKAIGLAIDWSREFATCDPEYYGHEQALFLDMLE---------------
SYL_CAUVC       -----AAMREQLKSLGISVDWSREFATCDPEYYGKQQAWFLRLLK---------------
SYL_CAUSK       -----AAMREQLKALGLSIDWSREFATCDPEYYGKQQAWFLHLLK---------------
SYL_MARMM       -----DAMRGQLQRLGLALDWSREIATCDPSYYRHQQAIFLRLME---------------
SYL_HYPNA       -----ESMKAQFRKLGLSLDWSREFATCDPDYYGAQQALFLKLMD---------------
SYL_RUEST       -----DTMVEQMKPLGLSLDWSRMFATCDPEYYGQQQALFLDFLE---------------
SYL_RUEPO       -----ETMVAQMKPLGFGLDWSRMFATCDPEYYGQQQALFLDFLE---------------
SYL_ROSDO       -----KDMRDQMKPLGLSIDWSREFATCDPEYYGQQQALFLDFLE---------------
SYL_JANSC       -----DDMRDQMRPLGFSIDWSRDLATCDPDYYGQQQALFIDMME---------------
SYL_DINSH       -----AEMRAQMKPLGLSIDWSREFATCDEAYYGQQQSMFLDFLE---------------
SYL_RHOS1       -----ADMRAQMKPLGLSIDWSREFATCDPEYYGQQQAMFIDMME---------------
SYL_RHOS4       -----ADMRAQMKPLGLSIDWSREFATCDPEYYGQQQAMFIDMME---------------
SYL_RHOS5       -----ADMRAQMKPLGLSIDWSREFATCDPEYYGQQQAMFIDMLE---------------
SYL_PARDP       -----ATMRGQLKPLGLSIDWSREFATCDDAYVAQQQALFLDMLE---------------
SYL_ZYMMO       -----ATMREQLKRIGFAIDWSRELATCEPSYYGQEQALFLDLYK---------------
SYL_SPHWW       -----AAMRDQLKRIGFALDWSRELATCEPDYYGQEQALFLDLYA---------------
SYL_NOVAD       -----ANMKAQLKRLGFALDWSREIATCEPEYYGQEQALFLDLYA---------------
SYL_SPHAL       -----DAMRAQLKRLGLAIDWSRELATCEPDYYGQEQALFLDLHA---------------
SYL_GRABC       -----AAMRGELQRMGLSITWEREFATCDPSYYGHQQALFLDFLK---------------
SYL_GLUOX       -----ATMRGTLQRLGFSLDWDREIATCLPEYYGKQQKLFTDMLG---------------
SYL_ACICJ       -----AAMKADLKRVGLSVDWSREFATCDPEYYGHQQKLFLDLWR---------------
SYL_MAGSA       -----AAMREQLKSMGLSYDWRREVATCEPEYYRHEQKMFLDFLK---------------
SYL_RHORT       -----AIMREQFKPMGLSIDWSREVSTCEPAYYRHEQKMFLDFLK---------------
SYL_MAGMM       -----ATMREELKSMGLSYDWDREFATCDEDYAHAEQVLFLRLYE---------------
SYL_CAMJ8       -----AYMKKELFSLGFSFSKKRMLATSDPLYTKFEQEFFIKMFE---------------
SYL_CAMJJ       -----AYMKKELFSLGFSFSKKRMLATSDPLYTKFEQEFFIKMFE---------------
SYL_CAMJR       -----AYMKKELFSLGFSFSKKRMLATSDPLYTKFEQEFFIKMFE---------------
SYL_CAMJE       -----AYMKKELFSLGFSFSKKRMLATSDPLYTKFEQEFFIKMFE---------------
SYL_CAMJD       -----AYMKKELFSLGFSFSKKRMLATSDPLYTKFEQEIFIKMFE---------------
SYL_CAMC1       -----DYMKKELASLGFSFSKKRILATSDPLYTKWEQSFFIKMFE---------------
SYL_CAMC5       -----DYMKKELSSLGFSFSDRRMLATSDPLYTKWEQSFFIKMFE---------------
SYL_CAMFF       -----DYMTKELDALGFSFSKKRLFATSDPLYTRWEQEFFIRMYE---------------
SYL_CAMHC       -----DYMTKELFRLGFSFSKNRILATSDPIYTKFEQEFFIKMFE---------------
SYL_ARCB4       -----DYMRDELKSLGLSFSKNREFATSDELYTKWEQEFIIKMYE---------------
SYL_NITSB       -----DYMRKELDALGLSFSHDREFATCDPLYSKWEQSFIIDMWN---------------
SYL_WOLSU       -----SNMREELDSLGLSFSNEREFATCDPIYSKWEQKFFIDMWN---------------
SYL_HELHP       -----DTMRKELATLGLSFSKEREFATSDAIYTRFEQEFFIKMWE---------------
SYL_HELPY       -----ENMQKEFEALGFSFSKNREFATSDPDYTKFEQRFFIDLWE---------------
SYL_HELPH       -----EAMQKEFEALGFSFSKNREFATSDPDYTKFEQQFFIDLWE---------------
SYL_HELPJ       -----EAMQKEFEALGFSFSKNREFATSDPDYTKFEQQFFIDLWE---------------
SYL_HELAH       -----ENMQKEFEALGFSFSKNREFATSDPNYTEFEQQFFIDLWE---------------
SYL_THEMA       -----ATIRQQVKKLGISYDWSREIATCDEEYYKWTQWIFLQLYK---------------
SYL_THEP1       -----NTIRGQVKKLGISYDWSREIATCDEEYYKWTQWIFLQLYK---------------
SYL_THEM4       -----DIIRNQIKKIGISYDWSREVITCTEEYYKWTQWIFLKLYE---------------
SYL_FERNB       -----NVIRGQIKKIGISYDWNREVITCTEDYYKWTQWVFLKLYE---------------
SYL_PSELT       -----NIIRRQIKKLGISYDWNREVITCLESYYKWTEWIFLKLYE---------------
SYL_CALS8       -----ENMKRQLKELGISYDWDREVATCHPDYYKWTQWMFLQFYK---------------
SYL_HUNT2       -----DNMRRQLKQLGISYDWDREVATCHPDYYKWTQWMFLQLYK---------------
SYL_DESHY       -----ANMKRQLQEMGISYDWEREVTTCHPDYYKFTQWIFLEFYK---------------
SYL_SYNWW       -----ENMKRQLKTMGISYDWDRELATCKPDYYKFTQWMFLKLYE---------------
SYL_CARHZ       -----ANMRRQLKELGISYDWRREIATCHPEYYRWTQWLFLQFYK---------------
SYL_PELTS       -----ESMRAQLKQLGISYDWNREVATCHPGYYRWTQWLFLQLFH---------------
SYL_MOOTA       -----ANMRRQLHAMGISYDWDREVATCHPNYYRWTQWLFLQMYK---------------
SYL_DESRM       -----AHMRSQLKQLGLSYDWNREVATCHTEYYKWGQWLFLQLYK---------------
SYL_SYMTH       -----AEMTAQLKQMGYSYDWSRAVYTYREDYYRWTQWLFLQFYK---------------
SYL_DESVH       -----DNMRSQLKRLGYSYDWQREVATCTPEYYRWEQLFFLRFLE---------------
SYL_DESVV       -----DNMRSQLKRLGYSYDWQREVATCTPEYYRWEQLFFLRFLE---------------
SYL_DESAG       -----DNMRSQLKRLGYSYDWRRELATCDAEYYRWEQLFFLKFME---------------
SYL_LAWIP       -----NEMRAQLKRLGYSYDWQREIATCDPDYYQWEQLFFVDCFE---------------
SYL_GEOMG       -----AYMRSQLKKMGLSYDWDRELATCDLDYYKWEQKVFLEMYE---------------
SYL_GEOSL       -----DYMRSQLKKMGLSYDWGRELATCDVDYYKWEQKMFLEMYE---------------
SYL_GEOUR       -----AYMRGQLKKMGLSYDWDRELATCDVDYYKWEQLIFLQMYK---------------
SYL_PELPD       -----DYMRGQLKKMGLSYDWGRELATCDLEYYRWEQKIFLEMFA---------------
SYL_PELCD       -----DNMRAQLKKMGFSYDWDREVATCHPEYYRWEQLIFLKMLE---------------
SYL_SYNAS       -----THMRKQLKRMGFSYDWDREVSTCEPVYYRWEQLFFLWMYE---------------
SYL_SYNFM       -----AYMRSQLKQLGFSYDWSREFATCDVSYYRWEQLFFLKMYE---------------
SYL_DESPS       -----DYMRQQLQQLGLSYDWDREMATCNPKYYRQEQQLFIEMLE---------------
SYL_FUSNN       -----ENMRRQLKLMGFSYDWEREIASYTPEYYKWNQWLFKRMYE---------------
SYL_TRIV2       -----TQMRQQLQRLGLSIDWDSEVATCSPDYYKWTQWIFLQFLQ---------------
SYL_NOSS1       -----TQMRQQLQRLGLSIDWDSEVATCSPDYYKWTQWIFLQFLQ---------------
SYL_ACAM1       -----AQMKKQLEPLGLSIDWSREIATCSPDYYRWTQWIFLQFLD---------------
SYL_TRIEI       -----AQMKEQLRRLGFSIDWDKEVATCTPEYYRWTQWIFLQFFQ---------------
SYL_SYNY3       -----AQMRAQLQQLGLSIDWEREVATCAPDYYRWTQWLFLEFFQ---------------
SYL_SYNE7       -----AQMREQLKQLGLSYDWDREVTTCSPDYYRWTQWLFLQFFE---------------
SYL_SYNP6       -----AQMREQLKQLGLSYDWDREVTTCSPDYYRWTQWLFLQFFE---------------
SYL_THEEB       -----GQMRQELQRLGLSYDWEREVTTCHPDYYRWTQWLFLEFFE---------------
SYL_SYNJB       -----AQMREQLQRLGLSYDWEREITTCAPDYYKWTQWLFLQFFK---------------
SYL_SYNJA       -----AQMRDQLQRLGLSYDWEREITTCAPDYYKWTQWLFLQFFK---------------
SYL_GLOVI       -----AQMREQLKRLGFAYAWEREVATCSPAYYRWTQKLFLEFWK---------------
SYL_SYNS3       -----AQMRGQLGRLGLSIDWDREVATCHSDYYRWTQWLFLELHA---------------
SYL_SYNPW       -----EQMKAQLARLGLSIDWSREQATCHADYYRWTQWLFLELMD---------------
SYL_PROMM       -----AQMRAQLDRLGLSIDWDRQQATCHQDYYRWTQWLFLELFA---------------
SYL_PROM3       -----AQMRAQLDRLGLSIDWDRQQATCHQDYYRWTQWLFLELFA---------------
SYL_SYNSC       -----DQMRAQLDRLGLSIDWSREQATCHSDYYRWTQWLFLELLE---------------
SYL_SYNS9       -----DQMRNQLDRLGLSIDWDREQATCHSDYYRWTQWLFLELLE---------------
SYL_SYNPX       -----DQMRSQLDRLGLSIDWDREQATCHSDYYRWTQWLFLELFD---------------
SYL_SYNR3       -----AQMREQLQRLGLSIDWSREVATCHSDYYRWTQWLFLQFLN---------------
SYL_PROMT       -----SQMKDQLDRLGLSIDWSKEVTTCKEEYYKWTQYIFNQLHK---------------
SYL_PROM1       -----SQMKDQLDRLGLSIDWSKEVTTCKEDYYKWTQYIFNQLHK---------------
SYL_PROMA       -----EDMRNQLNRLGLSIDWDKEVTTCKEEYYKWTQYIFLELYE---------------
SYL_PROM0       -----SHMKSQLKLLGLSVDWDREFATCDENYYVWTQYLFLELYK---------------
SYL_PROM9       -----SHMKSQLKLLGLSVDWDREFATCDENYYIWTQYLFLELYK---------------
SYL_PROMS       -----SHMKSQLKLLGLSVDWDREFATCDENYYIWTQYLFLELYK---------------
SYL_PROM2       -----SHMRSQLKLLGLSVDWDREFATCDENYYIWTQYLFLELYK---------------
SYL_PROMP       -----AHMKSQLKLLGLSVDWDREFATCDENYYVWTQFLFLELHK---------------
SYL_PROM5       -----AHMKSQLKLLGLSVDWDKEFATCDENYYLWTQFLFLELHK---------------
SYL_SOLUE       -----AAMKKTHRRFAFSYDWDREVSTCEPEYYRWNQWFFLRMLE---------------
SYL_DEIRA       -----ERMTGQFSRMGTMIDWSRKFATCDPEYYRWNQWFFIEFWK---------------
SYL_DEIGD       -----EHMLGQFKRMGTMIDWSRSLATCDPEYYRWNQWFFTEFFR---------------
SYL_RUBXD       -----ERMRGQLRQMGTMFDFDAEVVTCDPEYYRWNQWFFLKFYE---------------
SYL_CLOPE       -----AKMEEQLKAMGAMFNWENEVVTCSPEYYKWTQWLFLKLYE---------------
SYL_CLOPS       -----AKMEEQLKAMGAMFNWENEVVTCSPEYYKWTQWLFLKLYE---------------
SYL_CLOP1       -----AKMEEQLKAMGAMFNWENEVVTCSPEYYKWTQWLFLKLYE---------------
SYL_CLOB8       -----ETMEKQLKSMGAMFNWENEVVTCLPDYYKWTQWLFLKLYE---------------
SYL_CLOB1       -----ETMETQLKAMGAMFNWENEVITCSPDYYKWTQWLFLKLYE---------------
SYL_CLOBH       -----ETMETQLKAMGAMFNWENEVITCSPDYYKWTQWLFLKLYE---------------
SYL_CLOBL       -----ETMETQLKAMGAMFNWENEVITCSPDYYKWTQWLFLKLYE---------------
SYL_CLONN       -----ENMEEQLRSMGAMFNWDHEIITCLPDYYKWTQWVFLKLYE---------------
SYL_CLOAB       -----ETMEKQLKSMGAMFNWDHEVITCTPDYYKWTQWLFLELYK---------------
SYL_CLOK5       -----DTMEKQLKSMGAMFNWENEVVTCRPDYYKWNQWLFLQLYK---------------
SYL_CLOTE       -----ETMTKQLKSMGAMFHWDNEVITSEPEYYKWTQWMFLQLYK---------------
SYL_CALS4       -----RTMERQLREMGVTFDWDYEIITCLPEYYKWTQWIFLKLYE---------------
SYL_ROSCS       -----AESKKSLEIAGIMYDWSREVTTCDPDYYRWNQWLFLLLYR---------------
SYL_ROSS1       -----AESKKSLEIAGIMYDWSREVTTCNPDYYRWNQWLFLLLYR---------------
SYL_THEFY       -----ETQAESFRRYAISLDWSRRLHTSDPEYYRWNQWFFLRFFE---------------
SYL_ACIC1       -----ETQAASFRNYAISFDWSRRLHTCDPEYYKWTQWLFLRLFE---------------
SYL_ARTS2       -----DTQAASFKRYAISADWSRRLHTSDPEYYRWTQWLFKRFYE---------------
SYL_PAEAT       -----DTQAASFKRYAISADWSRRLHTSDPEYYRWTQWLFKRFYE---------------
SYL_RENSM       -----ETQAASFKRYAIGVDWSRRLQTSDPEYYRWTQWLFLRFYE---------------
SYL_CLAMS       -----ETQKQSMKRYGLSFDWERELHTSDPEYYRWNQWLFLKMHE---------------
SYL_CLAM3       -----ETQKQSMKRYGLSFDWERELHTSDPEYYRWNQWLFLKMHE---------------
SYL_LEIXX       -----AQQKASMRRYAPSFDWDRVLQTCDPSYYKWNQWLFLKLYE---------------
SYL_KINRD       -----AQQRASMRRYACSFDWDRVLHTSDPEYYRWNQWLFLKLYE---------------
SYL_NOCSJ       -----ETQYESFKRYAVSFDWSRRLHTSDPEYYRWTQWLFLKFRE---------------
SYL_TROW8       -----DQQARSMRLYAASFDWSRRLHTSDPEYYRWNQWLFLKLYK---------------
SYL_TROWT       -----DQQARSMRLYAASFDWSRRLHTSDPEYYRWNQWLFLKLYK---------------
SYL_MYCPA       -----VNFRRQLGRLGLGHDSRRSFSTTDVEFYKWTQWIFLQIYNAWFDPAANKAR----
SYL_MYCA1       -----VNFRRQLGRLGLGHDSRRSFSTTDVEFYKWTQWIFLQIYNAWFDPAANKAR----
SYL_MYCLE       -----VNFRHQLGRLGLGHDSRRTFSTTDVEFYKWTQWIFLQIYNAWFDVAANKAR----
SYL_MYCTA       -----VNFRRQLGRLGFGHDSRRSFSTTDVDFYRWTQWIFLQIYNAWFDTTANKAR----
SYL_MYCBO       -----VNFRRQLGRLGFGHDSRRSFSTTDVDFYRWTQWIFLQIYNAWFDTTANKAR----
SYL_MYCTU       -----VNFRRQLGRLGFGHDSRRSFSTTDVDFYRWTQWIFLQIYNAWFDTTANKAR----
SYL_MYCBP       -----VNFRRQLGRLGFGHDSRRSFSTTDVDFYRWTQWIFLQIYNAWFDTTANKAR----
SYL_MYCUA       -----VNFRRQLGRLGLGHDSRRSFSTTDVEFYKWTQWIFLQIYNAWFDAAANKAR----
SYL_MYCSS       -----VNFRRQLGRLGLGHDTRRSFSTTDVDFYTWTQWIFLQIYNAWFDRDANRAR----
SYL_MYCSK       -----VNFRRQLGRLGLGHDTRRSFSTTDVDFYTWTQWIFLQIYNAWFDRDANRAR----
SYL_MYCSJ       -----VNFRRQLGRLGLGHDTRRSFSTTDVDFYTWTQWIFLQIYNAWFDRDANRAR----
SYL_MYCS2       -----VNFRRQLGRLGLGHDTRRSFSTTDVDYYKWTQWIFLQIYNAWFDRDQNKAR----
SYL_MYCVP       -----VNFRRQLGRLGLGHDSRRSFSTTDVDFYKWTQWIFLQIYNAWFDTAQNKAR----
SYL_MYCGI       -----VNFRRQLGRLGLGHDSRRSFATTDVDYYKWTQWIFLQIFNAWFDTDQNRAR----
SYL_NOCFA       -----ATMQRQLDRLGLGHDRRRSFATTDPEYYRWTQWIFLQIYNAWYDLELNRAR----
SYL_RHOJR       -----VNMKRQLRRLGLGHDERRTFATTDTDFYHWTQWIFLQIHDAWFDKEAGKAR----
SYL_SACEN       -----ERYLTQIRRLGLGHDERRRVATTDIPFYRWTQWIFLQIFHSWYDTDADRAR----
SYL_CORGB       -----ENMKRQLGALGLGHDSRRAVATTDPEFYKWTQWIFLQIFNSWFDAEQQKAR----
SYL_CORGL       -----ENMKRQLGALGLGHDSRRAVATTDPEFYKWTQWIFLQIFNSWFDAEQQKAR----
SYL_COREF       -----ENMKRQLGALGLGHDPRRAVASTDPEFYKWTQWIFLQIFNSWFDEEQQKAR----
SYL_CORDI       -----ANMQRQLGALGLGHDPRRSVATTDPEFYKWTQWIFLQIFNAWFDTKQQKAR----
SYL_CORJK       -----ANMERQLGRLGLGHDKRRSFATTDTDYYRWTQWIFLQIYNSWFDPEAKNANG---
SYL_STRCO       -----KNMQSQLRRLGLGHDRRRSFATIDPEYYKWTQWIFLQIFNSWYDDEAKKAR----
SYL_STRAW       -----ENMKVQLRRLGLGHDKRRSFATIDPDYYKWTQWIFLQIFNSWYDEEANKAR----
SYL_SALAI       -----ARYKAQLRRLGLAHDERRSVATIDADFYRWTQWVFLQIYNAWYDREAKRAR----
SYL_BIFAA       -----ANMRRQLHRMGLSFDNRRSFATIDPGYVRWTQWIFSRIYDAWYDEDATNPSGSRG
SYL_BIFLO       -----ANMSRQLHRMGLSFDNRRTFATIDPGYVRWTQWIFSRIYDSWYDEDATNPSGSKG
SYL_FRACC       -----ANMRRQLSRLGLGHDTRREIATTDVGYYRWTQWIFQQIFNSWYDPQAGRAR----
SYL_FRAAA       -----ANMRRQLSRLGLGHDTRREIATTDVGYYRWTQWIFEQIFDAWYDPQAGRAR----
                               .          :    :    :  :                    

SYL_GEOKA       -----------------------------------------------------------K
SYL_GEOTN       -----------------------------------------------------------K
SYL_BACCZ       -----------------------------------------------------------K
SYL_BACAH       -----------------------------------------------------------K
SYL_BACAN       -----------------------------------------------------------K
SYL_BACHK       -----------------------------------------------------------K
SYL_BACC1       -----------------------------------------------------------K
SYL_BACCR       -----------------------------------------------------------K
SYL_BACCN       -----------------------------------------------------------K
SYL_BACSU       -----------------------------------------------------------K
SYL_BACVZ       -----------------------------------------------------------K
SYL_BACLD       -----------------------------------------------------------K
SYL_BACP2       -----------------------------------------------------------K
SYL_BACHD       -----------------------------------------------------------K
SYL_BACSK       -----------------------------------------------------------K
SYL_OCEIH       -----------------------------------------------------------N
SYL_STAES       -----------------------------------------------------------K
SYL_STAEQ       -----------------------------------------------------------K
SYL_STAAW       -----------------------------------------------------------K
SYL_STAAS       -----------------------------------------------------------K
SYL_STAAN       -----------------------------------------------------------K
SYL_STAA1       -----------------------------------------------------------K
SYL_STAAM       -----------------------------------------------------------K
SYL_STAA9       -----------------------------------------------------------K
SYL_STAA2       -----------------------------------------------------------K
SYL_STAA3       -----------------------------------------------------------K
SYL_STAAC       -----------------------------------------------------------K
SYL_STAA8       -----------------------------------------------------------K
SYL_STAAT       -----------------------------------------------------------K
SYL_STAAE       -----------------------------------------------------------K
SYL_STAAB       -----------------------------------------------------------K
SYL_STAAR       -----------------------------------------------------------K
SYL_STAHJ       -----------------------------------------------------------K
SYL_STAS1       -----------------------------------------------------------K
SYL_LISMF       -----------------------------------------------------------K
SYL_LISMO       -----------------------------------------------------------N
SYL_LISIN       -----------------------------------------------------------N
SYL_LISW6       -----------------------------------------------------------N
SYL_ENTFA       -----------------------------------------------------------K
SYL_STRTD       -----------------------------------------------------------K
SYL_STRT2       -----------------------------------------------------------K
SYL_STRT1       -----------------------------------------------------------K
SYL_STRP2       -----------------------------------------------------------K
SYL_STRR6       -----------------------------------------------------------K
SYL_STRPN       -----------------------------------------------------------K
SYL_STRSV       -----------------------------------------------------------K
SYL_STRGC       -----------------------------------------------------------K
SYL_STRS2       -----------------------------------------------------------K
SYL_STRSY       -----------------------------------------------------------K
SYL_STRPD       -----------------------------------------------------------K
SYL_STRPG       -----------------------------------------------------------K
SYL_STRP6       -----------------------------------------------------------K
SYL_STRPM       -----------------------------------------------------------K
SYL_STRPF       -----------------------------------------------------------K
SYL_STRPB       -----------------------------------------------------------K
SYL_STRPC       -----------------------------------------------------------K
SYL_STRP3       -----------------------------------------------------------K
SYL_STRP1       -----------------------------------------------------------K
SYL_STRP8       -----------------------------------------------------------K
SYL_STRA3       -----------------------------------------------------------K
SYL_STRA5       -----------------------------------------------------------K
SYL_STRA1       -----------------------------------------------------------K
SYL_STRMU       -----------------------------------------------------------K
SYL_LACLM       -----------------------------------------------------------K
SYL_LACLA       -----------------------------------------------------------K
SYL_LACLS       -----------------------------------------------------------K
SYL_LACSS       -----------------------------------------------------------K
SYL_LACDA       -----------------------------------------------------------M
SYL_LACDB       -----------------------------------------------------------M
SYL_LACP3       -----------------------------------------------------------H
SYL_LACPL       -----------------------------------------------------------K
SYL_LACBA       -----------------------------------------------------------K
SYL_PEDPA       -----------------------------------------------------------K
SYL_LACS1       -----------------------------------------------------------K
SYL_LACRD       -----------------------------------------------------------K
SYL_LEUMM       -----------------------------------------------------------K
SYL_OENOB       -----------------------------------------------------------K
SYL_SALRD       -----------------------------------------------------------K
SYL1_RHIL3      -----------------------------------------------------------N
SYL_RHOBA       LPIPAEVTAEGELEIEQYR--------------------------------------DSK
SYL_PELLD       ----------------------------------------------------------EM
SYL_CHLPM       ----------------------------------------------------------EM
SYL_CHLCH       ----------------------------------------------------------DR
SYL_CHLTE       ----------------------------------------------------------EK
SYL_CHLPD       ----------------------------------------------------------EL
SYL_LEPBL       LIQRFSNKGSADLDYKPFS------AQE----------------WKQFSLVEKEKILSDF
SYL_LEPBJ       LIQRFSNKGSADLDYKPFS------AQE----------------WKQFSLVEKEKILSDF
SYL_LEPIC       LIRRFSNQGSNGLDYRQFN------SEE----------------WKNFSPVEKEKILSDF
SYL_LEPIN       LIRRFSNQGSNGLDYRQFN------SEE----------------WKNFSPVEKEKILSDF
SYL_BACTN       LIDAFAIYGNEGLNAACSE-ELSFTAKE----------------WKAKSEKEQQEILMNY
SYL_BACV8       LTEAFARYGNEGLNAACSE-ELSFTAEE----------------WNAKSEKEQQEILMNY
SYL_BACFR       LIEAFSTNGTQGMNVACGE-EMDFTADE----------------WNAKSEKEQQEILMNY
SYL_BACFN       LIEAFSTNGTQGMNVACGE-EMDFTADE----------------WNAKSEKEQQEILMNY
SYL_PARD8       LIQAFETSGTEGLNVACGE-ELSFTAEE----------------WKAKSDKEKQEILLNY
SYL_PORGI       LIEVFARQGNDGLNVACGE-GVRFTAEE----------------WTAMSEKEQQEILMNY
SYL_FLAPJ       LISLFQKEGNTNINAVCDDNIAPFSAQD----------------WTGFSSSKQQKILLQY
SYL_FLAJ1       LVTVFEESGNALVEAVCDDNVTIFTADE----------------WKSYSDDQKEKILLQY
SYL_GRAFK       LEEIFTSEGNSRINAASDDDVEKFSADD----------------WNACSEDEKEQILLKY
SYL_CYTH3       LVKQFETAGNAGINAACDEDAVTFTAAD----------------WKSYSEKQQSDTLLKY
SYL_BDEBA       ------------------------------------------------------------
SYL_SORC5       -----------------------------------------------------------K
SYL_TREDE       -----------------------------------------------------------K
SYL_TREPA       -----------------------------------------------------------K
SYL_BORAP       -----------------------------------------------------------K
SYL_BORBP       -----------------------------------------------------------K
SYL_BORBU       -----------------------------------------------------------K
SYL_CHLTR       -----------------------------------------------------------K
SYL_CHLTA       -----------------------------------------------------------K
SYL_CHLMU       -----------------------------------------------------------K
SYL_CHLFF       -----------------------------------------------------------K
SYL_CHLCV       -----------------------------------------------------------K
SYL_CHLAB       -----------------------------------------------------------K
SYL_CHLPN       -----------------------------------------------------------Q
SYL_PARUW       -----------------------------------------------------------K
SYL_ALKOO       -----------------------------------------------------------K
SYL_UREP2       -----------------------------------------------------------H
SYL_UREPA       -----------------------------------------------------------H
SYL_MYCPU       -----------------------------------------------------------K
SYL_MYCPE       -----------------------------------------------------------N
SYL_MYCGA       -----------------------------------------------------------H
SYL_MYCGE       -----------------------------------------------------------A
SYL_MYCPN       -----------------------------------------------------------A
SYL_MYCCT       -----------------------------------------------------------K
SYL_MYCMS       -----------------------------------------------------------K
SYL_MESFL       -----------------------------------------------------------K
SYL_ACHLI       -----------------------------------------------------------K
SYL_PSEA6       -----------------------------------------------------------K
SYL_COLP3       -----------------------------------------------------------K
SYL_IDILO       -----------------------------------------------------------K
SYL_PSEHT       -----------------------------------------------------------K
SYL_PSYIN       -----------------------------------------------------------K
SYL_SALCH       -----------------------------------------------------------K
SYL_SALTI       -----------------------------------------------------------K
SYL_SALTY       -----------------------------------------------------------K
SYL_SALPB       -----------------------------------------------------------K
SYL_SALPA       -----------------------------------------------------------K
SYL_CITK8       -----------------------------------------------------------K
SYL_SALAR       -----------------------------------------------------------K
SYL_SHIFL       -----------------------------------------------------------K
SYL_SHIF8       -----------------------------------------------------------K
SYL_SHIBS       -----------------------------------------------------------K
SYL_ECOL6       -----------------------------------------------------------K
SYL_ECOL5       -----------------------------------------------------------K
SYL_ECO57       -----------------------------------------------------------K
SYL_SHISS       -----------------------------------------------------------K
SYL_ECOLI       -----------------------------------------------------------K
SYL_ECOLC       -----------------------------------------------------------K
SYL_SHIDS       -----------------------------------------------------------K
SYL_ECOHS       -----------------------------------------------------------K
SYL_ECOUT       -----------------------------------------------------------K
SYL_ECOK1       -----------------------------------------------------------K
SYL_ECO24       -----------------------------------------------------------K
SYL_KLEP7       -----------------------------------------------------------K
SYL_CROS8       -----------------------------------------------------------K
SYL_ENT38       -----------------------------------------------------------K
SYL_YERPA       -----------------------------------------------------------K
SYL_YERP3       -----------------------------------------------------------K
SYL_YERPE       -----------------------------------------------------------K
SYL_YERPN       -----------------------------------------------------------K
SYL_YERPS       -----------------------------------------------------------K
SYL_YERPP       -----------------------------------------------------------K
SYL_YERE8       -----------------------------------------------------------K
SYL_SERP5       -----------------------------------------------------------K
SYL_PECAS       -----------------------------------------------------------K
SYL_SODGM       -----------------------------------------------------------K
SYL_PHOLL       -----------------------------------------------------------K
SYL_MANSM       -----------------------------------------------------------K
SYL_ACTSZ       -----------------------------------------------------------K
SYL_HAES1       -----------------------------------------------------------K
SYL_HISS2       -----------------------------------------------------------K
SYL_PASMU       -----------------------------------------------------------K
SYL_HAEIG       -----------------------------------------------------------K
SYL_HAEIN       -----------------------------------------------------------K
SYL_HAEI8       -----------------------------------------------------------K
SYL_HAEIE       -----------------------------------------------------------K
SYL_ACTP2       -----------------------------------------------------------K
SYL_HAEDU       -----------------------------------------------------------K
SYL_SHESA       -----------------------------------------------------------K
SYL_SHESM       -----------------------------------------------------------K
SYL_SHESR       -----------------------------------------------------------K
SYL_SHEON       -----------------------------------------------------------K
SYL_SHEB9       -----------------------------------------------------------K
SYL_SHEB5       -----------------------------------------------------------K
SYL_SHEB8       -----------------------------------------------------------K
SYL_SHESW       -----------------------------------------------------------K
SYL_SHEPC       -----------------------------------------------------------K
SYL_SHEAM       -----------------------------------------------------------K
SYL_SHEHH       -----------------------------------------------------------K
SYL_SHEPA       -----------------------------------------------------------K
SYL_SHELP       -----------------------------------------------------------K
SYL_SHESH       -----------------------------------------------------------K
SYL_SHEDO       -----------------------------------------------------------K
SYL_SHEFN       -----------------------------------------------------------K
SYL_VIBPA       -----------------------------------------------------------K
SYL_VIBCB       -----------------------------------------------------------K
SYL_VIBVU       -----------------------------------------------------------K
SYL_VIBVY       -----------------------------------------------------------K
SYL_VIBCH       -----------------------------------------------------------K
SYL_VIBC3       -----------------------------------------------------------K
SYL_ALIF1       -----------------------------------------------------------K
SYL_PHOPR       -----------------------------------------------------------K
SYL_AERS4       -----------------------------------------------------------K
SYL_AERHH       -----------------------------------------------------------K
SYL_MARHV       -----------------------------------------------------------K
SYL_HAHCH       -----------------------------------------------------------K
SYL_SACD2       -----------------------------------------------------------K
SYL_MARMS       -----------------------------------------------------------K
SYL_ALCBS       -----------------------------------------------------------K
SYL_PSEAB       -----------------------------------------------------------K
SYL_PSEAE       -----------------------------------------------------------K
SYL_PSEA7       -----------------------------------------------------------K
SYL_PSEU5       -----------------------------------------------------------K
SYL_PSEMY       -----------------------------------------------------------K
SYL_PSEP1       -----------------------------------------------------------K
SYL_PSEPK       -----------------------------------------------------------K
SYL_PSEPG       -----------------------------------------------------------K
SYL_PSEE4       -----------------------------------------------------------K
SYL_PSEU2       -----------------------------------------------------------K
SYL_PSE14       -----------------------------------------------------------K
SYL_PSESM       -----------------------------------------------------------K
SYL_NEIMB       -----------------------------------------------------------K
SYL_NEIMF       -----------------------------------------------------------K
SYL_NEIG1       -----------------------------------------------------------K
SYL_NEIM0       -----------------------------------------------------------K
SYL_NEIMA       -----------------------------------------------------------K
SYL_CHRVO       -----------------------------------------------------------K
SYL_THIDA       -----------------------------------------------------------K
SYL_DECAR       -----------------------------------------------------------K
SYL_AZOSB       -----------------------------------------------------------K
SYL_CUPMC       -----------------------------------------------------------K
SYL_CUPPJ       -----------------------------------------------------------K
SYL_RALSO       -----------------------------------------------------------K
SYL_JANMA       -----------------------------------------------------------K
SYL_HERAR       -----------------------------------------------------------K
SYL_BURCH       -----------------------------------------------------------K
SYL_BURCA       -----------------------------------------------------------K
SYL_BURL3       -----------------------------------------------------------K
SYL_BURCM       -----------------------------------------------------------K
SYL_BURVG       -----------------------------------------------------------K
SYL_BURP0       -----------------------------------------------------------K
SYL_BURPS       -----------------------------------------------------------K
SYL_BURP6       -----------------------------------------------------------K
SYL_BURP1       -----------------------------------------------------------K
SYL_BURM7       -----------------------------------------------------------K
SYL_BURM9       -----------------------------------------------------------K
SYL_BURMA       -----------------------------------------------------------K
SYL_BURMS       -----------------------------------------------------------K
SYL_BURTA       -----------------------------------------------------------K
SYL_PARXL       -----------------------------------------------------------K
SYL_POLAQ       -----------------------------------------------------------K
SYL_BORBR       -----------------------------------------------------------K
SYL_BORPA       -----------------------------------------------------------K
SYL_BORPE       -----------------------------------------------------------K
SYL_BORPD       -----------------------------------------------------------K
SYL_BORA1       -----------------------------------------------------------K
SYL_METPP       -----------------------------------------------------------K
SYL_ACISJ       -----------------------------------------------------------K
SYL_ACIAC       -----------------------------------------------------------K
SYL_RHOFT       -----------------------------------------------------------K
SYL_VEREI       -----------------------------------------------------------K
SYL_POLNA       -----------------------------------------------------------K
SYL_POLSJ       -----------------------------------------------------------K
SYL_METCA       -----------------------------------------------------------K
SYL_DICNV       -----------------------------------------------------------K
SYL_PSYCK       -----------------------------------------------------------K
SYL_PSYA2       -----------------------------------------------------------K
SYL_PSYWF       -----------------------------------------------------------K
SYL_ACIAD       -----------------------------------------------------------K
SYL_NITEU       -----------------------------------------------------------K
SYL_NITEC       -----------------------------------------------------------K
SYL_NITMU       -----------------------------------------------------------K
SYL_METFK       -----------------------------------------------------------K
SYL_HYDCU       -----------------------------------------------------------K
SYL_XYLFA       -----------------------------------------------------------K
SYL_XYLFT       -----------------------------------------------------------K
SYL_XANC8       -----------------------------------------------------------K
SYL_XANCP       -----------------------------------------------------------K
SYL_XANCB       -----------------------------------------------------------K
SYL_XANC5       -----------------------------------------------------------K
SYL_XANAC       -----------------------------------------------------------K
SYL_XANOR       -----------------------------------------------------------K
SYL_XANOM       -----------------------------------------------------------K
SYL_NITOC       -----------------------------------------------------------K
SYL_ALKEH       -----------------------------------------------------------K
SYL_HALHL       -----------------------------------------------------------K
SYL_CHRSD       -----------------------------------------------------------K
SYL_BUCAI       -----------------------------------------------------------K
SYL_BUCAP       -----------------------------------------------------------K
SYL_BUCCC       -----------------------------------------------------------K
SYL_BUCBP       -----------------------------------------------------------K
SYL_WIGBR       -----------------------------------------------------------K
SYL_BLOPB       -----------------------------------------------------------K
SYL_BLOFL       -----------------------------------------------------------K
SYL_BAUCH       -----------------------------------------------------------K
SYL_COXBU       -----------------------------------------------------------K
SYL_COXBR       -----------------------------------------------------------K
SYL_COXBN       -----------------------------------------------------------K
SYL_LEGPH       -----------------------------------------------------------K
SYL_LEGPC       -----------------------------------------------------------K
SYL_LEGPA       -----------------------------------------------------------K
SYL_LEGPL       -----------------------------------------------------------K
SYL_FRATT       -----------------------------------------------------------K
SYL_FRAT1       -----------------------------------------------------------K
SYL_FRATW       -----------------------------------------------------------K
SYL_FRATF       -----------------------------------------------------------K
SYL_FRATH       -----------------------------------------------------------K
SYL_FRATO       -----------------------------------------------------------K
SYL_FRATN       -----------------------------------------------------------K
SYL_FRAP2       -----------------------------------------------------------K
SYL_RUTMC       -----------------------------------------------------------K
SYL_VESOH       -----------------------------------------------------------K
SYL_RICRS       -----------------------------------------------------------R
SYL_RICRO       -----------------------------------------------------------R
SYL_RICCN       -----------------------------------------------------------R
SYL_RICM5       -----------------------------------------------------------R
SYL_RICFE       -----------------------------------------------------------R
SYL_RICAH       -----------------------------------------------------------R
SYL_RICCK       -----------------------------------------------------------R
SYL_RICBR       -----------------------------------------------------------R
SYL_RICPR       -----------------------------------------------------------R
SYL_RICTY       -----------------------------------------------------------R
SYL_ORITB       -----------------------------------------------------------K
SYL_WOLPM       -----------------------------------------------------------H
SYL_WOLTR       -----------------------------------------------------------Q
SYL_EHRRW       -----------------------------------------------------------Y
SYL_EHRRG       -----------------------------------------------------------Y
SYL_EHRCJ       -----------------------------------------------------------C
SYL_EHRCR       -----------------------------------------------------------C
SYL_ANAMM       -----------------------------------------------------------Q
SYL_NEOSM       -----------------------------------------------------------A
SYL2_RHIL3      -----------------------------------------------------------K
SYL_RHIEC       -----------------------------------------------------------K
SYL_RHIME       -----------------------------------------------------------K
SYL_SINMW       -----------------------------------------------------------K
SYL_AGRFC       -----------------------------------------------------------K
SYL_BRUAB       -----------------------------------------------------------K
SYL_BRUA2       -----------------------------------------------------------K
SYL_BRUSI       -----------------------------------------------------------K
SYL_BRUO2       -----------------------------------------------------------K
SYL_BRUME       -----------------------------------------------------------K
SYL_BRUSU       -----------------------------------------------------------K
SYL_BRUC2       -----------------------------------------------------------K
SYL_OCHA4       -----------------------------------------------------------K
SYL_CHESB       -----------------------------------------------------------K
SYL_RHILO       -----------------------------------------------------------K
SYL_BART1       -----------------------------------------------------------K
SYL_BARHE       -----------------------------------------------------------K
SYL_BARQU       -----------------------------------------------------------K
SYL_BARBK       -----------------------------------------------------------K
SYL_RHOP2       -----------------------------------------------------------V
SYL_RHOPS       -----------------------------------------------------------A
SYL_RHOPA       -----------------------------------------------------------V
SYL_RHOP5       -----------------------------------------------------------A
SYL_NITHX       -----------------------------------------------------------A
SYL_NITWN       -----------------------------------------------------------A
SYL_BRASB       -----------------------------------------------------------A
SYL_BRASO       -----------------------------------------------------------A
SYL_BRADU       -----------------------------------------------------------A
SYL_RHOPB       -----------------------------------------------------------A
SYL_AZOC5       -----------------------------------------------------------N
SYL_PARL1       -----------------------------------------------------------A
SYL_CAUVC       -----------------------------------------------------------R
SYL_CAUSK       -----------------------------------------------------------R
SYL_MARMM       -----------------------------------------------------------R
SYL_HYPNA       -----------------------------------------------------------K
SYL_RUEST       -----------------------------------------------------------K
SYL_RUEPO       -----------------------------------------------------------K
SYL_ROSDO       -----------------------------------------------------------A
SYL_JANSC       -----------------------------------------------------------A
SYL_DINSH       -----------------------------------------------------------K
SYL_RHOS1       -----------------------------------------------------------A
SYL_RHOS4       -----------------------------------------------------------A
SYL_RHOS5       -----------------------------------------------------------A
SYL_PARDP       -----------------------------------------------------------A
SYL_ZYMMO       -----------------------------------------------------------A
SYL_SPHWW       -----------------------------------------------------------A
SYL_NOVAD       -----------------------------------------------------------A
SYL_SPHAL       -----------------------------------------------------------A
SYL_GRABC       -----------------------------------------------------------K
SYL_GLUOX       -----------------------------------------------------------A
SYL_ACICJ       -----------------------------------------------------------A
SYL_MAGSA       -----------------------------------------------------------A
SYL_RHORT       -----------------------------------------------------------A
SYL_MAGMM       -----------------------------------------------------------K
SYL_CAMJ8       -----------------------------------------------------------K
SYL_CAMJJ       -----------------------------------------------------------K
SYL_CAMJR       -----------------------------------------------------------K
SYL_CAMJE       -----------------------------------------------------------K
SYL_CAMJD       -----------------------------------------------------------K
SYL_CAMC1       -----------------------------------------------------------K
SYL_CAMC5       -----------------------------------------------------------K
SYL_CAMFF       -----------------------------------------------------------K
SYL_CAMHC       -----------------------------------------------------------K
SYL_ARCB4       -----------------------------------------------------------A
SYL_NITSB       -----------------------------------------------------------R
SYL_WOLSU       -----------------------------------------------------------R
SYL_HELHP       -----------------------------------------------------------R
SYL_HELPY       -----------------------------------------------------------K
SYL_HELPH       -----------------------------------------------------------K
SYL_HELPJ       -----------------------------------------------------------K
SYL_HELAH       -----------------------------------------------------------K
SYL_THEMA       -----------------------------------------------------------N
SYL_THEP1       -----------------------------------------------------------N
SYL_THEM4       -----------------------------------------------------------N
SYL_FERNB       -----------------------------------------------------------A
SYL_PSELT       -----------------------------------------------------------A
SYL_CALS8       -----------------------------------------------------------A
SYL_HUNT2       -----------------------------------------------------------N
SYL_DESHY       -----------------------------------------------------------H
SYL_SYNWW       -----------------------------------------------------------N
SYL_CARHZ       -----------------------------------------------------------K
SYL_PELTS       -----------------------------------------------------------N
SYL_MOOTA       -----------------------------------------------------------H
SYL_DESRM       -----------------------------------------------------------K
SYL_SYMTH       -----------------------------------------------------------K
SYL_DESVH       -----------------------------------------------------------K
SYL_DESVV       -----------------------------------------------------------K
SYL_DESAG       -----------------------------------------------------------K
SYL_LAWIP       -----------------------------------------------------------K
SYL_GEOMG       -----------------------------------------------------------K
SYL_GEOSL       -----------------------------------------------------------K
SYL_GEOUR       -----------------------------------------------------------K
SYL_PELPD       -----------------------------------------------------------K
SYL_PELCD       -----------------------------------------------------------K
SYL_SYNAS       -----------------------------------------------------------K
SYL_SYNFM       -----------------------------------------------------------K
SYL_DESPS       -----------------------------------------------------------K
SYL_FUSNN       -----------------------------------------------------------K
SYL_TRIV2       -----------------------------------------------------------A
SYL_NOSS1       -----------------------------------------------------------A
SYL_ACAM1       -----------------------------------------------------------M
SYL_TRIEI       -----------------------------------------------------------A
SYL_SYNY3       -----------------------------------------------------------A
SYL_SYNE7       -----------------------------------------------------------A
SYL_SYNP6       -----------------------------------------------------------A
SYL_THEEB       -----------------------------------------------------------A
SYL_SYNJB       -----------------------------------------------------------A
SYL_SYNJA       -----------------------------------------------------------A
SYL_GLOVI       -----------------------------------------------------------A
SYL_SYNS3       -----------------------------------------------------------G
SYL_SYNPW       -----------------------------------------------------------Q
SYL_PROMM       -----------------------------------------------------------G
SYL_PROM3       -----------------------------------------------------------G
SYL_SYNSC       -----------------------------------------------------------G
SYL_SYNS9       -----------------------------------------------------------G
SYL_SYNPX       -----------------------------------------------------------G
SYL_SYNR3       -----------------------------------------------------------A
SYL_PROMT       -----------------------------------------------------------N
SYL_PROM1       -----------------------------------------------------------N
SYL_PROMA       -----------------------------------------------------------A
SYL_PROM0       -----------------------------------------------------------A
SYL_PROM9       -----------------------------------------------------------A
SYL_PROMS       -----------------------------------------------------------S
SYL_PROM2       -----------------------------------------------------------A
SYL_PROMP       -----------------------------------------------------------A
SYL_PROM5       -----------------------------------------------------------S
SYL_SOLUE       -----------------------------------------------------------R
SYL_DEIRA       -----------------------------------------------------------R
SYL_DEIGD       -----------------------------------------------------------R
SYL_RUBXD       -----------------------------------------------------------K
SYL_CLOPE       -----------------------------------------------------------K
SYL_CLOPS       -----------------------------------------------------------K
SYL_CLOP1       -----------------------------------------------------------K
SYL_CLOB8       -----------------------------------------------------------K
SYL_CLOB1       -----------------------------------------------------------K
SYL_CLOBH       -----------------------------------------------------------K
SYL_CLOBL       -----------------------------------------------------------K
SYL_CLONN       -----------------------------------------------------------K
SYL_CLOAB       -----------------------------------------------------------N
SYL_CLOK5       -----------------------------------------------------------H
SYL_CLOTE       -----------------------------------------------------------N
SYL_CALS4       -----------------------------------------------------------A
SYL_ROSCS       -----------------------------------------------------------K
SYL_ROSS1       -----------------------------------------------------------K
SYL_THEFY       -----------------------------------------------------------R
SYL_ACIC1       -----------------------------------------------------------R
SYL_ARTS2       -----------------------------------------------------------R
SYL_PAEAT       -----------------------------------------------------------R
SYL_RENSM       -----------------------------------------------------------R
SYL_CLAMS       -----------------------------------------------------------K
SYL_CLAM3       -----------------------------------------------------------K
SYL_LEIXX       -----------------------------------------------------------K
SYL_KINRD       -----------------------------------------------------------K
SYL_NOCSJ       -----------------------------------------------------------R
SYL_TROW8       -----------------------------------------------------------H
SYL_TROWT       -----------------------------------------------------------H
SYL_MYCPA       ---PIAELVAEFDSGARSLDDGRN--------------------WSELSAGERADVIDSH
SYL_MYCA1       ---PIAELVAEFDSGARSLDDGRN--------------------WSELSAGERADVIDSH
SYL_MYCLE       ---PIAELIAEFDSGERRLVDGRD--------------------WATLSAGERADVIDNC
SYL_MYCTA       ---PISELVAEFESGARCLDGGRD--------------------WAKLTAGERADVIDEY
SYL_MYCBO       ---PISELVAEFESGARCLDGGRD--------------------WAKLTAGERADVIDEY
SYL_MYCTU       ---PISELVAEFESGARCLDGGRD--------------------WAKLTAGERADVIDEY
SYL_MYCBP       ---PISELVAEFESGARCLDGGRD--------------------WAKLTAGERADVIDEY
SYL_MYCUA       ---PISELVAEFDSGARSLVDGRD--------------------WSTLSAGERADVIDDH
SYL_MYCSS       ---PIAELIGEFESGVRTLDDGRP--------------------WSELSAGERADVVDSY
SYL_MYCSK       ---PIAELIGEFESGVRTLDDGRP--------------------WSELSAGERADVVDSY
SYL_MYCSJ       ---PIAELIGEFESGVRTLDDGRP--------------------WSELSAGERADVVDSY
SYL_MYCS2       ---RISELVEEFESGKRTLDDGRN--------------------WADLSKGERADVIDGY
SYL_MYCVP       ---PVAELIAEFEAGTREVGDGRR--------------------WADLDAGERADVVDSR
SYL_MYCGI       ---PIRELIAEFEAGTRQVGDGRS--------------------WADLDAGARADLVDAH
SYL_NOCFA       ---PISELEEQFASGARPAPDGKD--------------------WASMSQAERAAVIDSY
SYL_RHOJR       ---RISELEAEFVSGARSLEDGRE--------------------WASLSVSEKEAVLDSY
SYL_SACEN       ---PISELEAQFAAGERATPDGRP--------------------WAELSRTEQRRIIDSY
SYL_CORGB       ---PISELIPLLESGELKTKDGAD--------------------YNALGDVEKQKAVDDY
SYL_CORGL       ---PISELIPLLESGELKTKDGAD--------------------YNALGDVEKQKAVDDY
SYL_COREF       ---PISELIPLLESGEIPTRDGAD--------------------YNGLDRVAKQKAIDEF
SYL_CORDI       ---PISELIPLLESGEVALPEGFEGS---------------ADSYSELDAVEKAKVVDEF
SYL_CORJK       ---TLGKARPIKELEEKLAAERAD--------------------WADLSAAEKQEILDSY
SYL_STRCO       ---PIAELVAQFASGEREVPGHAG------------------RAWSSLSEAERADVLGEY
SYL_STRAW       ---PIAELVAQFESGERAVPRADGAT----------------RAWRELTAAERADVLGEY
SYL_SALAI       ---PIAELIAEFSGGVRRTP--DG------------------RPWRELTDVERRSVVDEY
SYL_BIFAA       CARPISTLVEQFESGKRAIPGFE------------------GKAWADLSEAEQADVLNDF
SYL_BIFLO       SARPIAELVAKFESGEKAIPGHESD----------------GKQWSDLTDAEQQDILNDF
SYL_FRACC       ---PIAELIEEFAAGTRAPVAGPAGGNTAVSVDAVRAANPAGLAWTELDEVSRRKVVNAH
SYL_FRAAA       ---PIAELIAEFEAGTRSPAAGPAAGTTAVSVDAVRAANPTGLPWAELDRVTRRRVVDAH
                                                                            

SYL_GEOKA       GLAYMDEVPVNWCPAL---GTVLANEEVI----NG----RSERGGHPVIRKPMRQWMLKI
SYL_GEOTN       GLAYMDEVPVNWCPAL---GTVLANEEVI----NG----RSERGGHPVIRKPMRQWMLKI
SYL_BACCZ       GLAYVDEVPVNWCPAL---GTVLANEEII----DG----KSERGGHPVERRPMRQWMLKI
SYL_BACAH       GLAYVDEVPVNWCPAL---GTVLANEEII----DG----KSERGGHPVERRPMRQWMLKI
SYL_BACAN       GLAYVDEVPVNWCPAL---GTVLANEEII----DG----KSERGGHPVERRPMRQWMLKI
SYL_BACHK       GLAYVDEVPVNWCPAL---GTVLANEEII----DG----KSERGGHPVERRPMRQWMLKI
SYL_BACC1       GLAYVDEVPVNWCPAL---GTVLANEEII----DG----KSERGGHPVERRPMRQWMLKI
SYL_BACCR       GLAYVDEVPVNWCPAL---GTVLANEEII----DG----KSERGGHPVERRPMRQWMLKI
SYL_BACCN       GLAYVDEIPVNWCPAL---GTVLANEEVI----DG----KSERGGHPVERRPMKQWMLKI
SYL_BACSU       GLAYVDEVPVNWCPAL---GTVLANEEVI----DG----KSERGGHPVERRPMKQWMLKI
SYL_BACVZ       GLAYVDEVPVNWCPAL---GTVLANEEVI----DG----KSERGGHPVERRPMRQWMLKI
SYL_BACLD       GLAYVDEVPVNWCPAL---GTVLANEEVI----DG----KSERGGHPVERRPMKQWMLKI
SYL_BACP2       GLAYIDEVPVNWCPAL---GTVLANEEVI----DG----KSERGGHPVERRPMKQWMLKI
SYL_BACHD       GLAYIDEVAVNWCPAL---GTVLANEEVI----DG----KSERGGHPVERRPMKQWMLKI
SYL_BACSK       GLAYIDEVAVNWCPAL---GTVLANEEIV----DG----VSERGGHPVERRPMKQWVLRI
SYL_OCEIH       DLAYMDEVAVNWCPAL---GTVLANEEVI----DG----KSERGGHPVIRKPMKQWMLKI
SYL_STAES       GLAYVDEVAVNWCPAL---GTVLSNEEVV----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAEQ       GLAYVDEVAVNWCPAL---GTVLSNEEVV----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAW       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAS       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAN       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAA1       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAM       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAA9       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAA2       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAA3       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAC       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAA8       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAT       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAE       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAB       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAAR       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRKPMKQWVLKI
SYL_STAHJ       GLAYVDEVAVNWCPAL---GTVLSNEEVV----DG----VSERGGHPVYRRPMKQWVLKI
SYL_STAS1       GLAYVDEVAVNWCPAL---GTVLSNEEVI----DG----VSERGGHPVYRRPMKQWVLKI
SYL_LISMF       GLAYEAEIAVNWCPAL---GTVLANEEVI----DG----KSERGGFPVFRKPMRQWMLKI
SYL_LISMO       GLAYEAEIAVNWCPAL---GTVLANEEVI----DG----KSERGGFPVFRKPMRQWMLKI
SYL_LISIN       GLAYEAEIAVNWCPAL---GTVLANEEVI----DG----KSERGGFPVFRKPMRQWMLKI
SYL_LISW6       GLAYEAEIAVNWCPAL---GTVLANEEVI----DG----KSERGGFPVFRKPMRQWMLKI
SYL_ENTFA       GLAYEAEVAVNWVPEL---GTVISNEEVI----DG----KSERGGYDVVRRPMRQWMLKI
SYL_STRTD       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRT2       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRT1       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRP2       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRR6       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRPN       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRSV       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRGC       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRS2       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRSY       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRPD       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRPG       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRP6       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRPM       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRPF       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRPB       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRPC       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRP3       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRP1       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRP8       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRA3       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRA5       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRA1       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_STRMU       GLAYEAEVPVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_LACLM       GLAYEAEVAVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_LACLA       GLAYEAEVAVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_LACLS       GLAYEAEVAVNWVEEL---GTAIANEEVLP---DG----TSERGGYPVVRKPMRQWMLKI
SYL_LACSS       GLAYEAEVAVNWSPDL---GTVVANEEVI----DG----KTERGGYPVYRKPMRQWMLKI
SYL_LACDA       GLAYEAEVPVNWSPDL---GTVVANEEVI----DG----KTERGGYPVYRRKMRQWMLKI
SYL_LACDB       GLAYEAEVPVNWSPDL---GTVVANEEVI----DG----KTERGGYPVYRRKMRQWMLKI
SYL_LACP3       GLAYEAEVPVNWSPDL---GTVVANEEVI----DG----KTERGGFPVVRKPMRQWMLKI
SYL_LACPL       GLAYESETLVNWAPDMMG-GTVVSNEEVV----DG----KTERGGYDVYRVPMKQWSLKI
SYL_LACBA       GLAYEDKIMVNWAPDFMG-GTVVANEEVI----DG----KTERGGYPVYRVPMRQWVLKI
SYL_PEDPA       GLAYEKETLVNWAPDLMG-GTVVANEEVV----DG----KTERGGFPVYRKPMKQWILKI
SYL_LACS1       GLAYEAEVPVNWSPDL---GTVVANEEVI----DG----KTERGGFPVIRKPMRQWVLKI
SYL_LACRD       GLAYESEIMVNWAPDFMG-GTVVANEEVE----DG----KTKRGGYPVYRKPMRQWVLKI
SYL_LEUMM       GLAYEDEIMVNWAPDFPGGGIVVANEEVI----DG----KTERGGYPVYRKPMKQWVLRI
SYL_OENOB       GLAYEDEIMVNWAPDFPGGGIVVANEEVI----DG----KTERGSYPVYRVPMKQWVLRI
SYL_SALRD       GLAYQSEEPVWWCEEL---GTVLANEEVI----DG----KSERGGYPCERVPMRQWVLKI
SYL1_RHIL3      GLAYQAEVAVNWCPAQ---NAVLADEEVK----DG----RYVETGDPVIRRRMRQWMLRI
SYL_RHOBA       RLAYLDDALVNWCPKL---GTVLANEEVV----DG----KSEVGGHPVKRIPLRQWMLRI
SYL_PELLD       GLAYQSEVDVNWCVEL---RAVLANEEVE----EK----IAE--GLTVVRRPLRQWVLKI
SYL_CHLPM       GLAYMSEVDVNWCVEL---RAVLANEEVE----EK----LAD--GLTVVRRPLRQWVLKI
SYL_CHLCH       GLAYMSEVDVNWCEEL---KTVLANEEVD----EK----LAD--GYTVVRRPLRQWVLKI
SYL_CHLTE       GLAYISEVDVNWCEEL---KVVLANEEVD----EK----IAD--GYTVVRRPLRQWVLKI
SYL_CHLPD       GLAYVSEVDINWCEEL---KTVLANEEVE----EK----VKE--GYTVIRKPLRQWVLKI
SYL_LEPBL       RLVYQAEIPVNWCEAL---GTVLANEEVE----EW----IDK--GYEVVRKPMRQYMMRI
SYL_LEPBJ       RLVYQAEIPVNWCEAL---GTVLANEEVE----EW----IDK--GYEVVRKPMRQYMMRI
SYL_LEPIC       RLVYQAEIPVNWCEAL---GTVLANEEVE----EW----VGK--GYEVVRKPMRQYMMRI
SYL_LEPIN       RLVYQAEIPVNWCEAL---GTVLANEEVE----EW----VGK--GYEVVRKPMRQYMMRI
SYL_BACTN       RIAYLGETMVNWCQAL---GTVLANDEVI----DG----VSERGGFPVVQKKMRQWCLRV
SYL_BACV8       RIAYLGETMVNWCPQL---GTVLANDEVV----DG----VSERGGFPVVQKKMRQWCLRV
SYL_BACFR       RIAYLGNTMVNWCPAL---GTVLANDEVV----DG----VSERGGYPVIQKVMRQWCLRV
SYL_BACFN       RIAYLGNTMVNWCPAL---GTVLANDEVV----DG----VSERGGYPVIQKVMRQWCLRV
SYL_PARD8       RIAYRGETMVNWCAAL---GTVLANDEVV----NG----VSERGGYPVEQKIMRQWCLRV
SYL_PORGI       RLAYLGDTMVNWCPAL---GTVLANDEVK----DG----VSERGGHPVEQKKMRQWCLRV
SYL_FLAPJ       RLTYLAETEVNWCPGL---GTVLANDEII----NG----VSERGGHPVIRKKMTQWSMRI
SYL_FLAJ1       RMTYLAETEVNWCPGL---GTVLANDEIV----NG----VSERGGFPVIRKKMTQWSMRI
SYL_GRAFK       RLTYLAEAEVNWCPQL---GTVLANDEIV----NG----VSERGGYPVVRKKMTQWSMRI
SYL_CYTH3       RLTYLSETMVNWCPGL---GTVLANEEVK----DG----LSERGGFPVERKKMKQWSMRI
SYL_BDEBA       GLAYQKEVPVNWCPAL---KTVLANDEVV----DG----KSERGGHPVIRVPMKQWMLKI
SYL_SORC5       GLAYQDEVSVNWCPAL---GTVLANEEVI----DG----KSERGSHPVYRTPLRQWMLRI
SYL_TREDE       GLAYEKEAPINWCPSC---LTGLANEEVKD---G-----KCERCGAQIQRKNLRQWILKI
SYL_TREPA       GLAYEATAPINWCPSC---KTGLANEEVRD---A-----CCERCGAEVTRRGVRQWMVRI
SYL_BORAP       GLAYAKEMPVWYCPEL---GTVLANEEIIQ---TPNGP-KSERGFHNVEKKYLRQWVLKI
SYL_BORBP       GLAYAKEMPVWYCPEL---GTVLANEEIIQ---TPDGP-KSERGFHNVEKKYLRQWVLKI
SYL_BORBU       GLAYVKEMPVWYCPEL---GTVLANEEIIQ---TSDGP-KSERGSYSVEKKYLRQWVLKI
SYL_CHLTR       GLAYMADMAVNYCPEL---GTVLSNEEIEN---G-----FSVDGGYPVERRMLRQWVLRI
SYL_CHLTA       GLAYMADMAVNYCPEL---GTVLSNEEIEN---G-----FSVDGGYPVERRMLRQWVLRI
SYL_CHLMU       GLAYMADMAVNYCPEL---GTVLSNEEVEN---G-----FSVEGGYPVERRMLRQWVLRI
SYL_CHLFF       GLAYMADMAVNYCPEL---GTVLSNEEVEN---G-----LSIEGGYPVERRMLRQWILRI
SYL_CHLCV       GLAYMADMAVNYCPEL---GTVLSNEEVEN---G-----LSVEGGYPVERRMLRQWILRI
SYL_CHLAB       GLAYMADMAVNYCEEL---GTVLANEEVEN---G-----LSIEGGYPVERRMLRQWILRI
SYL_CHLPN       GLAYMADMAVNYCPEL---GTVLSNEEVEN---G-----FSIEGGYPVERKMLRQWILKI
SYL_PARUW       GLAYEAEMLVNYCPAL---GTVLANEEIEN---G-----KTKDGGHPVERRPLKQWILKI
SYL_ALKOO       GLAYKKEMSINWCTSC---KVGLANEEVVN---G-----GCERCGAEVVRKQKNQWMLKI
SYL_UREP2       NLAEIQDIDVNWCENL---GTVLSNEEVVL---NDKNERVSERGGHPVVRKPMKQWVLKI
SYL_UREPA       NLAEIQDIDVNWCENL---GTVLSNEEVVL---NDKNERVSERGGHPVVRKPMKQWVLKI
SYL_MYCPU       GLAVLADIDVNWCEEL---GTVLANEEVLI---DKDGNKVSERGSFPVVKKKMRQWVLKI
SYL_MYCPE       GLAEIKDIDVNWCQEL---GTVLANEEVLT---DEKGNKVSERGKYPVIKKPMKQWVLKI
SYL_MYCGA       DLAYQADIEVNWCEQL---GTVLANEEVLT---DENGNKISERGSYPVIKKKMRQWVLKI
SYL_MYCGE       NLAELVDIDVNWCEQL---GTVLANEEVLI---DSNGNAVSERGSFSVEKRKMKQWVLKI
SYL_MYCPN       GLAEVKEIDVNWCAEL---GTVLANEEVLI---DSNGNAVSERGEFPVTKRKMKQWVLKI
SYL_MYCCT       GLAENRNIDVNWCQEL---GTVLANDEIIE----KDGLMVSERGEYPVVKKKMRQWVLKI
SYL_MYCMS       GLAENRDIDVNWCQEL---GTVLANDEIIE----KDGLMVSERGEYPVVKKKMRQWVLKI
SYL_MESFL       GLAENRDVEVNWCQEL---GTVLANDEIIE----KDGLMVSERGEHPVTKRKMRQWVLKI
SYL_ACHLI       GLAVLKDVEVNWCEGL---GTVLANDEIEI----INGQMVSERGHYPVIKKPMRQWVLRI
SYL_PSEA6       GLVYKKNSTVNWDPVD---HTVLANEQVI--DGRGWR------SGALVEQKEIPQWFIKI
SYL_COLP3       GLVYKKNATVNWDPVD---QTVLANEQVI--DGRGWR------SGALVERKQIPQWFIKI
SYL_IDILO       GLVYKKNATVNWDPVD---QTVLANEQVI--DGRGWR------SGAKVEQKEIPQWFIKI
SYL_PSEHT       GLVYKKMSTVNWDPVD---QTVLANEQVI--DGRGWR------SGAVVEQKEIPQWFIKI
SYL_PSYIN       DLVYKKMATVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEQKEIPQWFIKI
SYL_SALCH       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SALTI       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SALTY       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SALPB       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SALPA       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_CITK8       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SALAR       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDSKVERKEIPQWFIKI
SYL_SHIFL       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SHIF8       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SHIBS       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECOL6       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECOL5       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECO57       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SHISS       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECOLI       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECOLC       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SHIDS       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECOHS       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECOUT       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECOK1       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ECO24       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_KLEP7       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_CROS8       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_ENT38       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_YERPA       GMVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_YERP3       GMVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_YERPE       GMVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_YERPN       GMVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_YERPS       GMVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_YERPP       GMVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_YERE8       GMVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SERP5       GLVYKKTSAVNWCPHD---LTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_PECAS       GLVYKKTSAVNWCPND---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFIKI
SYL_SODGM       GLVYKKTSAVNWCPQD---QTVLANEQVI--DGCCWR------CDTKVERKEIPQWFVKI
SYL_PHOLL       GLVYKKTSSVNWCPHD---LTVLANEQVV--DGCCWR------CDSKVERKEIPQWFIKI
SYL_MANSM       GLVYKKTSVVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQKEIPQWFIKI
SYL_ACTSZ       GLVYKKTSVVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQREIPQWFIKI
SYL_HAES1       GLVYKKTSTVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQKEIPQWFIKI
SYL_HISS2       GLVYKKTSTVNWCPND---ETVLANEQVH--EGGCWR------CDTPVEQKEIPQWFIKI
SYL_PASMU       GLVYKKTSTVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQKEIPQWFIKI
SYL_HAEIG       GLVYKKTSTVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQKEIPQWFIKI
SYL_HAEIN       GLVYKKTSTVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQKEIPQWFIKI
SYL_HAEI8       GLVYKKTSTVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQKEIPQWFIKI
SYL_HAEIE       GLVYKKTSTVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQKEIPQWFIKI
SYL_ACTP2       GLVYKKTSTVNWCPND---ATVLANEQVH--EGCCWR------CDTPVEQREIPQWFIKI
SYL_HAEDU       GLVYKKTSTVNWCPND---ETVLANEQVH--EGCCWR------CDTPVEQRDIPQWFIKI
SYL_SHESA       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHESM       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHESR       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHEON       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHEB9       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHEB5       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHEB8       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHESW       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHEPC       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHEAM       GLVYKKTSAVNWCPND---QTVLANEQVQ--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_SHEHH       GLVYKKTSSVNWCPND---ETVLANEQVI--DGCCWR------CDTTVEQKEIPQWFIKI
SYL_SHEPA       GLVYKKTSSVNWCPND---ETVLANEQVI--DGCCWR------CDTTVEQKEIPQWFIKI
SYL_SHELP       GLVYKKTASVNWCPND---ETVLANEQVQ--DGCCWR------CDTQVVQKEIPQWFIKI
SYL_SHESH       GLVYKKTASVNWCPND---ETVLANEQVI--DGCCWR------CDTTVEQKEIPQWFIKI
SYL_SHEDO       GMVYKKTSSVNWCPND---ETVLANEQVQ--DGCCWR------CDTPVIQKEIPQWFIKI
SYL_SHEFN       GLVYKKTSSVNWCPND---ETVLANEQVQ--DGCCWR------CDTEVIQKEIPQWFIKI
SYL_VIBPA       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_VIBCB       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_VIBVU       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_VIBVY       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_VIBCH       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_VIBC3       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKEIPQWFIKI
SYL_ALIF1       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKKIPQWFIKI
SYL_PHOPR       GLVYKKTSSVNWCPND---QTVLANEQVE--DGCCWR------CDTPVEQKKIPQWFIKI
SYL_AERS4       GLVYKKTSSVNWCPND---MTVLANEQVV--DNCCWR------CDTPVEQKEIPQWFIKI
SYL_AERHH       GLVYKKTSSVNWCPND---MTVLANEQVV--DNCCWR------CDTPVEQKEIPQWFIKI
SYL_MARHV       GLVYKKMSTVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEQKKIPQWFIRI
SYL_HAHCH       GLVYKKMSTVNWDPVD---ETVLANEQVI--DGKGWR------SGAVVERREIPQWFIKI
SYL_SACD2       GLAYKKVASVNWCPND---QTVLANEQVV--DGQCWR------CDTAVERKEIPQWFIRI
SYL_MARMS       GLAYKKTAAVNWCPED---QTVLANEQVE--DGCCWR------CGTNVEKKEISQWFIRI
SYL_ALCBS       GLVYRKMSTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEQKEIPQWFIKI
SYL_PSEAB       GVIYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_PSEAE       GVIYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_PSEA7       GVIYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_PSEU5       GVIYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_PSEMY       GVIYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_PSEP1       GIIYRKNGTVNWDPAD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFRI
SYL_PSEPK       GIIYRKNGTVNWDPAD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFRI
SYL_PSEPG       GIIYRKNGTVNWDPAD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFRI
SYL_PSEE4       GVIYRKNGTVNWDPAD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFRI
SYL_PSEU2       GVIYRKNGTVNWDPID---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_PSE14       GVIYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_PSESM       GVIYRKNGTVNWDPID---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_NEIMB       GIVYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_NEIMF       GIVYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_NEIG1       GIVYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_NEIM0       GIVYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_NEIMA       GIVYRKNGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYFKI
SYL_CHRVO       GVIYKKNGVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKREIPMYYFRI
SYL_THIDA       GVIYKKMATVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKRDIPMYFFRI
SYL_DECAR       GLVYKKLGTVNWDPVD---HTVLANEQVI--DGRGWR------SGALIEKREIPMYYMKI
SYL_AZOSB       GLIYKKLGTVNWDPVD---ETVLANEQVI--DGRGWR------SGALVEKREIPMYYMKI
SYL_CUPMC       GIAYRKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGAVVEKREIPMYYLRI
SYL_CUPPJ       GIAYRKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGAIVEKREIPMYYLRI
SYL_RALSO       GIAYRKTGTVNWDPID---QTVLANEQVI--DGRGWR------SGAVVEKREIPMYYLRI
SYL_JANMA       GIIYKKTGTVNWDPID---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYARI
SYL_HERAR       GIIYKKTGSVNWDPID---QTVLANEQVI--DGRGWR------SGALIEKREIPMYYARI
SYL_BURCH       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYLRI
SYL_BURCA       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYLRI
SYL_BURL3       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYLRI
SYL_BURCM       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYLRI
SYL_BURVG       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYLRI
SYL_BURP0       GVAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYMRI
SYL_BURPS       GVAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYMRI
SYL_BURP6       GVAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYMRI
SYL_BURP1       GVAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYMRI
SYL_BURM7       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGAFVEKREIPMYYMRI
SYL_BURM9       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGAFVEKREIPMYYMRI
SYL_BURMA       GVAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGAFVEKREIPMYYMRI
SYL_BURMS       GVAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGAFVEKREIPMYYMRI
SYL_BURTA       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYMRI
SYL_PARXL       GIAYKKTGTVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPMYYMRI
SYL_POLAQ       GVAYRKTQVVNWDPID---QTVLANEQVI--DGRGWR------SGALVEKREIPGYYFNI
SYL_BORBR       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGRGWR------SGAPVEKREIPGYYLRI
SYL_BORPA       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGRGWR------SGAPVEKREIPGYYLRI
SYL_BORPE       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGRGWR------SGAPVEKREIPGYYLRI
SYL_BORPD       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKREIPGYYLRI
SYL_BORA1       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGRGWR------SGAPVEKREIPGYYLRI
SYL_METPP       GIAYKKTQVVNWDPVD---QTVLANEQVI--DGRGWR------SGAPVERREIPGYYLAI
SYL_ACISJ       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGRGWR------TGALVEKREIPGYYLKI
SYL_ACIAC       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGRGWR------TGALVEKREIPGYYLKI
SYL_RHOFT       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGKGWR------TGATVEKREIPGYYLKI
SYL_VEREI       GIAYRKTQVVNWDPVD---QTVLANEQVN--EGKGWR------TGAVVEKREIPGYYLKI
SYL_POLNA       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGKGWR------TGATVEKREIPGYYLKI
SYL_POLSJ       GIAYRKTQVVNWDPVD---QTVLANEQVI--DGKGWR------TGATVEKREIPGYYLKI
SYL_METCA       GLIYKKTAPVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKRDIPMYFMRI
SYL_DICNV       GVIYRKLGAVNWDPVD---QTVLANEQVI--DGRGWR------SGAIVEKREIPMYYFRI
SYL_PSYCK       GLVYKKLATVNWDPVD---NTVLANEQVI--DGKGWR------SGAMVEKRDIPMYYFNI
SYL_PSYA2       GLVYKKLATVNWDPID---NTVLANEQVI--DGKGWR------SGAMVEKRDIPMYYFNI
SYL_PSYWF       GLVYKKLATVNWDPVD---NTVLANEQVV--DGKGWR------SGAPVEKRDIPMYYFKI
SYL_ACIAD       GLIYRKLSTVNWDPVD---QTVLANEQVE--NGRGWR------SGALVEKRDIPMYYFRI
SYL_NITEU       GIAYQKTQVVNWDPVD---QTVLANEQVI--DGCGWR------TGAVVEKREIPGYYLAI
SYL_NITEC       GIAYQKTQVVNWDPVD---QTVLANEQVI--DGCGWR------TGAVVEKREIPGYYLAI
SYL_NITMU       GLAYRTTGIVNWDPVD---QTVLANEQVI--DGRGWR------TGALVEKHEIPMYYMKI
SYL_METFK       GLIYKKTATVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEKRDIPQYFMKI
SYL_HYDCU       GLVYRKLSVVNWDPVD---QTVLANEQVI--DGKGWR------SGVPVERKEIAQWFLRI
SYL_XYLFA       GLAYRRNALVNWDPVD---QTVLANEQVI--DGRGWR------SGAPVEKREIPQWFLRI
SYL_XYLFT       GLAYRRNALVNWDPVD---QTVLANEQVI--DGRGWR------SGAPVEKREIPQWFLRI
SYL_XANC8       GLAYRRNAVVNWDPID---QTVLANEQVI--DGRGWR------SGALVEKREIPQWFLRI
SYL_XANCP       GLAYRRNAVVNWDPID---QTVLANEQVI--DGRGWR------SGALVEKREIPQWFLRI
SYL_XANCB       GLAYRRNAVVNWDPID---QTVLANEQVI--DGRGWR------SGALVEKREIPQWFLRI
SYL_XANC5       GLAYRRNAVVNWDPID---QTVLANEQVI--DGRGWR------SGALVEKREIPQWFLRI
SYL_XANAC       GLAYRRNAVVNWDPID---QTVLANEQVI--DGRGWR------SGAVVEKREIPQWFLRI
SYL_XANOR       GLAYRRNAVVNWDPID---QTVLANEQVI--DGRGWR------SGAVVEKREIPQWFLRI
SYL_XANOM       GLAYRRNAVVNWDPID---QTVLANEQVI--DGRGWR------SGAVVEKREIPQWFLRI
SYL_NITOC       GLVYKKTALVNWDPVD---QTVLANEQVI--DGRGWR------SGALVERREIPQWFLKI
SYL_ALKEH       GLVYKKTATVNWDPVD---QTVLANEQVV--DGRGWR------SGAVVERRDIPQWFLRI
SYL_HALHL       GLVYRDTAAVNWDPVD---QTVLANEQVI--EGRGWR------SGALVERREIPQWFLRI
SYL_CHRSD       GLVYKKMSTVNWDPVD---QTVLANEQVI--EGRGWR------SGALVERKEIPLWFLKI
SYL_BUCAI       KLVYKKNSLVNWCSYD---KTVLANEQVI--DGCCWR------CQNKIRIKQIPQWFIKI
SYL_BUCAP       KLVYKKNSFVNWCPYD---KTVLANEQVI--KGCCWR------CQNKIKVKKIPQWFIKI
SYL_BUCCC       KLIYKKKSIVNWCEKD---KTVLANEQVQ--KGVCWR------CGTKIKLRKISQWFIKI
SYL_BUCBP       NLVYKKKSWVNWCEYD---KTVLANEQVI--NELCWR------CNNKVIKKKIFQWFIKI
SYL_WIGBR       NKAYKKKSIVNWCPKD---KTVLANEQVI--DNLCWR------CSSNIEMKKIFQWFIKI
SYL_BLOPB       GLVYKKTASVNWCSYH---KTVLANEQVT--NNCCWR------CHTPVKYKRIPQWFIRI
SYL_BLOFL       GLVYRKTTLVNWCPYH---NTVLANEQVI--NGGCWR------CHTKIQYKKIPQWFIKI
SYL_BAUCH       GLVYKKTSFVNWCSND---QTVLANEQVI--DGCCWR------CGAPIMLKDIPQWFLKI
SYL_COXBU       GLAYKKNAIVNWDPVD---QTVLANEQIV--DGRGWR------SGAVVERREISQWFLKI
SYL_COXBR       GLAYKKNAIVNWDPVD---QTVLANEQIV--DGRGWR------SGAVVERREISQWFLKI
SYL_COXBN       GLAYKKNAIVNWDPVD---QTVLANEQIV--DGRGWR------SGAVVERREISQWFLKI
SYL_LEGPH       GLVYKKNAVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVERKEISQWFIKI
SYL_LEGPC       GLVYKKNAVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVERKEISQWFIKI
SYL_LEGPA       GLVYKKNAVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVERKEISQWFIKI
SYL_LEGPL       GLVYKKNAVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVERKEISQWFIKI
SYL_FRATT       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKKEIPQWFLKI
SYL_FRAT1       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKKEIPQWFLKI
SYL_FRATW       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKKEIPQWFLKI
SYL_FRATF       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKKEIPQWFLKI
SYL_FRATH       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKKEIPQWFLKI
SYL_FRATO       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKKEIPQWFLKI
SYL_FRATN       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEKKEIPQWFLKI
SYL_FRAP2       GLAYRKNSVVNWDPVD---QTVLANEQVV--DGRGWR------SGALIEKKEIPQWFLKI
SYL_RUTMC       DLVYKKNAIVNWDPVD---QTVLANEQVI--DGRGWR------SNALIEKKKISQWFMRI
SYL_VESOH       NLIYKKKAIVNWDPVD---QTVLANEQVI--NGRGWR------SNALIEKKEISQWFIRI
SYL_RICRS       NLAYQKESFVNWDPVD---NTVLANEQVV--DGRGWR------SGAIVAKRYLKQWFLKI
SYL_RICRO       NLAYQKESFVNWDPVD---NTVLANEQVV--DGRGWR------SGAIVAKRYLKQWFLKI
SYL_RICCN       NLAYQKESFVNWDPVD---NTVLANEQVV--DGRGWR------SGAIVVKRYLKQWFLKI
SYL_RICM5       NLAYQKESLVNWDPVD---NTVLANEQVV--DGRGWR------SGAIVAKRYLKQWFLKI
SYL_RICFE       NLAYQKESLVNWDPVD---NTVLANEQVV--DGRGWR------SGAIVEKRYLKQWFLKI
SYL_RICAH       NLAYQKESLVNWDPVD---NTVLANEQVV--DGRGWR------SGAVVEKRYLKQWFLKI
SYL_RICCK       NLAYQKEALVNWDPVD---NTVLANEQVV--DGRGWR------SGAIIEKRYLKQWFLKI
SYL_RICBR       NLAYQKESLVNWDPVD---NTVLANEQVV--DGRGWR------SGAIVEKRYLKQWFLKI
SYL_RICPR       NLVYQKESLVNWDPVD---NTVLANEQVV--DGRGWR------SGAIIEKRYLKQWFLKI
SYL_RICTY       DLVYQKESLVNWDPVD---NTVLANEQVV--NGRGWR------SGAIIEKRYLNQWFLKI
SYL_ORITB       GLVYQKESLVNWDPID---QTVLANEQVI--NGKGWR------SGAIIEYRNLKQWFIKI
SYL_WOLPM       GLAYRKESWVNWDPVD---QTVLANEQVV--DGKGWR------SGAVVEKRKLSQWFLKI
SYL_WOLTR       GLVYRKKSWVNWDPID---QTVLANEQVV--DGKGWR------SGAIVEKRELSQWFLKI
SYL_EHRRW       GLAYRKESLVNWDPVD---QTVLANEQVI--DGRGWR------SGAIIEKRKLSQWFLKI
SYL_EHRRG       GLAYRKESLVNWDPVD---QTVLANEQVI--DGRGWR------SGAIIEKRKLSQWFLKI
SYL_EHRCJ       GLAYRKESLVNWDPID---QTVLANEQVI--DGKGWR------SGAVVEKRKLSQWFLKI
SYL_EHRCR       GLAYRKESLVNWDPVD---QTVLANEQVI--DGRGWR------SGAVVEKRKLFQWFLKI
SYL_ANAMM       GLAYRKESWVNWDPVD---NTVLANEQVV--DGRGWR------SGAKIERRKLSQWFLKI
SYL_NEOSM       GLAYRKNSEVNWDPID---KTVLANEQVI--DGRGWR------SGAVVVKRKIPQWFLKI
SYL2_RHIL3      GLVYRKQSKVNWDPVD---NTVLANEQVI--DGRGWR------SGALVEQRELTQWFFKI
SYL_RHIEC       GLVYRKQSKVNWDPVD---NTVLANEQVI--DGRGWR------SGALVEQRELTQWFFKI
SYL_RHIME       GLVYRKQSKVNWDPVD---NTVLANEQVI--EGRGWR------SGALVEQRELTQWFFRI
SYL_SINMW       GLVYRKQSKVNWDPVD---NTVLANEQVI--DGRGWR------SGALVEQRELTQWFFRI
SYL_AGRFC       GLVYRKQSKVNWDPVD---HTVLANEQVI--DGRGWR------SGALVEQRELTQWFFRI
SYL_BRUAB       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BRUA2       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BRUSI       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BRUO2       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BRUME       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BRUSU       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BRUC2       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_OCHA4       GLVTRKTSKVNWDPVD---NTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_CHESB       GLVRRKTSKVNWDPVE---QTVLANEQVI--DGRGWR------SGALVEQRELAQWFFKI
SYL_RHILO       GLVTRKSSKVNWDPED---MTVLANEQVI--DGRGWR------SGALVEQRELTQWFFKI
SYL_BART1       GLVARKVAKVNWDPVD---HTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BARHE       GLVARKVAKVNWDPVD---QTVLANEQVV--DGRGWR------SGALVEQRELTQWFFKI
SYL_BARQU       GLVARKVAKVNWDPVD---QTVLANEQVV--DGCGWR------SGALVEQRELAQWFFKI
SYL_BARBK       GLVVRKVAKVNWDPVD---QTVLANEQVI--DGRGWR------SGALVEQRELTQWFFKI
SYL_RHOP2       GLAERETRKLNWDPVD---MTVLANEQVI--DGRGWR------SGAVVEQREMNQWVFKI
SYL_RHOPS       GLAERETRKLNWDPVD---MTVLANEQVI--DGRGWR------SGAVVEQREMNQWVFKI
SYL_RHOPA       GLVEREKRKLNWDPVD---MTVLANEQVI--DGRGWR------SGAVVELREMNQWVFKI
SYL_RHOP5       GLAEREKRKINWDPVD---MTVLANEQVI--DGRGWR------SGAVVEQREMNQWVFKI
SYL_NITHX       GLAEREKRKINWDPVD---MTVLANEQVI--DGRGWR------SGAVVEQREMNQWVFKI
SYL_NITWN       GLAEREKRKINWDPVD---MTVLANEQVI--DGRGWR------SGAVVEQREMNQWVFKI
SYL_BRASB       GLVEREQRKVNWDPVD---MTVLANEQVI--DGRGWR------SGAVVEQREMNQWVFKI
SYL_BRASO       GLVEREQRKVNWDPVD---MTVLANEQVI--DGRGWR------SGAVVEQREMNQWVFKI
SYL_BRADU       GLAEREKRKVNWDPVD---MTVLANEQVI--DGKGWR------SGAIVEQREMNQWVFKI
SYL_RHOPB       GLVERKQSKVNWDPVD---NTVLANEQVI--DGRGWR------SGALVEQRELTQWFFKI
SYL_AZOC5       DLAYRKESEVNWDPVD---NTVLANEQVI--DGRGWR------SGAVVERRKLNQWFFRI
SYL_PARL1       GLVSRKKSMVNWDPVD---NTVLANEQVI--DGRGWR------SGALVERRELTQWFLKI
SYL_CAUVC       GLVYRKEASVNWDPVD---MTVLANEQVI--DGKGWR------SGAVVEKRKLTQWFLRI
SYL_CAUSK       GLVYRKEASVNWDPVD---MTVLANEQVI--DGKGWR------SGATVEKRKLTQWFLRI
SYL_MARMM       GLLHRKTAKVNWDPVD---QTVLANEQVI--DGRGWR------SGALVVQRELDQWFFKI
SYL_HYPNA       GLVYRKASKVNWDPVD---NTVLANEQVI--DGRGWR------SGAPVEQRELTQWFFKI
SYL_RUEST       GLVYRKNAVVNWDPVD---MTVLANEQVE--NGRGWR------SGALVERRELTQWFFKI
SYL_RUEPO       GLVYRKNAVVNWDPVD---MTVLANEQVE--DGRGWR------SGALVERRELTQWFFKI
SYL_ROSDO       GLVYRKNAIVNWDPVD---MTVLANEQVE--QGRGWR------SGALVERRELTQWFFKI
SYL_JANSC       GLIDRKNAVVNWDPVD---MTVLANEQVE--DGKGWR------SGAEVERKELTQWFFKI
SYL_DINSH       GLVYRKNAVVNWDPVD---MTVLANEQVI--DGKGWR------SGAEVERRELTQWFFKI
SYL_RHOS1       GLVYRKNAVVNWDPVD---MTVLANEQVI--DGKGWR------SGAPVVRRELTQWFFRI
SYL_RHOS4       GLVYRKNAVVNWDPVD---MTVLANEQVI--DGKGWR------SGAPVVRRELTQWFFRI
SYL_RHOS5       GLIYRKNAVVNWDPVD---MTVLANEQVI--DGKGWR------SNAPVERRELTQWFFRI
SYL_PARDP       GLITRKSAQVNWDPVD---MTVLANEQVI--DGKGWR------SGATVERKELTQWFFKI
SYL_ZYMMO       GLVYRKESAVNWDPID---NTVLANEQVI--DGRGWR------SGALVERKKLNQWFLKI
SYL_SPHWW       GLVYRKESAVNWDPVD---MTVLANEQVI--DGRGWR------SGALVERRKLNQWFLKI
SYL_NOVAD       GLVYRKESTVNWDPVD---MTVLANEQVI--DGRGWR------SGALVEKRKLNQWFLKI
SYL_SPHAL       GLVYRKESYVNWDPVD---MTVLANEQVI--DGRGWR------SGALVEKKKLSQWFLKI
SYL_GRABC       NLVERRESWVNWDPVD---ETVLANEQVI--DGKGWR------SGAPVERKKLSQWFLRI
SYL_GLUOX       GLVERRDSLVNWDPVD---ETVLANEQVV--DGRGWR------SGALIEKKKLSQWFLKI
SYL_ACICJ       GLAYRRESAVNWDPVD---MTVLANEQVI--DGRGWK------SGAPVEKRKLRQWFFRI
SYL_MAGSA       GLVYRKESWVNWDPVE---NTVLANEQVI--DGRGWR------SGALVEKRLLSQWFLKI
SYL_RHORT       GLAYRRESWVNWDPVE---HTVLANEQVI--DGKGWR------SGAPVERRKLSQWFLRI
SYL_MAGMM       GLVYRKHAFVNWDPVD---HTVLANEQVI--DGCGWR------SGAPVEQRELNQWFFRI
SYL_CAMJ8       GLIYTKEANVNWCEQD---QTVLANEQVE--DGKCWR------CGHEVVQKKMPGYYVKI
SYL_CAMJJ       GLIYTKEANVNWCEQD---QTVLANEQVE--DGKCWR------CGHEVAQKKMPGYYVKI
SYL_CAMJR       GLIYTKEANVNWCEQD---QTVLANEQVE--DGKCWR------CGHEVVQKKMPGYYVKI
SYL_CAMJE       GLIYTKEANVNWCEQD---QTVLANEQVE--DGKCWR------CGHEVVQKKMPGYYVKI
SYL_CAMJD       GLIYTKEANVNWCEQD---QTVLANEQVE--DGKCWR------CGHEVVQKKMPGYYVKI
SYL_CAMC1       GLVYRKNAIVNWCEYD---QTVLANEQVE--DGKCWR------CGNDVVQKELPGYYFNI
SYL_CAMC5       GLVYRKSAIVNWCEHD---QTVLANEQVE--DGCCWR------CGNEVVQREFPGYYFKI
SYL_CAMFF       GLVYRKSAVVNWCEND---QTVLANEQVE--DGKCWR------CGHEVIQKEMPGYYLKI
SYL_CAMHC       GLIYRKNAVVNWCEQD---QTVLANEQVE--DGKCWR------CGNEVVQKEMPGYYLKI
SYL_ARCB4       GIIYRKSATVNWCPHD---QTVLANEQLE--EGCCWR------CGTEVVQKEMPGYYIGI
SYL_NITSB       GLLYRKKAAVNWCPHD---KTVLANEQVI--EGRCWR------CDTEVVQKEIEQYFLKI
SYL_WOLSU       GLIYRKKGFLNWCPND---QTVLANEQVI--EGRCWR------CDTEVVQKEMFQYYVKI
SYL_HELHP       GLIYRKEAYLNWCPKD---KTILANEQVI--EGKCWR------CDTPVVQKQMFQYYIKI
SYL_HELPY       GLIYRKKAMLNWCPND---KTVLANEQVI--DGRCWR------CDTEVIQKELYQYYLKI
SYL_HELPH       GLIYRKKAMLNWCPND---KTVLANEQVI--DGRCWR------CDTEVVQKELYQYYLKI
SYL_HELPJ       GLIYRKKAMLNWCPND---KTVLANEQVI--DGRCWR------CDTEVIQKELYQYYLKI
SYL_HELAH       GLIYRKKAMLNWCPND---KTVLANEQVI--EGRCWR------CDTEVVQKELYQYYLKI
SYL_THEMA       GLAYKKKAAVNWCPKC---KTVLANEQVK--DGKCER------CGTSVTIRHLEQWFFKI
SYL_THEP1       GLAYKKKAAVNWCPKC---KTVLANEQVK--DGKCER------CGTSVTIRHLEQWFFKI
SYL_THEM4       GLAYKKKAAVNWCPSC---QTVLANEQVV--DGKCER------CGTEVTMKHLEQWYFKI
SYL_FERNB       GLAYKKPGAVNWCPSC---QTVLANEQVK--DGKCER------CGTTVTMKYLEQWYFKI
SYL_PSELT       GLAYKKKAAVNWCPKC---MTSLANEQVK--DGRCER------CDTPVTIKHLEQWFFKI
SYL_CALS8       GLAYRKRSYVNWCPSC---ETVLANEQVV--NGRCER------CKSLVGKKDLEQWFFRI
SYL_HUNT2       GLAYKKKAYVNWCPSC---ATVLANEQVV--NGVCER------CKSVVGKKDLEQWFFKI
SYL_DESHY       GLVYKKKAGVNWCPSC---ATVLANEQVV--DGACER------CDTAVTKKDLEQWFFKI
SYL_SYNWW       KLAYKKKSAVNWCPSC---QTVLANEQVV--DGACER------CEAVIEKKQLEQWFFKI
SYL_CARHZ       GLAYKKKAPVNWCPGC---QTVLANEQVI--DGECER------CHSRVEKKELEQWFFKI
SYL_PELTS       GLAYKKKAAVNWCPGC---ATVLANEQVK--DGGCER------CKAPVEKRELEQWFFKI
SYL_MOOTA       GLAYRKKAAVNWCPSC---ATVLANEQVV--DGACER------CHTPVMRKDLEQWFFRI
SYL_DESRM       GLCYKKHARVNWCPDC---ATVLANEQVV--DGACER------CSAVVEQKELDQWFFRI
SYL_SYMTH       GLAYKKTAPVNWCPSC---QTVLANEQVE--DGRCWR------CDSVVTKKDLAQWFFRI
SYL_DESVH       GLVYRKKAAQNWCPKC---HTVLANEQVI--EGLCWR------CDSAVEQKELTQWFLRI
SYL_DESVV       GLVYRKKAAQNWCPKC---HTVLANEQVI--EGLCWR------CDSAVEQKELTQWFLRI
SYL_DESAG       GLIYRKKAPQNWCPKC---NTVLANEQVI--DGLCWR------CDSVVEQRDLAQWFLRI
SYL_LAWIP       GLVYRKKAPQNWCPSC---NTVLANEQVI--EGSCWR------CDTSIIQKELTQWFLKI
SYL_GEOMG       GLAYKKTSYVNWCPKC---ETVLANEQVE--DGACWR------CDSEVTQKELEQWFFRI
SYL_GEOSL       GLVYKKSSFVNWCPAC---ETVLANEQVE--DGCCWR------CDSDVTQKELDQWFFRI
SYL_GEOUR       GLAYKKISSVNWCPKC---ETVLANEQVE--DGCCWR------CDSNVDQKELEQWSFRI
SYL_PELPD       GLAYKKTSYVNWCPTC---ETVLANEQVE--DGACWR------CDSPVQQKELDQWFFRI
SYL_PELCD       GLAYKKSSFVNWCSEC---QTVLANEQVE--NDACWR------CGTVVEQKELEQWFFKI
SYL_SYNAS       GLAYKKTSSVNWCPRC---QTVLANEQVE--AGLCWR------CGSEVVEKILDQWFFRI
SYL_SYNFM       GLAYKRSAYVNWCGTC---LTVLANEQVE--GGACWR------CDQPVVQKEMEQWFFKI
SYL_DESPS       GLIYEKVTTVNWCDTC---QTVLANEQVI--EGACWR------CDQLVHPRKMNGWFFKI
SYL_FUSNN       GLIYKKKSLVNWCPDC---QTVLANEQVE--DGMCWRH-----SKTHVIQKELEQWFFKI
SYL_TRIV2       GLAYQKEAAVNWDPID---QTVLANEQVDN-EGRSWR------SGAIVERKLLRQWFLKI
SYL_NOSS1       GLAYQKEAAVNWDPID---QTVLANEQVDN-EGRSWR------SGAIVERKLLRQWFLKI
SYL_ACAM1       GLAYQKEAAVNWDPVD---QTVLANEQVDN-EGRSWR------SGAKVERKLLRQWFLKI
SYL_TRIEI       GLAYQKESAVNWDPID---QTVLANEQVDG-EGRSWR------SGAKVERKMLRQWFFKI
SYL_SYNY3       GLAYQKEATVNWDPID---QTVLANEQVDS-EGRSWR------SGAMVERKLLRQWFLKI
SYL_SYNE7       GLAYQKEATVNWDPID---QTVLANEQVDS-EGRSWR------SGAKVERRQLKQWFLKI
SYL_SYNP6       GLAYQKEATVNWDPID---QTVLANEQVDS-EGRSWR------SGAKVERRQLKQWFLKI
SYL_THEEB       GLAYQKEAAVNWDPVD---QTVLANEQVDS-EGRSWR------SGALVERRLLKQWFLKI
SYL_SYNJB       GLAYQKEAPVNWDPVD---QTVLANEQVDA-EGRSWR------SGALVEKRMLKQWFFKI
SYL_SYNJA       GLAYQKEAPVNWDPVD---QTVLANEQVDA-EGRSWR------SGALVEKRLLKQWFLKI
SYL_GLOVI       GLAYRKAGVVNWDPVD---QTVLANEQVDA-EGRSWR------SGALVEKRPLEQWYLKI
SYL_SYNS3       GLAYQKDATVNWDPVD---QTVLANEQVDA-DGRSWR------SGALVEKRDLRQWFLRI
SYL_SYNPW       GLAYQKDATVNWDPVD---QTVLANEQVDS-EGRSWR------SGALVEQKNLRQWFLRI
SYL_PROMM       GLAYQKEATVNWDPVD---KTVLANEQVDG-EGRSWR------SGALVEQRQLKQWFLRI
SYL_PROM3       GLAYQKEATVNWDPID---KTVLANEQVDG-EGRSWR------SGALVEQRQLKQWFLRI
SYL_SYNSC       GLAYRKNATVNWDPVD---QTVLANEQVDG-DGRSWR------SGALVEQRQLNQWFLRI
SYL_SYNS9       GLAYRKNATVNWDPVD---QTVLANEQVDA-DGRSWR------SGALVEQRQLNQWFLRI
SYL_SYNPX       GLAYRKNATVNWDPVD---QTVLANEQVDA-DGRSWR------SGALVEQRQLNQWFLRI
SYL_SYNR3       DLAYRKEATVNWDPID---QTVLANEQVDA-DGRSWR------SGALAEKRKLRQWFLKI
SYL_PROMT       NLAYQKKATVNWDPID---QTVLANEQVDA-EGKSWR------SGAKVEKKELNQWFLRI
SYL_PROM1       NLAYQKKATVNWDPID---QTVLANEQVDA-EGKSWR------SGAKVEKKELNQWFLRI
SYL_PROMA       GLAYQKSATVNWDPID---KTVLANEQVDA-NGRSWR------SGALVEKKKLKQWFLKI
SYL_PROM0       GLVYQKESEVNWDPID---NTVLANEQVDS-EGKSWR------SGAIVEKKLLKQWFLRI
SYL_PROM9       GLVYQKESEVNWDPID---NTVLANEQVDS-EGKSWR------SGALVEKKLLKQWFLRI
SYL_PROMS       GLVYQKESEVNWDPID---NTVLANEQVDS-EGKSWR------SGAVVEKKLLKQWFLRI
SYL_PROM2       GLVYQKESEVNWDPVD---NTVLANEQVDS-EGKSWR------SGAVVEKKLLKQWFLRI
SYL_PROMP       GLVYQKESEVNWDPID---NTVLANEQVDS-EGKSWR------SGAIVEKKLLTQWFLKI
SYL_PROM5       GLVYQKESEVNWDPID---NTVLANEQVDS-EGKSWR------SGAKVEKKLLTQWFLKI
SYL_SOLUE       GLAYRKRALVNWCPKC---ATVLANEQVV--DGCCWRH-----EGTPVEQRALDQWFLKI
SYL_DEIRA       GLAYKKGGLVNWCPKD---QTVLANEQVV--NGHCER------CGTAVERRNLSQWYLKI
SYL_DEIGD       GLAYKKDGLVNWCPKD---QTVLANEQVV--DGRCER------CGTPVERRNLSQWYLKI
SYL_RUBXD       GLAYREKAPVDWCPSC---NTTLAREQVVGPDRRCER------CDTPVIKRNLAQWLFKI
SYL_CLOPE       GLAYRKKAPVNWCPSC---QTVLANEQVV--DGACER------CSTEVTKKDLTQWFFKI
SYL_CLOPS       GLAYRKKAPVNWCPSC---QTVLANEQVV--DGACER------CSTEVTKKDLTQWFFKI
SYL_CLOP1       GLAYRKKAPVNWCPSC---QTVLANEQVV--DGACER------CSTEVTKKDLTQWFFKI
SYL_CLOB8       GLAYRKKAPVNWCPSC---NTVLANEQVV--DGVCER------CSTEVTKKDLTQWFFKI
SYL_CLOB1       GLAYKKKAPVNWCPSC---NTVLANEQVL--DGKCER------CDSNVDKKNLEQWFLKI
SYL_CLOBH       GLAYKKKAPVNWCPSC---NTVLANEQVL--DGKCER------CDSNVDKKNLEQWFLKI
SYL_CLOBL       GLAYKKKAPVNWCPSC---NTVLANEQVL--DGKCER------CDSNVDKKNLEQWFLKI
SYL_CLONN       GLAYRKNAPVNWCPSC---NTVLANEQVL--DGHCER------CDSLVEKKALTQWFLKI
SYL_CLOAB       GLAYRKKAPANWCPSC---NTVLANEQVV--DGSCER------CGTEVIKKDLTQWFFKI
SYL_CLOK5       DLAYRKNAPVNWCPSC---NTVLANEQVK--EGECER------CGTEVTKKDLTQWFFKI
SYL_CLOTE       NLAYRKNAPVNWCPSC---NTVLANEQVL--DGACER------CSSDVIKKDLTQWFFKI
SYL_CALS4       GLAYRKKAPVNWCPSC---QTVLANEQVI--DGKCER------CGTEVTKKELTQWFFKI
SYL_ROSCS       GLAYRAKATVNWDPVD---QTVLANEQVDA-EGRSWR------SGAKVEKRELEQWFFRI
SYL_ROSS1       GLAYRAKATVNWDPVD---QTVLANEQVDA-EGRSWR------SGAKVEKRELEQWFFRI
SYL_THEFY       GLAYRKDGLVNWCPKD---QTVLANEQVI--QGKCER------CGTEVERRALNQWYFKI
SYL_ACIC1       GLAYRKASPVNWCPND---QTVLANEQVV--GGTCER------CGAQVTKKTLTQWYFRI
SYL_ARTS2       GLAYRKDSPVNWCPKD---QTVLANEQVV--NGACER------CGTAVTKKSLNQWYFKI
SYL_PAEAT       GLAYRKDSPVNWCPKD---LTVLANEQVV--NGACER------CGTPVTKKSLNQWYFKI
SYL_RENSM       GLAYRKNSPVNWCPKD---LTVLANEQVI--NGACER------CGTPVTKKNLNQWYFKI
SYL_CLAMS       GLAYRKDSWVNWDPVD---QTVLANEQVLP-DGTSDR------SGAVVVKKKLTQWYLRI
SYL_CLAM3       GLAYRKDSWVNWDPVD---QTVLANEQVLP-DGTSDR------SGAVVVKKKLTQWYLRI
SYL_LEIXX       GLAYRKASQVNWCPFD---QTVLANEQVV--NGRCER------CDNLVTKKKLTQWYFRI
SYL_KINRD       GLAYRKDSLVNWDPVD---QTVLANEQVLP-DGTSER------SGAKVVKKKLTQWYFRI
SYL_NOCSJ       GLAYRKSSPVNWCPND---QTVLANEQVV--DGRCER------CGAEVTKRELTQWYFKI
SYL_TROW8       GLAYRKKAWVNWDPSD---RTVLANEQVLP-DGTSER------SGALVVKKKLTQWFLRI
SYL_TROWT       GLAYRKKAWVNWDPSD---RTVLANEQVLP-DGTSER------SGALVVKKKLTQWFLRI
SYL_MYCPA       RLVYRADSMVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCA1       RLVYRADSMVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCLE       RLVYRADSMVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCTA       RLVYRADSLVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCBO       RLVYRADSLVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCTU       RLVYRADSLVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCBP       RLVYRADSLVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCUA       RLVYRADSMVNWCPGL---GTVLANEEVTS-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCSS       RLVYRADSMVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCSK       RLVYRADSMVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCSJ       RLVYRADSMVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCS2       RLVYRADSMVNWCPGL---GTVLANEEVTS-EGRSDR------GNFPVFRKRLRQWMMRI
SYL_MYCVP       RLVYLADSVVNWCPGL---GTVLANEEVTS-DGRSER------GNFPVFRKRLRQWMMRI
SYL_MYCGI       RLVYLADSVVNWCPGL---GTVLANEEVTA-DGRSER------GNFPVFRKRLRQWMMRI
SYL_NOCFA       RLVYQTDSMVNWCPGL---GTVLSNEEVTA-EGRSER------GNFPVFRKRLWQWMMRI
SYL_RHOJR       RLVYHSDSMVNWCPGL---GTVLANEEVTA-DGRSDR------GNFPVFRKHLQQWMMRI
SYL_SACEN       RLVYLSEAPVNWAPGL---GTVVANEEVTA-DGLTER------GNFPVFRRNLKQWMMRI
SYL_CORGB       RLVYRSNSTVNWCPGL---GTVLANEEVTA-DGRSER------GNFPVFRKNLSQWMMRI
SYL_CORGL       RLVYRSNSTVNWCPGL---GTVLANEEVTA-DGRSER------GNFPVFRKNLSQWMMRI
SYL_COREF       RLVYRSNSTVNWCPGL---GTVLANEEVTA-DGRSER------GNFPVFRKNLSQWMMRI
SYL_CORDI       RLVYRSHSMVNWCPGL---GTVLANEEVTA-DGRSER------GNFPVFRKKLSQWMMRI
SYL_CORJK       RLVYRSNSTVNWCPGL---GTVLANEEVTA-EGRSER------GNFPVFRKNLQQWMMRI
SYL_STRCO       RLAYASDAPVNWCPGL---GTVLANEEVTA-DGRSER------GNFPVFKSKLRQWNMRI
SYL_STRAW       RLAYASEAPVNWSPGL---GTVLANEEVTA-DGRSER------GNFPVFKAKLRQWNMRI
SYL_SALAI       RLAYVSQAPVNWCPGL---GTVLANEEVTA-DGRSER------GNFPVFKRNLKQWMMRI
SYL_BIFAA       RLAYISKSPVNWCPGL---GTVLANEEVTA-EGKSER------GNFPVFQRELRQWSMRI
SYL_BIFLO       RLAYISKSPVNWCPGL---GTVLANEEVTA-EGKSER------GNFPVFQRELRQWSMRI
SYL_FRACC       RLAYISEQLVNWCPGL---GTVLANEEVTA-DGRSDI------GNYPVFRRPLKQWILRI
SYL_FRAAA       RLAYISEQLVNWCPGL---GTVLANEEVTA-EGRSDI------GNYPVFRRPLRQWVLRI
                           :          :: :::                           :   :

SYL_GEOKA       TAYADRLLEDLEEL-------DWPESIKEMQRNWIGRSEGAEIEFAVHGHD---------
SYL_GEOTN       TAYADRLLEDLEEL-------DWPESIKEMQRNWIGRSEGAEIEFAVDGHD---------
SYL_BACCZ       TAYGDRLLEDLDEL-------DWPESLKDMQRNWIGRSEGAEVHFNIDGTD---------
SYL_BACAH       TAYGDRLLEDLDEL-------DWPESLKDMQRNWIGRSEGAEVHFNIDGTD---------
SYL_BACAN       TAYGDRLLEDLDEL-------DWPESLKDMQRNWIGRSEGAEVHFNIDGTD---------
SYL_BACHK       TAYGDRLLEDLDEL-------DWPESLKDMQRNWIGRSEGAEVHFNIDGTD---------
SYL_BACC1       TAYGDRLLEDLDEL-------DWPESLKDMQRNWIGRSEGAEVHFNIDGTD---------
SYL_BACCR       TAYGDRLLEDLDEL-------DWPESLKDMQRNWIGRSEGAEVHFNIDGTD---------
SYL_BACCN       TAYADRLLEDLDEL-------DWPESLKDMQRNWIGRSEGAEVHFNIDGTD---------
SYL_BACSU       TAYADRLLEDLEEL-------DWPESIKDMQRNWIGRSEGAHVHFAIDGHD---------
SYL_BACVZ       TAYADRLLEDLEDL-------DWPESIKDMQRNWIGRSEGANVHFAIDGTD---------
SYL_BACLD       TAYADRLLEDLEEL-------DWPESIKEMQRNWIGRSEGAHVHFAVDGTN---------
SYL_BACP2       TAYADRLLEDLEDI-------DWPESIKDMQRNWIGRSEGAHVHFEIEGHD---------
SYL_BACHD       TEYADRLLEDLEEL-------DWPESIKDMQRNWIGRSEGAEVTFSVDGHD---------
SYL_BACSK       TAYAERLLEDLEEL-------EWPESLKDMQRNWIGKSEGAEVTFKIN--E---------
SYL_OCEIH       TAYADRLLEDLNEL-------DWPDSLKEMQRNWIGRSEGAEVTFSIKGNE---------
SYL_STAES       TEYADRLLEDLDEL-------DWPESIKDMQRNWIGRSEGAKVTFKIEQSD---------
SYL_STAEQ       TEYADRLLEDLDEL-------DWPESIKDMQRNWIGRSEGAKVTFKIEQSD---------
SYL_STAAW       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTEAE-------
SYL_STAAS       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTEAE-------
SYL_STAAN       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAA1       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAAM       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAA9       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAA2       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAA3       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAAC       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAA8       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAAT       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAAE       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAAB       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNTE---------
SYL_STAAR       TEYADQLLADLDDL-------DWPESLKDMQRNWIGRSEGAKVSFDVDNSE---------
SYL_STAHJ       TEYADRLLEDLDEL-------DWPESIKDMQRNWIGRSEGARVSFEIENKD---------
SYL_STAS1       TEYADRLLEDLDEL-------DWPESLKDMQRNWIGRSEGASVAFDVKDYN---------
SYL_LISMF       TAYADRLLDDLDLV-------DWPENIKDMQRNWIGRSEGAEVTFKIKDSDE--------
SYL_LISMO       TAYADRLLDDLDLV-------DWPENIKDMQRNWIGRSEGAEVTFKIKDSDE--------
SYL_LISIN       TAYADRLLDDLELV-------DWPENIKDMQRNWIGRSEGAEVTFKIKDSDE--------
SYL_LISW6       TAYADRLLDDLDLV-------DWPENIKDMQRNWIGRSEGAEVTFKIKDSDE--------
SYL_ENTFA       TAYADRLLEDLELV-------DWPESIKDMQRNWIGRSEGANVTFKVAGTEE--------
SYL_STRTD       TAYAERLLNDLDEL-------DWPESIKDMQRNWIGKSTGANVTFKVKGTDK--------
SYL_STRT2       TAYAERLLNDLDEL-------DWPESIKDMQRNWIGKSTGANVTFKVKGTDK--------
SYL_STRT1       TAYAERLLNDLDEL-------DWPESIKDMQRNWIGKSTGANVTFKVKGTDK--------
SYL_STRP2       TAYAERLLNDLDEL-------DWSESIKDMQRNWIGKSTGANVTFKVKGTDK--------
SYL_STRR6       TAYAERLLNDLDEL-------DWSESIKDMQRNWIGKSTGANVTFKVKGTDK--------
SYL_STRPN       TAYAERLLNDLDEL-------DWSESIKDMQRNWIGKSTGANVTFKVKGTDK--------
SYL_STRSV       TAYAERLLNDLEEL-------DWPESIKDMQRNWIGKSTGANVTFKIKDTDK--------
SYL_STRGC       TAYAERLLNDLEEL-------DWPESIKDMQRNWIGKSTGANVTFKIKDTDK--------
SYL_STRS2       TAYAERLLNDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKIKDTDK--------
SYL_STRSY       TAYAERLLNDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKIKDTDK--------
SYL_STRPD       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRPG       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRP6       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRPM       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRPF       TAYAERLLEDLEEV-------DWPESIKDMQRNWIDKSTGANVTFKVKDTDK--------
SYL_STRPB       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRPC       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRP3       TVYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRP1       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRP8       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRA3       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRA5       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRA1       TAYAERLLEDLEEV-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDK--------
SYL_STRMU       TAYAERLLEDLEDL-------DWPESIKDMQRNWIGKSTGANVTFKVKDTDE--------
SYL_LACLM       TAYAERLLEDLEEV-------DWPESIKEMQRNWIGKSVGADVTFEVAGTDK--------
SYL_LACLA       TAYAERLLEDLEEV-------DWPESIKEMQRNWIGKSVGADVTFEVAGTDK--------
SYL_LACLS       TAYAERLLEDLEEV-------DWPESIKEMQRNWIGKSVGADVTFKVEGTDK--------
SYL_LACSS       TAYADRLIDDLDLV-------DWPESVKDMQRNWIGRSKGAEVSFAVENHDA--------
SYL_LACDA       TAYADRLLDDLDDL-------DWPEPIKEMQRNWIGRSVGAQVTFKIKDSDK--------
SYL_LACDB       TAYADRLLDDLDDL-------DWPEPIKEMQRNWIGRSVGAQVTFKIKDSDK--------
SYL_LACP3       TAYAEKLLTDLDDL-------DWPESIKQMQRNWIGKSTGAQITFRVTDSHE--------
SYL_LACPL       TAYADRLIDDLDDI-------DWPENIKEQQRNWIGRSVGASIRFKVAGQPDD-------
SYL_LACBA       TAYADRLIDDLDDL-------DWPDSIKEMQRNWIGRSEGASVFFPVDGQAD--------
SYL_PEDPA       TAYADRLIDDLDLV-------DWPDSIKEMQKNWIGRSVGASVFFNVEDSEK--------
SYL_LACS1       TAYADRLIDDLDDL-------DWPEAIKEQQRNWIGRSVGAAINFPVSGDEN--------
SYL_LACRD       TAYADRLIDDLDLV-------DWPESVKEMQRNWIGRSEGASVFFPVVGDED--------
SYL_LEUMM       TAYADRLLEDLEDL-------DWPEAIKEQQRHWIGKSIGASVFFNIAD-SD--------
SYL_OENOB       TKYAERLLSDLDDL-------DWPEAIKEQQRNWIGKSTGAAVFFKVDGKSD--------
SYL_SALRD       TEYADRLLEGLEDL-------DWPESTKEMQRNWIGRSEGANVYFDLVGADD--------
SYL1_RHIL3      TAYADRLLQGLDGL-------DWPENLKAMQRNWIGRSEGAEIRFPLEHGKG--------
SYL_RHOBA       TDYAERLLDGLDDL-------DWPTGIKKLQSDWIGRSTGGEVDFYLQRGAAGDDTGPFV
SYL_PELLD       TAYAERLLLDLDGL-------DWPENVKQMQRNWIGRSEGVEVDFE----LRCHR-----
SYL_CHLPM       TAYADRLLEDLDGL-------DWPENVKQMQRNWIGRSEGVEVDFE----LRCHR-----
SYL_CHLCH       TAYAERLLADLEEL-------DWPENVKQMQRNWIGRSEGVEIDFE----LRCHR-----
SYL_CHLTE       TAYAERLLKDLDEV-------DWPENVKQMQRNWIGRSEGMEIDFE----LRCHR-----
SYL_CHLPD       TAYAERLLDDLDEL-------DWPENVKQMQRNWIGRSEGMEIDFE----LRCHN-----
SYL_LEPBL       TAYADRLLEDLKLV-------QWPSSTLEMQKNWIGKSEGLEITFPFKKPLKSGS-----
SYL_LEPBJ       TAYADRLLEDLKLV-------QWPSSTLEMQKNWIGKSEGLEITFPFKKPLKSGS-----
SYL_LEPIC       TAYADRLLEDLELV-------EWPPSTLEMQKNWIGKSEGLEITFPFLKPLQSGL-----
SYL_LEPIN       TAYADRLLEDLELV-------EWPPSTLEMQKNWIGKSEGLEITFPFLKPLQSGL-----
SYL_BACTN       SAYAQRLLDGLDTI-------DWTESLKETQKNWIGRSEGAEVQFK----VKDSD-----
SYL_BACV8       SAYAQRLLDGLDTV-------DWTDSLKETQRNWIGRSEGTEVQFK----VKDSD-----
SYL_BACFR       SAYAQRLLDGLETV-------EWTDSLKETQRNWIGRSEGAEMNFK----VKDSD-----
SYL_BACFN       SAYAQRLLDGLETV-------EWTDSLKETQRNWIGRSEGAEMNFK----VKDSD-----
SYL_PARD8       SAYAQRLLDGLDTI-------DWTDSLKETQKNWIGRSEGAEVRFK----VKDSD-----
SYL_PORGI       SAYAERLLHDLETL-------DWTESLKETQRNWIGRSEGAEMEFR----LAGKD-----
SYL_FLAPJ       SAYAERLLQGLNDI-------DWSESIKESQRNWIGKSVGAMVSFK----VKNQKSQVTS
SYL_FLAJ1       SAYAERLLQGLNDI-------DWSESIKESQRNWIGKSVGALVTFN----VKNHD-----
SYL_GRAFK       SAFSERLLQDLNKI-------DWTESLKESQRNWIGKSVGAHVDFK----IENSK-----
SYL_CYTH3       TAYADRLLKGLDTI-------DWPEAMKEMQRYWIGKSLGAMLTFK----VVDKD-----
SYL_BDEBA       TDYAERLLNDLDKL-------DWPERTKEGQRNWIGKSEGARITFK----VHGEK-----
SYL_SORC5       TAYADRLAEDLRLL-------DWPEGTVAMQRSWIGRSEGALITFEVKGWGK--------
SYL_TREDE       TEYAERLLEDLDEL-------DWPESIKIMQKNWIGKSTGAEVDFALVDKD---GKETG-
SYL_TREPA       TAYAERLLSDLDEL-------DWPESVKQMQRNWIGKSCGAEIDFPVDAPACSVHDKLP-
SYL_BORAP       TKYAERLLNDLEEL-------EWPESVKEMQRNWIGKSTGVEIDFEIEGYN---------
SYL_BORBP       TKYAERLLNDLEEL-------EWPESVKEMQRNWIGKSTGVEIDFEIEGHN---------
SYL_BORBU       TKYAERLLDDLEEL-------EWPESVKEMQRNWIGKSTGVEIEFEIEGHS---------
SYL_CHLTR       TAFADQLLEGLDEL-------DWPESVKQLQKNWIGKSSGASVNFATEH-----------
SYL_CHLTA       TAFADQLLEGLDEL-------DWPESVKQLQKNWIGKSSGASVNFATEH-----------
SYL_CHLMU       TAFADQLLGGLDEL-------DWPESVKQLQRNWIGKSVGASVHFETEH-----------
SYL_CHLFF       TAYSDQLLEGLEGL-------DWPENVKQLQRNWIGKSEGALVRFKVNNQ----------
SYL_CHLCV       TAYSDQLLEGLEDL-------DWPENVKQLQRNWIGKSEGALVRFEVNNE----------
SYL_CHLAB       TAYADQLLQGLEDL-------DWPENVKQLQRNWIGKSEGALLRFVVDKD----------
SYL_CHLPN       TAYADKLLEGLDAL-------DWPENVKQLQKNWIGKSEGALVTFHLTQE----------
SYL_PARUW       TAYADRLLQDLDLL-------DWPESLKKLQINWIGKSEGAYVQFIEKTTQ---------
SYL_ALKOO       TEYAERLINDLDLV-------DYIERVKIQQKNWIGKSEGMEVDFEITGG----------
SYL_UREP2       VDYADKLLDGLNEV-------EFSESLKSLQRNWIGKSIGTSVQFKIKDSLLT-------
SYL_UREPA       VDYADKLLDGLNEV-------EFSESLKSLQRNWIGKSIGTSVQFKIKDSLLT-------
SYL_MYCPU       TNYADKLLEGLEDL-------DWENSLKLLQKNWIGKSTGTKVKFALELLDES-------
SYL_MYCPE       TKFADQLIDDLELT-------DWTVGLKNIQKKWIGKSIGATVKFKIQNSDSE-------
SYL_MYCGA       TAFADQLIDDLENL-------NWPNSIKAMQVNWINKSVGASIKFEIDQLDNQT------
SYL_MYCGE       TTFADALLEGLDTL-------DWPEPIKEMQRNWIGKSKGVTINFQLKDHKEA-------
SYL_MYCPN       TAFAESLLNGLAEL-------DWHQSIKEMQTNWIGKSEGVEVTFDIENSKET-------
SYL_MYCCT       TDYADKLLKGLDNL-------DWPNSVKELQRNWIGKSEGCEINFK--SNDIN-------
SYL_MYCMS       TDYADKLLDGLDNL-------DWPNSVKELQRNWIGKSEGCEINFK--SNDIN-------
SYL_MESFL       TEYADRLLEGLDEL-------EWNSSIKDLQRNWIGKSTGVELDFL--VNNIK-------
SYL_ACHLI       TEYADRLLDDLALV-------DWPENLKEMQRNWIGKSSGAVIEFEVASTDYK-------
SYL_PSEA6       TDYAEELLTDLEQL------EDWPEQVRAMQKNWIGRSEGVDITFNLSE----NAAD---
SYL_COLP3       TDYAEELLDDLDQL------TEWPEQVKTMQRNWIGRSQGVEMTFAVAD----STE----
SYL_IDILO       TDYAEELLDDLDQL------DGWPEQVKAMQRNWIGRSEGVEIDFNVAS----SEQ----
SYL_PSEHT       TDYAQELLDDLDKL------EDWPEQVKTMQRNWIGRSEGCDIEFKRTD----NNE----
SYL_PSYIN       TAYAQELLDDLDKL------DEWPEQVRTMQRNWIGRSEGVEMDFKVSG----KEE----
SYL_SALCH       TAYADELLRDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVKG----YDN----
SYL_SALTI       TAYADELLRDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVKG----YDN----
SYL_SALTY       TAYADELLRDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVKG----YDN----
SYL_SALPB       TAYADELLRDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVKG----YDN----
SYL_SALPA       TAYADELLRDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVKG----YDN----
SYL_CITK8       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVNG----YDN----
SYL_SALAR       TAYADELLSDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVKG----YDN----
SYL_SHIFL       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_SHIF8       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_SHIBS       TAYADELLNDLDKL------DHWPDTVKSMQRNWIGRSEGVEITFNVND----YDN----
SYL_ECOL6       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_ECOL5       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_ECO57       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_SHISS       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_ECOLI       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_ECOLC       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_SHIDS       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_ECOHS       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVNN----YDN----
SYL_ECOUT       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVKD----YDN----
SYL_ECOK1       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVKD----YDN----
SYL_ECO24       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFNVND----YDN----
SYL_KLEP7       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEISFDVND----YAD----
SYL_CROS8       TAYADELLNDLDKL------DHWPDTVKTMQRNWIGRSEGVEITFDVQN----SDE----
SYL_ENT38       TAYADELLRDLDNL------DHWPDTVKTMQRNWIGRSEGVEITFNVEN----SDQ----
SYL_YERPA       TDYAEQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDIVFDVVD----SEE----
SYL_YERP3       TDYAEQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDIVFDVVD----SEE----
SYL_YERPE       TDYAEQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDIVFDVVD----SEE----
SYL_YERPN       TDYAEQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDIVFDVVD----SEE----
SYL_YERPS       TDYAEQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDIVFDVVD----SEE----
SYL_YERPP       TDYAEQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDIVFDVVD----SEE----
SYL_YERE8       TDYADQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDIVFNVAD----SEE----
SYL_SERP5       TDYADQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVDITFDVAG----SDE----
SYL_PECAS       TAYADQLLNDLDTL------ESWPEQVKTMQRNWIGRSEGVEITFDVAD----SEE----
SYL_SODGM       TAYADQLLYDLDKL------ESWPEQVKTMQRNWIGRSEGVEITFQVAD----SEE----
SYL_PHOLL       TDYAEELLSDLETL------EEWPEQVKTMQRNWIGRSEGVEITFDVAD----SQE----
SYL_MANSM       TDYAEQLLSGLDTL------PEWPDMVKTMQRNWIGRSEGVEITFKIEN----SDE----
SYL_ACTSZ       TDYAEQLLGGLDTL------PEWPEMVKTMQRNWIGRSEGVEITFKIEN----SDE----
SYL_HAES1       TDYAEQLLSDLDQL------PEWPDMVKTMQRNWIGRSEGVEITFNVAH----SDQ----
SYL_HISS2       TDYAEQLLSDLDQL------PEWPDMVKTMQRNWIGRSEGVEITFNVAH----SDQ----
SYL_PASMU       TDYAEQLLGGLDHL------PLWPDQVKTMQRNWIGRSEGVEITFQLAN----SED----
SYL_HAEIG       TDYAEQLLGGLDTL------PQWPDMVKTMQRNWIGRSEGVEITFDVAN----TNE----
SYL_HAEIN       TDYAEQLLGGLDTL------PQWPDMVKTMQRNWIGRSEGVEITFDVAN----TNE----
SYL_HAEI8       TDYAEQLLGGLDAL------PQWPDMVKTMQRNWIGRSEGVEITFDVAN----TNE----
SYL_HAEIE       TDYAEQLLGGLDTL------PQWPDMVKTMQRNWIGRSEGVEITFDVAN----TNE----
SYL_ACTP2       TDYAEELLTHLDNL------PQWPDQVKTMQRNWIGRSEGVEITFKIAG----SNA----
SYL_HAEDU       TDYAEELLTQLDNL------TQWPDQVKTMQRNWIGRSEGVEITFKIAG----SNA----
SYL_SHESA       TAYAEELLNDIDTL------DGWPEQVKTMQRNWIGRSEGVEMTFGVAG----SDK----
SYL_SHESM       TAYAEELLNDIDTL------DGWPEQVKTMQRNWIGRSEGVEMTFGVAG----SDK----
SYL_SHESR       TAYAEELLNDIDTL------DGWPEQVKTMQRNWIGRSEGVEMTFGVAG----SDK----
SYL_SHEON       TAYAEELLNDIDTL------DGWPEQVKTMQRNWIGRSEGVEMTFGVAG----SDK----
SYL_SHEB9       TAYAEELLNDIDTL------DGWPDQVKTMQRNWIGRSEGVEMTFGVAG----HDK----
SYL_SHEB5       TAYAEELLNDIDTL------DGWPDQVKTMQRNWIGRSEGVEMTFGVAG----HDK----
SYL_SHEB8       TAYAEELLNDIDTL------DGWPEQVKTMQRNWIGRSEGVEMTFGVAG----HDK----
SYL_SHESW       TAYAEELLNDIDTL------DGWPEQVKTMQRNWIGRSEGVEMTFGVAG----HDK----
SYL_SHEPC       TAYAEELLNDIDTL------DGWPEQVKTMQRNWIGRSEGVEMTFGVAG----HDK----
SYL_SHEAM       TAYAEELLNDIDNL------EGWPEQVKTMQRNWIGRSEGVEMTFKVKD----SDD----
SYL_SHEHH       TEYAEELLNDLDQL------DEWPEQVKTMQRNWIGRSEGIEMTFQVAD----SDQ----
SYL_SHEPA       TEYAEELLNDIDTL------EEWPEQVKTMQRNWIGRSEGIEMTFQVAG----SDQ----
SYL_SHELP       TDYAEELLNDIDQL------DEWPEQVKTMQRNWIGRSEGIEMTFQVEG----SDQ----
SYL_SHESH       TEYADELLKDIDQL------DEWPEQVKTMQRNWIGRSEGIEMTFGVVD----SEE----
SYL_SHEDO       TDYAEELLNDIDTL------DGWPEQVKAMQRNWIGRSEGIEMTFKVKD----SEQ----
SYL_SHEFN       TDYAEELLNDIDTL------DGWPEQVKAMQRNWIGRSEGIEMTFAVAD----SDA----
SYL_VIBPA       TEYAQELLDDLDKL------EGWPEMVKTMQRNWIGRSEGVELKFEVK-----GQQ----
SYL_VIBCB       TEYAQELLDDLDKL------EGWPEMVKTMQRNWIGRSEGVELRFALKDSEVKGQQ----
SYL_VIBVU       TEYAQELLDDLDKL------EGWPEMVKTMQRNWIGRSEGVELKFEVK-----GQQ----
SYL_VIBVY       TEYAQELLDDLDTL------EGWPEMVKTMQRNWIGRSEGVELKFEVK-----GQQ----
SYL_VIBCH       TAYAQELLDDLDNL------DGWPEMVKTMQRNWIGRSEGVELKFAVKG----ENT----
SYL_VIBC3       TAYAQELLDDLDNL------DGWPEMVKTMQRNWIGRSEGVELKFAVKG----ENT----
SYL_ALIF1       TEYAQELLDDLDNL------DGWPEMVKTMQRNWIGRSEGVELSFAVNG----ETS----
SYL_PHOPR       TEYAQELLDDLDTL------DGWPEMVKTMQRNWIGRSEGVELSFAVNG----EEA----
SYL_AERS4       TDYAEELLNDIDNL------EGWPEMVKTMQRNWIGRSEGVNISFAIEG----QAE----
SYL_AERHH       TDYAEELLNDIDNL------EGWPEMVKTMQRNWIGRSEGVNISFAIEG----QTE----
SYL_MARHV       TDYAEELLNDLEDM------EGWPEQVKTMQRNWIGKSVGTELTFPLKEQ----------
SYL_HAHCH       TDYAEQLLNDLDKL------ENWPEQVKTMQRNWINKSEGVEFHFKLKDH----------
SYL_SACD2       TDYAEELLADLDKL------PNWPEQVKTMQRNWIGKSQGVEMRFDLANPI----AG---
SYL_MARMS       TDYAEELLNDLDQL------DGWPEKVKAMQRNWIGRSEGLEFSFAVEGK----------
SYL_ALCBS       TDYADELLNDLDQL------DGWPEQVKTMQRNWIGRSEGVELDFPIEGE----------
SYL_PSEAB       TAYAEELLESLDNL------PGWPEQVKTMQRNWIGKSRGMEIGFPYDQASIG-------
SYL_PSEAE       TAYAEELLESLDNL------PGWPEQVKTMQRNWIGKSRGMEIGFPYDQASIG-------
SYL_PSEA7       TAYAEELLESLDNL------PGWPEQVKTMQRNWIGKSRGMEIAFPYDQASIG-------
SYL_PSEU5       TAYADELLESLDEL------DGWPEQVKTMQRNWIGKSRGMEISFPYDVASIG-------
SYL_PSEMY       TAYADELLSSLDEL------DGWPEQVKTMQRNWIGKSFGADIVFDYDVASIG-------
SYL_PSEP1       TDYADELLESLDEL------PGWPEQVKTMQRNWIGKSRGMEVQFPYDQASIG-------
SYL_PSEPK       TDYADELLESLDEL------PGWPEQVKTMQRNWIGKSRGMEVQFPYDKASIG-------
SYL_PSEPG       TDYADELLESLDEL------PGWPEQVKTMQRNWIGKSRGMEVQFPYDQASIG-------
SYL_PSEE4       TDYADELLESLDEL------PGWPEQVKTMQRNWIGKSRGMEVQFPYDQASIG-------
SYL_PSEU2       TAYADELLESLDEL------PGWPEQVKTMQRNWIGRSRGMEVQFPYDQASIG-------
SYL_PSE14       TAYADELLESLDEL------PGWPEQVKTMQRNWIGRSRGMEVQFPYDQASIG-------
SYL_PSESM       TAYADELLESLDEL------PGWPEQVKTMQRNWIGRSRGMEVQFPYDQASIG-------
SYL_NEIMB       TDYAEELLNDLDKL------EHWPEQVKTMQRNWIGKSRGMTVRFAVSDDSKQGLEGD--
SYL_NEIMF       TDYAEELLNDLDKL------EHWPEQVKTMQRNWIGKSRGMTVRFAVSDDSKQGLEGD--
SYL_NEIG1       TDYAEELLNDLDKL------EHWPEQVKTMQRNWIGKSRGMTVRFAVSDDSKQGLEGD--
SYL_NEIM0       TDYAEELLNDLDKL------EHWPEQVKTMQRNWIGKSRGMTVRFAVSDDSKQGLEGD--
SYL_NEIMA       TDYAEELLNDLDKL------EHWPEQVKTMQRNWIGKSRGMTVRFAVSDDSKQGLEGD--
SYL_CHRVO       TDYAEQLLADLDKL------DGWPEQVKTMQRNWIGKSYGSDVVFPYDEASI-----G--
SYL_THIDA       TQYADELLSGLDTL------PGWPERVKTMQANWIGKSTGVRLAFPYELDG--SQE----
SYL_DECAR       TAYAEELLSELDNL------PGWPEQVRLMQKNWIGKSTGVRFAFPLADN---PDE----
SYL_AZOSB       TAYADELLEALDGL------PGWPEQVKLMQKNWIGRSEGVEVHFPYDLSTIGSSG----
SYL_CUPMC       TDYAQELLGDLEGL-------GWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLIN--
SYL_CUPPJ       TDYAEELLGDLDGL-------GWPERVKIMQQNWIGKSVGVRFAFKHDIEGDDGQLIN--
SYL_RALSO       TDYAQELLSDLDPL-------GWPERVKLMQQNWIGKSEGVRFAFPHGIPGDDGKVIG--
SYL_JANMA       TDYAEELLDHVDNKL-----PGWPERVRIMQSNWIGKSTGVRFAFTHDIA-EEGKLIN--
SYL_HERAR       TDYAEELLDHVEHKL-----PGWPERVRTMQANWIGKSTGVRFAFTHDIK-DDDKLIN--
SYL_BURCH       TQYADELLNDLDGL-------GWPERVKIMQQNWIGKSFGVNFGFPYELDGEQK------
SYL_BURCA       TQYADELLNDLDGL-------GWPERVKIMQQNWIGKSFGVNFGFPYELDGEQK------
SYL_BURL3       TQYADELLNDLDGL-------GWPERVKIMQQNWIGKSFGVNFGFPYELDGEKK------
SYL_BURCM       TQYADELLNDLDGL-------GWPERVKIMQQNWIGKSFGVNFGFPYELDGEKA------
SYL_BURVG       TQYADELLNDLDGL-------GWPERVKIMQQNWIGKSFGVNFGFPYELDGEKA------
SYL_BURP0       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURPS       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURP6       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURP1       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURM7       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURM9       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURMA       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURMS       TQYADELLNDLDGL-------GWPERVKVMQHNWIGKSFGVNFGFPYELDGEKK------
SYL_BURTA       TQYADELLNDLDGL-------GWPERVKIMQQNWIGKSFGVNFGFPYELDGEKK------
SYL_PARXL       TQYADELLNDLEGL-------GWPERVKIMQQNWIGKSFGVNFGFPYEIDGEQK------
SYL_POLAQ       TAYAEQLLSGLDGL-------GWPERVKTMQQNWIGKSRGVRFAFKHEIADAHGNFIQ--
SYL_BORBR       TDYAEELLDQVSTN-----LPGWPERVRLMQENWIGKSEGLRFAFPHRIAGADGKLIQ--
SYL_BORPA       TDYAEELLDQVSTN-----LPGWPERVRLMQENWIGKSEGLRFAFPHRIAGADGKLIQ--
SYL_BORPE       TDYAEELLDQVSTN-----LPGWPERVRLMQENWIGKSEGLRFAFPHRIAGADGKLIQ--
SYL_BORPD       TDYADELLDQVRSG-----LPGWPERVRAMQENWIGKSEGVRFAFPHTIAGADGQLIQ--
SYL_BORA1       TDYADELLDQVKNG-----LPGWPERVRVMQENWIGKSEGVRLAFPHDIKDENGQLIQ--
SYL_METPP       TQYADELLANVADPASPGFLHGWPERVRLMQEHWIGKSAGVRFAFPHEIRDADGTLVG--
SYL_ACISJ       TDYAQELLDHVQIGNEKATLTGWPDKVRLMQENWIGKSAGVRFAFPHDIRNAAGERIQ--
SYL_ACIAC       TDYAQELLDHVQVGNPNATLTGWPDKVRLMQENWIGKSEGVRFAFTHDIRGEDGQPIG--
SYL_RHOFT       TDYAEELLGQVQTG-----LPGWPERVKLMQENWIGKSEGVRFAFTHDIRDASGALID--
SYL_VEREI       TDYAEELLAFVTDDR----LPGWPERVKLMQENWIGKSEGLRFAFPHDVRGDDGALIG--
SYL_POLNA       TDYAEELLGSVQHK-----LPGWPERVKLMQENWIGKSEGVRFAFLHDIKDASGALIG--
SYL_POLSJ       TDYAEELLGHVQHQ-----LPGWPERVRLMQENWIGKSEGVRFAFTHDIRDASGALIG--
SYL_METCA       TAYAEELLAELDDL------PGWPEQVKTMQRNWIGKSHGCEVHFPYEDGSD--------
SYL_DICNV       TDYAEELLNDLEQL------DGWPERVKMMQRNWIGKSRGMTIRFPIEPESQKGLSAE--
SYL_PSYCK       TDYADELLDDLDQLE-----GHWPSEVITMQRNWIGRSSGMEVHFPYELAG---------
SYL_PSYA2       TDYADELLDDLDQLE-----GHWPSEVITMQRNWIGRSSGMEVHFPYELAG---------
SYL_PSYWF       TDYADELLDDLDKLE-----GQWPSDVITMQRNWIGRSQGMEVHFPYKNSD---------
SYL_ACIAD       TDYAQELLDDLDTLK-----DGWPQQVLTMQRNWIGRSTGMDITFPSANPEI--------
SYL_NITEU       TRYADELLADLEKL------PGWPERVKTMQANWIGKSFGVDITFPPDTASGMPQ-----
SYL_NITEC       TRYADELLAGLENL------PGWPERVKAMQANWIGKSYGVDIIFSPDIASGMPQ-----
SYL_NITMU       TAYADELLEALNAL------PGWPERVRTMQANWIGKSFGVEVRFPADAESGMPQ-----
SYL_METFK       TAYAEELLADLDKL------DGWPEQVKTMQRNWIGKSYGCEVEFPLAVGNG--------
SYL_HYDCU       TDYAEELLTDLDQL------EGWPEQVKTMQKNWIGKSTGLEIEFPIASGLDES------
SYL_XYLFA       TDYAQELLDGLNTLDD------WPEPVKTMQRNWIGRSEGLEIQFEVRDADNNAL-----
SYL_XYLFT       TDYAQELLDGLNTLDD------WPEPVKTMQRNWIGRSEGLEIRFEVRDVDNNAL-----
SYL_XANC8       TDYAQELLDGLDQLDG------WPDSVKTMQRNWIGRSEGLEIQFDVRDTTGAAL-----
SYL_XANCP       TDYAQELLDGLDQLDG------WPDSVKTMQRNWIGRSEGLEIQFDVRDTTGAAL-----
SYL_XANCB       TDYAQELLDGLDQLDG------WPDSVKTMQRNWIGRSEGLEIQFDVRDTTGAAL-----
SYL_XANC5       TDYAQELLDGLDQLDG------WPDSVKTMQRNWIGRSEGLEIQFDVRDIDGAPL-----
SYL_XANAC       TDYAQELLDGLDQLDG------WPDSVKTMQRNWIGRSEGLEIQFDVRDPDGATL-----
SYL_XANOR       TDYAQELLDGLDQLDG------WPDSVKTMQRNWIGRSEGLEIQFDVRDTNGAAL-----
SYL_XANOM       TDYAQELLDGLDQLDG------WPDSVKTMQRNWIGRSEGLEIQFDVRDTNGAAL-----
SYL_NITOC       TAYGEELLTALDGLTG------WPEQVRAMQRNWIGRSEGIEVQFHVEGK----------
SYL_ALKEH       TDYADELLEALDELPG------WPEQVRAMQRNWIGRSEGVELDFAVAGHS---------
SYL_HALHL       TDYADELLEALDELDG------WPEQVRNMQRNWIGRSEGVELSFDLAGRD---------
SYL_CHRSD       TDYADELLADLDKVD-------WPEQVKTMQRNWIGKSTGVELSFAVADSS---------
SYL_BUCAI       RNYAESLYQDLKKL------THWPENVKNMQRNWIGRIKGFEITLNVFNTCQKLK-----
SYL_BUCAP       RNYAESLHNDLNDL------ENWPEKVKNMQRNWIGRSKGFEIVFNVLNSNKKIK-----
SYL_BUCCC       KKYADKFLKDLKLL------KKWPKEVISMQKNWIGKSKGLKIKCKIYKKKYFLK-----
SYL_BUCBP       TKYAEELLNDLDNL------PEWPEKVKTMQHNWIGRNHGIKIKLKLANQHTILND----
SYL_WIGBR       TDYADELLNDLNDL------KLWPKKVKVMQRNWIGKSKGIDVLFHIKDTNEKIL-----
SYL_BLOPB       TNYADQLLHGLDQL------THWPEQVKIMQRNWIGRSKGVNVTFRIENSN-DTLT----
SYL_BLOFL       THYADQLLNGLNQL------QYWPEQVKTMQRNWIGQSTGTNVIFKILNSNITTIT----
SYL_BAUCH       TAYADQLLHDLDKL------DGWPEQIKNMQRNWIGRSEGINITFQVIDMKETLT-----
SYL_COXBU       TDYSEELLKDLDEL------KEWPEQVITMQRNWIGQSQGVIINFNLEKGP---------
SYL_COXBR       TDYSEELLKDLDEL------KEWPEQVITMQRNWIGQSQGVIINFNFEKGP---------
SYL_COXBN       TDYSEELLKDLDEL------KEWPEQVITMQRNWIGQSQGVIINFNLEKGP---------
SYL_LEGPH       TSYADELLSSLDSL------DEWPAQVKQMQRNWIGKSIGTEIYFNVNNYP---------
SYL_LEGPC       TSYADELLSSLDSL------DEWPAQVKQMQRNWIGKSIGTEIYFNVNNYP---------
SYL_LEGPA       TSYADELLSSLDSL------DEWPAQVKQMQRNWIGKSIGTEIYFNVNNYP---------
SYL_LEGPL       TSYADELLSSLDSL------DEWPAQVKQMQRNWIGKSIGTEIYFNVNNYP---------
SYL_FRATT       TDYADELLQDINKL------DNWPEAVKTMQINWIGKSKGLTVKFKVKDSN---------
SYL_FRAT1       TDYADELLQDINKL------DNWPEAVKTMQINWIGKSKGLTVKFKVKDSN---------
SYL_FRATW       TDYADELLQDINKL------DNWPEAVKTMQINWIGKSKGLTVKFKVKDSN---------
SYL_FRATF       TDYADELLQDINKL------DNWPEAVKTMQINWIGKSKGLTVKFKVKDSN---------
SYL_FRATH       TDYADELLQDINKL------DNWPEAVKTMQINWIGKSKGLTVKFKVKDSN---------
SYL_FRATO       TDYADELLQDINKL------DNWPEAVKTMQINWIGKSKGLTVKFKVKDSN---------
SYL_FRATN       TDYADELLQDISKL------DGWPEAVKTMQINWIGKSKGLTVKFKIKDSN---------
SYL_FRAP2       TDYADELLKDINQL------DGWPEAVKTMQTNWIGKSKGLTVKFKIQNSD---------
SYL_RUTMC       TNYADELIYGLDKL------DGWPDAVKTMQKNWIGKSVGLEVDFPRHNA----------
SYL_VESOH       TNYAEELLNDLDKL------YGWPDPVKIMQKNWIGKSIGLEITFSRRNS----------
SYL_RICRS       TDYAEELLNEIQNL------KEWPEAVRSMQEKWIGKSIGANFHFKIKDNEETT------
SYL_RICRO       TDYAEELLNEIQNL------KEWPEAVRSMQEKWIGKSIGANFHFKIKDNEETT------
SYL_RICCN       TDYAEELLNEIQNL------KEWPEAVRSMQEKWIGKSIGANFHFKIKDNEETT------
SYL_RICM5       TDYAEELLNEIQNL------KEWPEAVRSMQEKWIGKSIGANFHFKIKDNEETT------
SYL_RICFE       TDYAEELLNEIQNL------KEWPEAVRSMQEKWIGKSIGANFHFKIKDNEDNT------
SYL_RICAH       TDYAEELLNEIQNL------KEWPEAVRSMQEKWIGKSIGANFHFKIKDNEDTT------
SYL_RICCK       TDYAEELLNEIKNL------KEWPEAVRSMQEKWIGKSIGANFYFKVKDNEDAI------
SYL_RICBR       TNYAEELLNEIPNL------TEWPEAVRSMQEKWIGKSVGANFRFKIKDNED-V------
SYL_RICPR       TDYAEELLNEIQNL------KDWPAAVRVMQEEWIGKSTGVNFHFKVKYHENTT------
SYL_RICTY       TNYAEELLNEIQNL------KDWPEAVRVMQEEWIGKSTGVNFHFKIKYHENST------
SYL_ORITB       TNYADALLKGLDSL------KGWPESVKTMQKKWIGQSTGININFQLK-GIEAS------
SYL_WOLPM       TDFAEDLLKCLQSL------KNWPEKVKTMQERWIGKSEGATIEFEVVGLNKK-------
SYL_WOLTR       TDFAEDLLECLQGL------ENWPEKVKMMQDRWIGKSEGVTIEFKIVGLNKK-------
SYL_EHRRW       TDFAAELLDDLKSL------NQWPEKVKLMQERWIGKSEGVIIDFQIVGINEV-------
SYL_EHRRG       TDFAAELLDDLKSL------NQWPEKVKLMQERWIGKSEGVIIDFQIVGINEV-------
SYL_EHRCJ       TDFAEELLNDLKVL------DKWPEKVKLMQERWIGRSEGVVVDFEILNINKT-------
SYL_EHRCR       TDFAEELLNDLQIL------DQWPEKVKLMQEKWIGKSQGVVIDFEILGINKT-------
SYL_ANAMM       TDFADSLLDGLKTL------DGWPEKVKLMQERWIGKTEGVILEFA-TSCGQK-------
SYL_NEOSM       SDFSEELLKGLESL------TGWPEKVKTMQTNWIGKSEGAVIKFSISGYEERF------
SYL2_RHIL3      TDFSQDLLDALDTL------DQWPEKVRLMQKNWIGRSEGLTIRWEIVPETAP-------
SYL_RHIEC       TDFSQELLDALDTL------DQWPEKVRLMQKNWIGRSEGLTVRWEIVPETAP-------
SYL_RHIME       TDFSQDLLDALDTL------DEWPEKVRLMQKNWIGRSEGLSVRWELDPATVP-------
SYL_SINMW       TDFSQDLLDSLDTL------DEWPEKVRLMQKNWIGRSEGLSVRWELDPATVP-------
SYL_AGRFC       TDFSQDLLDELDEL------DQWPEKVRLMQKNWIGRSEGLSLRWQTVADTAP-------
SYL_BRUAB       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRFALAAGTAP-------
SYL_BRUA2       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRFALAAGTAP-------
SYL_BRUSI       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRFALAAGTAP-------
SYL_BRUO2       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRFALAAGTAP-------
SYL_BRUME       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRFALAAGTAP-------
SYL_BRUSU       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRFALAAGTAP-------
SYL_BRUC2       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRLALAAGTAP-------
SYL_OCHA4       TDFSEELLAGLDTL------DQWPEKVRLMQRNWIGKSEGLQVRFTLDGKTAP-------
SYL_CHESB       TDYAEDLLSAIDGL------DDWPEKVRLMQRNWIGRSEGLSIRWALAEDTAP-------
SYL_RHILO       TDFAQDLLDSLEGL------DEWPEKVKLMQQNWIGRSEGLLIRWPLASDVA--------
SYL_BART1       SDFSEDLLAGLEEL------DQWPEKVRTMQKNWIGKSQGLLIRWALKSTADDAGGSNDV
SYL_BARHE       SDFSEDLLAGLEEL------EQWPEKVRIMQKNWIGKSQGLLIRWALKSTEE----ADEV
SYL_BARQU       SDFSEDLLAGLEEL------EQWPEKVRTMQKNWIGKSQGLLIRWALKSTNG----ADEV
SYL_BARBK       TEFGEGLLARLDDL------TEWPDKVRVMQKNWIGKSQGLYIRWALDKTQLP---HNDG
SYL_RHOP2       TRYAQDLLDALETL------DRWPDKVRLMQRNWIGRSEGLLVRFALDAATTP-------
SYL_RHOPS       TRYAQELLDALETL------DRWPDKVRLMQRNWIGRSEGLLVRFALDSATTP-------
SYL_RHOPA       TKYAQELLDALDTL------DRWPDKVRLMQRNWIGRSEGLMVRFALDSATTP-------
SYL_RHOP5       TRYSQDLLDALDRL------DRWPDKVRLMQRNWIGRSEGMLVRFALDAATTP-------
SYL_NITHX       TKYSQELLEALDTL------DRWPDKVRLMQRNWIGRSEGLLLRFALDPATTP-------
SYL_NITWN       TKFSQELLDALGTL------DRWPDKVRLMQRNWIGRSEGLLIRFALDATTTP-------
SYL_BRASB       TKYSQELLDALDGL------DRWPDKVRLMQRNWIGRSEGLLIRFALDPQTTP-------
SYL_BRASO       TKYSQELLDALDGL------DRWPDKVRLMQRNWIGRSEGLLIRFALDPKTVP-------
SYL_BRADU       TKYSQELLSALDTL------DRWPDKVRLMQRNWIGRSEGLLVRFALDQATTP-------
SYL_RHOPB       SKYSEDLLTALDRL------DRWPDKVRIMQRNWIGRSEGLLLRFALDTSTTP-------
SYL_AZOC5       TAFAQELLDAIDTL------DRWPDKVRLMQRNWIGRSEGLEVLFELSKGSVA-------
SYL_PARL1       SDFADELLEGLDTL------DRWPEKVRLMQKNWIGRSEGARVFFELENAPDG-------
SYL_CAUVC       TDYADALIDGLKTL------DRWPDKVRLMQENWIGRSKGLRFKFQFDGEA-P-------
SYL_CAUSK       TDYADALIDGLKTL------DRWPEKVRIMQENWIGRSKGLRFTFKFDGEA-P-------
SYL_MARMM       TEYADELTDALEEL------DRWPDKVRTMQSNWIGRSRGAEVSFPLTDSGLA-------
SYL_HYPNA       TAYADDLLEAVQKL------ERWPEKVRTMQANWIGRSEGLEMTFAFDGER-P-------
SYL_RUEST       SDYSDELLEALDGL------ENWPAKVRLMQENWIGKSRGLQFSFERTD-----------
SYL_RUEPO       SDMSGELLDALDTL------DDWPAKVKLMQANWIGKSRGLQFSWALTEPA---------
SYL_ROSDO       SDHSEELLSALDTL------ENWPAKVRLMQENWIGKSRGLQFAFSTIDGP---------
SYL_JANSC       SDYSDELLEALDGL------DDWPAKVKLMQANWIGKSRGLQFAFGLVEPV---------
SYL_DINSH       SDFADDLLSALDGL------ENWPEKVRLMQANWIGKSRGLEFAFARTD-----------
SYL_RHOS1       SDYAGELLEALDTL------KDWPEKVRLMQANWIGQSRGLQFAFSMAGAP---------
SYL_RHOS4       SDYAGELLEALDTL------KDWPEKVRLMQANWIGQSRGLQFAFSMAGAP---------
SYL_RHOS5       SDYAGELLEALDRL------KDWPEKVRLMQANWIGQSRGLQFAFSTVNAP---------
SYL_PARDP       SDYSDELLSALDGL------EGWPEKVRLMQANWIGKSRGLQFRFHTVDLP---------
SYL_ZYMMO       TEFADDLLDGLKDL------DQWPEKVRSMQENWIGRSQGMQFHFNFEVAPEGFD-----
SYL_SPHWW       TDFADDLLDGLDTL------DQWPEKVRTMQENWIGKSQGMRFTFVLDAPAGDLT-----
SYL_NOVAD       TDFADELLEGLSTL------DKWPEKVRVMQENWIGKSQGLQFRFDLS---NGE------
SYL_SPHAL       TDFADELLEGLGSL------DKWPDKVRLMQENWIGKSQGLEFSFKFA---GGAP-----
SYL_GRABC       TDYAEELLAGLDQL------DRWPERVRVMQSRWIGRSEGARLRFPLVEPLG--------
SYL_GLUOX       TKFAQPLLDDLKTL------DRWPERVRTMQERWIGRSEGARVRFALHQPPAGYDE----
SYL_ACICJ       TDFAADLLAGLDTL------ENWPERVRTMQRNWIGRSEGAEFTIRLAAPCG--------
SYL_MAGSA       TAYAQDLLDSLATL------ERWPERVRLMQENWIGRSEGARLMFDLDGRSDR-------
SYL_RHORT       TRYAEDLLAAIGDL------DRWPDKVRLMQTNWIGRSEGARVRFGLVGRDQA-------
SYL_MAGMM       THYADELLDNLQHM------DGWPETVRTMQTNWIGKSHGVEFAFALEGYPGT-------
SYL_CAMJ8       TAYAEELLKDLEELK-----DKWPNQVLTMQENWIGKSEGLEFSLNLDEESKQKTKE---
SYL_CAMJJ       TAYAEELLKDLEELK-----DKWPNQVLTMQENWIGKSEGLEFSLNLDEESKQKTKE---
SYL_CAMJR       TAYAEELLKDLEELK-----DKWPNQVLTMQENWIGKSEGLEFSLNLDEESKQKTKE---
SYL_CAMJE       TAYAEELLKDLEELK-----DKWPNQVLTMQENWIGKSEGLEFSLNLDEESKQKTKE---
SYL_CAMJD       TAYAEKLLKDLEGLR-----DKWPNQVLTMQENWIGKSEGLAFSLNLDEKSKQKAKE---
SYL_CAMC1       TKYASELLDDLKLLE-----GKWPNQVITMQENWIGRSYGLEFKFSLDEASKETLGGK--
SYL_CAMC5       TQYAEELLNDLKTLE-----GKWPNQVIAMQENWIGKSSGLEFKFYLDDASSRALGGK--
SYL_CAMFF       TDYANELLECLKDLE-----GKWPNQVLTMQENWIGKSYGLEFEFKFDSSSKILLDG---
SYL_CAMHC       TSYADELLSCLKDLQ-----NHWPSQVITMQENWIGKSFGLEFDFKFDDESSKKLGG---
SYL_ARCB4       TKYAQELLDDLEKLK-----EDWPSQVLTMQENWIGRSEGLEFKFDLSKESRAKLERA--
SYL_NITSB       TDYAQELLEDLKKLE-----GNWPNQVIAMQRNWIGRSEGLEFRLHFDETSAKKAGI---
SYL_WOLSU       TDYAEELLGSLDTLE-----GRWPSQVLTMQRNWIGRSEGLSFAFKLTSSSKERIGGS--
SYL_HELHP       TDYADELLECLNKLE-----GHWPSQVLSMQRNWIGKSKGLSFTFDFSVDSLQKLGNG--
SYL_HELPY       TNYAEELLKDLEALE-----DHWPSQVLIMQKNWIGKSSGLQFGFKIADECLKACNG---
SYL_HELPH       TNYAEELLKDLETLE-----DHWPSQVLIMQKNWIGKSSGLQFGFKIADECLKACNG---
SYL_HELPJ       TNYAEELLKDLETLE-----NHWPSQVLTMQKNWIGKSSGLQFGFKIADECLKACNN---
SYL_HELAH       TNYAEELLKDLETLK-----NHWPSQVLLMQKNWIGKSSGLQFRFKIADECLKACND---
SYL_THEMA       TDYAERLLNDLDKLTG------WPEHVKTMQRNWIGKSTGAEIDFPVEGSDT--------
SYL_THEP1       TDYAERLLNDLDKLTG------WPEHVKTMQRNWIGKSTGAEIDFPVEGSDT--------
SYL_THEM4       TDYAEKLLNDIDKLRG------WPENVKIMQKNWIGKSTGAEIDFPVDRLDM--------
SYL_FERNB       TDYAEKLLEGLDRLPG------WPEHVKTMQRNWIGKSTGAEVDFPVDGMDR--------
SYL_PSELT       TDYAERLLKDLDKLTG------WPEHVKTMQRNWIGESKGAKISFKVEESEM--------
SYL_CALS8       TKYAERLLRDIDKLDG------WPEKVKIMQKNWIGRSEGAEIEFEIDGLGK--------
SYL_HUNT2       TDYAQRLLDDIEKLKG------WPDKVKVMQQNWIGRSEGVEVDFKVDGMDK--------
SYL_DESHY       TDYAQVLLDDLEKLPG------WPDKVKTMQKNWIGRSEGAEVEFDLENHGD--------
SYL_SYNWW       TDYAQRLLDDLALLPG------WPEKVKTMQKNWIGRSEGCEFSLHIEDSDE--------
SYL_CARHZ       TAYAERLLQDIKKLTG------WPEKVKIMQENWIGRSEGAEITFKIKGHEE--------
SYL_PELTS       TDYAERLLKDLELLEG------WPEKVKIMQENWIGRSEGAEIDFKVEGSDD--------
SYL_MOOTA       TDYADRLLEDLKKLPG------WPDKVKIMQENWIGKSSGAEVVFRVEGSGE--------
SYL_DESRM       TEYAQRLLNDLKLLKG------WPDKVKIMQENWIGRSEGAELTFQVEGSDE--------
SYL_SYMTH       TQYADELLEDLKLLEGG-----WPEQVRIMQQNWIGRSEGARVEFTLEATGD--------
SYL_DESVH       TDYAEELLADLSKLENG-----WPERVLSMQRNWIGKSTGAEIRFALDGRDD--------
SYL_DESVV       TDYAEELLADLSKLENG-----WPERVLSMQRNWIGKSTGAEIRFALDGRDD--------
SYL_DESAG       TSYAEELLADLEKLTGG-----WPDRVLTMQHNWIGKSVGAEIEFAVDGSDE--------
SYL_LAWIP       TDYAEELLDDLTTLKYS-----WPDRVITMQENWLGKSTGVEISFPIESSQD--------
SYL_GEOMG       TDYAEELLEYTEKLPG------WPERVLTMQRNWIGKSYGCEIDFPVEGSLA--------
SYL_GEOSL       TRYAEELLEDTWNLPG------WPERVLVMQRNWIGKSFGCEIDFPVEGKVE--------
SYL_GEOUR       TDYAEELLEYTYKLPG------WPERVLTMQRNWIGRSTGCEIDFPIEGQMD--------
SYL_PELPD       TQYAEELLSYTEKLPG------WPERVLVMQKNWIGKSHGCEVDFPLEGGTG--------
SYL_PELCD       TDYAQELLDDTSKLSG------WPEPVLTMQRNWIGRSTGCEIDFPVADSDL--------
SYL_SYNAS       TAYIDELLAGCDRLTG------WPERVLTMQRNWIGKSYGCEVSFPMADGNG--------
SYL_SYNFM       TDYVEELLDYTHRLPG------WPERVLTMQQNWIGKSLGSKLLFPLASGDG--------
SYL_DESPS       TDYAEELLADLDKLTG------WPEKVRTMQRNWIGKSTGLSCDFQLEDMDD--------
SYL_FUSNN       TDYADELLEGHEEIK-----DGWPEKVLTMQKNWIGKSFGTELKLKVVETGE--------
SYL_TRIV2       TDYAEELLNDLDKL------TGWPERVKLMQANWIGKSVGAYLEFPIVGSTEK-------
SYL_NOSS1       TDYAEELLNDLDKL------TGWPERVKLMQANWIGKSSGAYLEFPIVGSNEK-------
SYL_ACAM1       TDYAEELLTDLDKL------TGWPERVKTMQANWIGKSVGAYLEFPIVGMDEK-------
SYL_TRIEI       TDYAEQLLNDLDKL------PGWPERVKLMQANWIGKSVGAYLEFPIVGMDQK-------
SYL_SYNY3       TDYAEALLNDLEQL------TGWPERVKLMQSHWIGKSVGAYLEFPIKDSQEK-------
SYL_SYNE7       TDYAEELLQDLDQL------TGWPERVRLMQANWIGKSTGAYLEFPIVNSSDR-------
SYL_SYNP6       TDYAEELLQDLDQL------TGWPERVRLMQANWIGKSTGAYLEFPIVNSSDR-------
SYL_THEEB       TAYAEELLNDLEQL------TGWPERVKLMQANWIGQSRGAYLEFPIVGSDEK-------
SYL_SYNJB       TAYADQLLADLEKL------SGWPERVRTMQENWIGQSVGAKVIFKT-EAGDE-------
SYL_SYNJA       TAYADQLLADLEKL------SGWPERVLTMQENWIGQSVGARVVFKT-ETGEE-------
SYL_GLOVI       TDYAEELLQALGTL------GDWPERVRVMQENWIGKSVGAELCFPINGEPEG-------
SYL_SYNS3       TDYADALLDDLDQL------QGWPERVRTMQANWIGRSIGAEIDFQVEAHPGTS------
SYL_SYNPW       TNYADALLDDLDLL------KGWPERVRTMQANWIGRSIGAEIDFRVSDHDDAV------
SYL_PROMM       TDYADALIDDLDEL------TGWPERVRTMQANWIGRSHGAEIKFRVAGVANSI------
SYL_PROM3       TDYADALIDDLDEL------TGWPERVRTMQANWIGRSHGAEIKFRVAGQTNSI------
SYL_SYNSC       TDYAEPLLNDLDAL------KGWPERVRTMQANWIGRSEGAEISFNVEGAQNQT------
SYL_SYNS9       TDYAEALLNDLDKL------KGWPERVRTMQANWIGRSEGAEITFQVTGSSQQS------
SYL_SYNPX       TQYAEALLNDLDQL------SGWPERVRTMQANWIGRSEGAEIQFKVSSDSDTT------
SYL_SYNR3       TAVADELLDDLEQL------KGWPERVRTMQANWIGRSSGATLRFAIEADGKQA------
SYL_PROMT       TSFAEDLNKDLIKL------NDWPDRVRVMQKNWIGKSIGAEITFEIK-NSDQK------
SYL_PROM1       TSFAEDLNKDLVTL------NDWPDRVRVMQKNWIGKSIGAEITFDIK-NSDQK------
SYL_PROMA       TDFADELLEDIELL------SGWPQNVKTMQQNWIGRSNGTEIDFYIKGKNNIF------
SYL_PROM0       TNYADELLKDLEKL------DNWPERVKIMQDNWIGKSIGTNINFNINTHPEKK------
SYL_PROM9       TNYADELLKDLEKL------DNWPERVKIMQDNWIGKSIGTNINFNINTNPEKK------
SYL_PROMS       TNYADELLKDLEKL------DNWPERVKIMQDNWIGKSIGANINFNINTNPEKN------
SYL_PROM2       TNYADELLKDLEKL------DNWPERVKIMQDNWIGKSIGTNINFNLNTNPEEK------
SYL_PROMP       TDYAEELLQDLEKL------NEWPERVKIMQENWIGKSIGTNINFKIKEFKKEK------
SYL_PROM5       TNYTEELLQDLEKL------SEWPERVKIMQENWIGKSKGANIIFKINEFENEK------
SYL_SOLUE       TDYADQLLDEMARLE-----GGWPERVLTMQRNWIGRSEGAEIDFTLAGAGT--------
SYL_DEIRA       TDYAEELLD-FSATD-------MPEKVRAMQTNWIGKSVGAEVTF-------------DT
SYL_DEIGD       TDYAEELLD-FRDTD-------MPERVRAMQTNWIGKSVGAEITF-------------DT
SYL_RUBXD       TDYAEELLD-FSEIE-------WPERVKALQRNWIGRSEGAEIEF-------------EI
SYL_CLOPE       TDYADELLDKLDGLD-------WPEKTVSMQKHWIGRSTGSQVNF-------------KV
SYL_CLOPS       TDYADELLDKLDGLD-------WPEKTVSMQKHWIGRSTGSQVNF-------------KV
SYL_CLOP1       TDYADELLDKLDDLD-------WPEKTVSMQKHWIGRSTGSQVNF-------------KV
SYL_CLOB8       TEYGDELLDKLDGLD-------WPEKTKSMQKHWIGRSYGAEVTF-------------KV
SYL_CLOB1       TDYADELLEKLDELD-------WPEKTKAMQKHWIGKSVGAEVTF-------------NV
SYL_CLOBH       TDYADELLEKLDELD-------WPEKTKAMQKHWIGKSVGAEVTF-------------NV
SYL_CLOBL       TDYADELLEKLDELD-------WPEKTKAMQKHWIGKSVGAEVTF-------------NV
SYL_CLONN       TDYADELLEKLDGLD-------WPEKTKAMQKHWIGKSKGVEATF-------------KV
SYL_CLOAB       TNYAEELLQKLDELD-------WPEKTKAMQKHWIGKSKGAEVTF-------------KV
SYL_CLOK5       TDYTEELLKDLDNID-------WPEKTKAMQRHWMGKSTGTDVTF-------------KV
SYL_CLOTE       TDYAEELLEKLDDLD-------WPENTKSMQKHWIGKSIGAQLTF-------------KI
SYL_CALS4       TAYAEELLEKLDDLD-------WPEKTKMMQRNWIGKSEGAEIEF-------------KI
SYL_ROSCS       TAYAERLLNDLDKLDK------WPENVKTMQRNWIGRSEGAEVTFLALPPGADLHA--PP
SYL_ROSS1       TAYAERLLNDLDKLDR------WPENVKTMQRNWIGRSEGAEVTFLALPPGADLYA--PP
SYL_THEFY       TDYAQRLLDDMEQLE-----GKWPERVLTMQRNWIGRSEGADVQFTIEGR----------
SYL_ACIC1       TEYAQRLLDDMALLE-----GRWPERVLTMQRNWIGRSEGAYVDFTIEGR----------
SYL_ARTS2       TDYADRLLDDMDELR-----GHWPERVLAMQKNWIGRSEGAHVNFVIEAAGDKP------
SYL_PAEAT       TDYADRLLEDMDQLQ-----GHWPERVLAMQRNWIGRSEGAHVRFVIEATADRA------
SYL_RENSM       TDYADRLLDDMAQLE-----GHWPERVLAMQRNWIGRSQGAHVDFVIDGMSDAETGE---
SYL_CLAMS       TDYADRLVDDLNQLE-----GTWPAKVLSMQRNWIGRSIGAEVDFVVEGR----------
SYL_CLAM3       TDYADRLVDDLNQLE-----GTWPAKVISMQRNWIGRSIGAEVDFVVEGR----------
SYL_LEIXX       TDYADRLLDDLNQLE-----GAWPAKVILMQRNWIGRSTGADVQFAIEGR----------
SYL_KINRD       TEYADRLLDDLDTLE-----GQWPAKVISMQRNWIGRSTGAEVEFAIEGR----------
SYL_NOCSJ       TDYAQELLDRLDDLE-----PTWPARVVTAQRNWIGRSEGAHVDFVVDGR----------
SYL_TROW8       TAYADRLLDDLSMLE-----NNWPERVITMQRNWIGRSEGVSIEFNIPTL----------
SYL_TROWT       TAYADRLLDDLSMLE-----NNWPERVITMQRNWIGRSEGVSIEFNIPTL----------
SYL_MYCPA       TAYSDRLLDDLDLL-------DWPEPVKTMQRNWIGRSTGAKALFAA-------------
SYL_MYCA1       TAYSDRLLDDLDLL-------DWPEPVKTMQRNWIGRSTGAKALFAA-------------
SYL_MYCLE       TAYADRLLDDLDLL-------DWPEQVKTMQRNWIGRSSGATVLFSAILSR---------
SYL_MYCTA       TAYADRLLDDLDVL-------DWPEQVKTMQRNWIGRSTGAVALFSA--RA---------
SYL_MYCBO       TAYADRLLDDLDVL-------DWPEQVKTMQRNWIGRSTGAVALFSA--RA---------
SYL_MYCTU       TAYADRLLDDLDVL-------DWPEQVKTMQRNWIGRSTGAVALFSA--RA---------
SYL_MYCBP       TAYADRLLDDLDVL-------DWPEQVKTMQRNWIGRSTGAVALFSA--RA---------
SYL_MYCUA       TAYSDRLLDDLDVL-------DWPDQVKTMQRNWIGRSTGASALFTA-------------
SYL_MYCSS       TAYSDRLLEDLEVL-------DWPDKVKTMQRNWIGRSTGASVQFGT-------------
SYL_MYCSK       TAYSDRLLEDLEVL-------DWPDKVKTMQRNWIGRSTGASVQFGT-------------
SYL_MYCSJ       TAYSDRLLEDLEVL-------DWPDKVKTMQRNWIGRSTGASVQFGT-------------
SYL_MYCS2       TAYSDRLLEDLDVL-------DWPEKVKTMQRNWIGRSTGASVLFAT-------------
SYL_MYCVP       TAYSDRLLEDLDVL-------DWPDKVKTMQRNWIGRSTGASVEFGT-------------
SYL_MYCGI       TAYSDRLLEDLDVL-------DWPDKVKTMQRNWIGRSTGAEVQFST-------------
SYL_NOCFA       TAYADRLVDDLDLL-------DWPENVKAMQRNWIGRSRGAQVRFDS-------------
SYL_RHOJR       TAYSDRLVDDLEYL-------DWPEKVKTMQRNWIGRSHGAQVKFQA-------------
SYL_SACEN       TAYADRLIDDLDRL-------DWPDKIKTMQRNWIGRSQGANVVFPL-------------
SYL_CORGB       TAYSDRLIDDLELL-------DWTEKVKSMQRNWIGRSRGAEVDFSA-------------
SYL_CORGL       TAYSDRLIDDLELL-------DWTEKVKSMQRNWIGRSRGAEVDFSA-------------
SYL_COREF       TAYSDRLIDDLELL-------DWPEKVKSMQRNWIGRSRGAEVDFTA-------------
SYL_CORDI       TAYSDRLIDDLDLL-------DWPDKVKSMQRNWIGRSRGAEVDFDA-------------
SYL_CORJK       TAYSDRLIDDLEYL-------DWPEKVKSMQRNWIGRSRGAEVTFDC-------------
SYL_STRCO       TAYADRLLDDLDQL-------DWPEAIKLQQRNWIGRSEGARVDFPVDG-----------
SYL_STRAW       TAYADRLLDDLDAL-------DWPEAIKLQQRNWIGRSEGARVDFPIDG-----------
SYL_SALAI       TAYGDRLLDDLDKL-------DWPEPIKLMQRNWIGRSIGAHIEFPTSAG----------
SYL_BIFAA       TAYGHRLIEDLDTI-------DWPEKVKLMQRNWIGESHGASVHFDVETPN---------
SYL_BIFLO       TKYGHRLIADLDGI-------NWPEKVKLMQRNWIGESHGASVHFIVATAD---------
SYL_FRACC       TAYAERLISDLDLV-------DWPDSIKQMQRNWISPSEGASVEFTVVAPGEEAGASD--
SYL_FRAAA       TAYAERLVDDLDLV-------DWSDSIKQMQRNWIGPSDGAGVEFAVVPP------SG--
                      :                       *  *:.   *                    

SYL_GEOKA       -----------------ETFTVFTTRPDTLFGATYTVLAPEHPLVEKITTPE--------
SYL_GEOTN       -----------------ESFTVFTTRPDTLFGATYAVLAPEHPLVEKITTPE--------
SYL_BACCZ       -----------------EKFTVFTTRPDTLFGASYCVLAPEHALVADITTAD--------
SYL_BACAH       -----------------EKFTVFTTRPDTLFGASYCVLAPEHALVADITTAD--------
SYL_BACAN       -----------------EKFTVFTTRPDTLFGASYCVLAPEHALVADITTAD--------
SYL_BACHK       -----------------EKFTVFTTRPDTLFGASYCVLAPEHALVADITTAE--------
SYL_BACC1       -----------------EKFTVFTTRPDTLFGASYCVLAPEHALVADITTAE--------
SYL_BACCR       -----------------EKFTVFTTRPDTLFGATYCVLAPEHALVAEITTAE--------
SYL_BACCN       -----------------KKFTIFTTRPDTLFGATYCVLAPEHALVAEITTED--------
SYL_BACSU       -----------------DSFTVFTTRPDTLFGATYTVLAPEHALVENITTAE--------
SYL_BACVZ       -----------------DTFTVFTTRPDTLFGAAYAVLAPEHELVEAITTPE--------
SYL_BACLD       -----------------ETFTVFTTRPDTLFGATYAVLAPEHDLVQKITTPE--------
SYL_BACP2       -----------------EQFTVFTTRPDTLFGATYAVLAPEHALVEKITTAT--------
SYL_BACHD       -----------------DTITVFTTRPDTLFGATYMVLAPEHKLVDAITTSE--------
SYL_BACSK       -----------------HSVNVFTTRPDTLFGATYMVLAPEHKLVTEITTDE--------
SYL_OCEIH       -----------------GTFTVFTTRPDTLFGATYAVVAPEHPLVKEITTLS--------
SYL_STAES       -----------------QNIEVFTTRPDTIYGTSFLVLSPEHPLVNEITTSD--------
SYL_STAEQ       -----------------QNIEVFTTRPDTIYGTSFLVLSPEHPLVNEITTSD--------
SYL_STAAW       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAS       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAN       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAA1       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAM       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAA9       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAA2       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAA3       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAC       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAA8       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAT       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAE       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAB       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDE--------
SYL_STAAR       -----------------GKVEVFTTRPDTIYGASFLVLSPEHALVDSITTDE--------
SYL_STAHJ       -----------------ASIDVFTTRPDTIYGTTFLVLSPEHSLVNEITSED--------
SYL_STAS1       -----------------EQIEVFTTRPDTIYGASFLVLSPEHELVDLITTED--------
SYL_LISMF       ------------------TFNVFTTRPDTLFGATYTVFAPEHELIEKITTPE--------
SYL_LISMO       ------------------TFNVFTTRPDTLFGATYTVFAPEHELIEKITTPE--------
SYL_LISIN       ------------------TFNVFTTRPDTLFGATYTVFAPEHELIEKITTPE--------
SYL_LISW6       ------------------TFNVFTTRPDTLFGATYTVFAPEHELIEKITTPE--------
SYL_ENTFA       ------------------SFTVFTTRPDTLFGATYTVLAPELELVKKITTPE--------
SYL_STRTD       ------------------EFTVFTTRPDTLFGATFTVLAPEHDLVDAITSPE--------
SYL_STRT2       ------------------EFTVFTTRPDTLFGATFTVLAPEHDLVDAITSPE--------
SYL_STRT1       ------------------EFTVFTTRPDTLFGATFTVLAPEHDLVDAITSPE--------
SYL_STRP2       ------------------EFTVFTTRPDTLFGATFTVLAPEHELVDAITSSE--------
SYL_STRR6       ------------------EFTVFTTRPDTLFGATFTVLAPEHELVDAITSSE--------
SYL_STRPN       ------------------EFTVFTTRPDTLFGATFTVLAPEHELVDAITSSE--------
SYL_STRSV       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITSAE--------
SYL_STRGC       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDVITSAE--------
SYL_STRS2       ------------------DFTVFTTRPDTLFGATYAVLAPEHDLVDSITSAE--------
SYL_STRSY       ------------------DFTVFTTRPDTLFGATYAVLAPEHDLVDSITSAE--------
SYL_STRPD       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRPG       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRP6       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRPM       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRPF       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRPB       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTSD--------
SYL_STRPC       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTSD--------
SYL_STRP3       ------------------NFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRP1       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRP8       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRA3       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRA5       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRA1       ------------------DFTVFTTRPDTLFGATYAVLAPEHALVDAITTAD--------
SYL_STRMU       ------------------EFTVFTTRPDTLFGATYAVLAPEHDLVDIITTAG--------
SYL_LACLM       ------------------SFEVFTTRPDTLFGATYAVLAPEHDLVDAITTPE--------
SYL_LACLA       ------------------SFEVFTTRPDTLFGATYAVLAPEHDLVDAITTPE--------
SYL_LACLS       ------------------SFEVFTTRPDTLFGATYAVLAPEHDLVDAITTPE--------
SYL_LACSS       ------------------NIDVFTTRADTMFGVSYIVMAPEHKLVADITTPE--------
SYL_LACDA       ------------------SFAVFTTRPDTLFGCSYTVLAPENELVKEITSPE--------
SYL_LACDB       ------------------SFAVFTTRPDTLFGCSYTVLAPENELVKEITSPE--------
SYL_LACP3       ------------------PFDVFTTRPDTLFGATYVVMAPEHELVQKITTPA--------
SYL_LACPL       -----------------TEIEVFSTRPDTLFGASYMVLAPEHDLVEQLTTPE--------
SYL_LACBA       -----------------TKIEVYTTRPDTLFGATYMVLAPEHAAVAKITTPE--------
SYL_PEDPA       ------------------QIEVFTTRPDTLFGATYLVISPEHDLVDQITTPE--------
SYL_LACS1       -----------------TKIEVFSTRPDTIFGVAALVLAPEHELVKQLTTPE--------
SYL_LACRD       -----------------TKIEVFTTRADTLFGASYVVLAPEQELVDQLTTPE--------
SYL_LEUMM       -----------------KQIEVYTTRPDTLFGAQYMVLSPEHELVDEITTLE--------
SYL_OENOB       -----------------YQVEVYTTRPDTLFGASYMVLAPEHDLVDKITTSE--------
SYL_SALRD       ------------------ALEVYTTRPDTLFGATYMVLAPEHELLDEITTDE--------
SYL1_RHIL3      ------------------VITVFTTRPETLFGASYILLAPEHPAVAAIVEPE--------
SYL_RHOBA       AFKRARESEGFPTDPGKDCLRVYTTRPDTLFGATYMVVAPEHPLIDVLVKPE--------
SYL_PELLD       -----------------KMLRVYTTRPDTLFGATYLVISPEHPMAEKLATAP--------
SYL_CHLPM       -----------------TMLRVYTTRPDTLFGATYLVISPEHAMAEKLATAQ--------
SYL_CHLCH       -----------------TTLKAYTTRPDTLFGATYLVIAPEHPMAEKLATAP--------
SYL_CHLTE       -----------------TNLRVYTTRPDTLFGATYLVISPEHPMAEKLAIAQ--------
SYL_CHLPD       -----------------RKLRVYTTRPDTLFGATFLVISPEHPLALKLATAQ--------
SYL_LEPBL       -----------------DGIRIFTTRPDTIFGVTYMVVAPEHPIVSEITTPE--------
SYL_LEPBJ       -----------------DGIRIFTTRPDTIFGVTYMVVAPEHPIVSEITTPE--------
SYL_LEPIC       -----------------EGIRIFTTRPDTIFGVTYMVVAPEHPIVSEITTPE--------
SYL_LEPIN       -----------------EGIRIFTTRPDTIFGVTYMVVAPEHPIVSEITTPE--------
SYL_BACTN       -----------------LEFTIFTTRADTMFGVTFMVLAPESDLVAQLTTPA--------
SYL_BACV8       -----------------IEFTIFTTRADTMFGVTFMVLAPESELVPQLTTEA--------
SYL_BACFR       -----------------IEFTIFTTRADTVFGVTFMVLAPESELVAKLTTPE--------
SYL_BACFN       -----------------IEFTIFTTRADTVFGVTFMVLAPESELVAKLTTPE--------
SYL_PARD8       -----------------KEFTIFTTRADTMFGVTFMVLAPESELVQQLTTAD--------
SYL_PORGI       -----------------CTFTIFTTRADTIFGVTFMVLAPESELVEEVTTEE--------
SYL_FLAPJ       EATLSDLRPSTL-----DYIEVFTTRPDTIFGVTFMTLAPEHPLVQEITTPE--------
SYL_FLAJ1       -----------------EVIEVFTTRPDTIFGVTFMTLAPEHDLVAKITTPE--------
SYL_GRAFK       -----------------FKIGVFTTRPDTIFGVSFMTLAPEHELVEKITTED--------
SYL_CYTH3       -----------------MELTVFTTRIDTTFGVTYVSIAPEHEWIGALTSPE--------
SYL_BDEBA       -----------------DTFEVFTTRPDTLFGVTFMVMAPEHPLVKKITSQP--------
SYL_SORC5       -----------------GALSVFTTRPDTLMGVTYVVLAPEHPLTTWLTSAESGASE---
SYL_TREDE       -----------------QKIKVYTTRPDTIFGATYMVLAPEHELVKSITTSNQE------
SYL_TREPA       -----------------QTIRVYTTRADTLFGVTYLVLAPEHEAVTALTTHAQR------
SYL_BORAP       -----------------DKIKVFTTRPDTIFGITYLVIAPENKLVEKITKDNFK------
SYL_BORBP       -----------------DKIKVFTTRPDTIFGITYLVIAPESKLIEKITKNNFK------
SYL_BORBU       -----------------DKIKVFTTRPDTIFGITYLVIAPENKLIEKITKNNFK------
SYL_CHLTR       -----------------GVIEVFTTRPDTLIGVSFLALAPEHPLVDLLTSDEQK------
SYL_CHLTA       -----------------GAIEVFTTRPDTLIGVSFLALAPEHPLVDLLTSDEQK------
SYL_CHLMU       -----------------GVLEVFTTRPDTLIGVSFLVLAPEHPLVDLLTSDEQK------
SYL_CHLFF       -----------------NFLEVFTTRPDTLCGVSFLVIAPEHPEVGQLIAEDRR------
SYL_CHLCV       -----------------RFLEVFTTRPDTIGGVSFLVVAPEHPEVNRLISENQR------
SYL_CHLAB       -----------------KCLEVFTTRPDTLCGVSFLVMAPEHPEIQQLVSEEQR------
SYL_CHLPN       -----------------GSLEAFTTRLDTLLGVSFLVIAPEHPDLDSIVSEEQR------
SYL_PARUW       -----------------EAFSVFTTRPDTLFGVSYLVLAPEHPLVSHITASSQQ------
SYL_ALKOO       -----------------KKITVYTTRPDTLFGSTYMVISPEHPYIEELAAHIQNM-----
SYL_UREP2       -------------------LDVFTTRIDTIYGVQYLVVAPEHPILKSITSEQ--------
SYL_UREPA       -------------------LDVFTTRIDTIYGVQYLVVAPEHPILKSITSEQ--------
SYL_MYCPU       -------------------IEVFTTRIETIFGATFLTISPEHPLVEKIVTSE--------
SYL_MYCPE       -------------------IEVFTSRPDTIFGVSFIGLSSDHELVLKEKTKN--------
SYL_MYCGA       -------------------IEVFSSRADTLFGASFLALSFDHPLVKQKLITD--------
SYL_MYCGE       -------------------IAIFTTKPQTIFGVSFLAVSTNHWLAKKIAETN--------
SYL_MYCPN       -------------------ITIFTTKVQTIFGVTFLALSNSHPLVKEVAKTN--------
SYL_MYCCT       -------------------IPVFTTRADTVFGATYIVLAPENELVLKLTTPN--------
SYL_MYCMS       -------------------IPVFTTRADTIFGVTYIVLASENELVLKLTAPE--------
SYL_MESFL       -------------------VPVFTTRIDTIYGVSYIVLAPEHEQVLNITTPE--------
SYL_ACHLI       -------------------FEIFTTRPDTIYGVTYCVLSPEHPLVEKIVTQD--------
SYL_PSEA6       ----------------ISSFDVYTTRPDTLYGVTYVAVAAQHPLALHAA-----------
SYL_COLP3       ------------------SFDIYTTRPDTLMGVTYVALAAQHPLAVAAA-----------
SYL_IDILO       ------------------TLRVYTTRPDTLYGVTYMGVAAQHPLATEAA-----------
SYL_PSEHT       ------------------TFSVYTTRPDTFMGVTYVAVAAGHPIAKEAA-----------
SYL_PSYIN       ------------------SFSVYTTRPDTVMGVTYVAVAAQHPLALEAA-----------
SYL_SALCH       ------------------TLTVYTTRPDTFMGATYLAVAAGHPLAQKAA-----------
SYL_SALTI       ------------------TLTVYTTRPDTFMGATYLAVAAGHPLAQKAA-----------
SYL_SALTY       ------------------TLTVYTTRPDTFMGATYLAVAAGHPLAQKAA-----------
SYL_SALPB       ------------------TLTVYTTRPDTFMGATYLAVAAGHPLAQKAA-----------
SYL_SALPA       ------------------TLIVYTTRPDTFMGATYLAVAAGHPLAQKAA-----------
SYL_CITK8       ------------------TLTVYTTRPDTFMGATYLAVAAGHPLAQKAA-----------
SYL_SALAR       ------------------TLTVYTTRPDTFMGATYLAVAAGHPLAQKAA-----------
SYL_SHIFL       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_SHIF8       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_SHIBS       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECOL6       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECOL5       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECO57       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_SHISS       ------------------MLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECOLI       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECOLC       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_SHIDS       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECOHS       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECOUT       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECOK1       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_ECO24       ------------------TLTVYTTRPDTFMGCTYLAVAAGHPLAQKAA-----------
SYL_KLEP7       ------------------KLTVYTTRPDTFMGCTYLAVAAGHPLAQQAA-----------
SYL_CROS8       ------------------KLTVYTTRPDTFMGVTYLAVAAGHPLAQAAA-----------
SYL_ENT38       ------------------KLTVYTTRPDTFMGATYLAVAAGHPLAQQAA-----------
SYL_YERPA       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA-----------
SYL_YERP3       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA-----------
SYL_YERPE       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA-----------
SYL_YERPN       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA-----------
SYL_YERPS       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA-----------
SYL_YERPP       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA-----------
SYL_YERE8       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLSLQAA-----------
SYL_SERP5       ------------------KLTVYTTRPDTFMGATYVAVAAGHPLAQQGA-----------
SYL_PECAS       ------------------KLSVYTTRPDTFMGVTYVAVAAGHPLAAQAA-----------
SYL_SODGM       ------------------TLTVYTTRPDTFMGTTYVAVAAGHPLSLQAA-----------
SYL_PHOLL       ------------------KLTVYTTRPDTFLGATYVAIAAGHPLAKQAA-----------
SYL_MANSM       ------------------TVAVYTTRPDTFYGVSYMAVAAGHPLAEKAA-----------
SYL_ACTSZ       ------------------TVAVYTTRPDTFYGVSYMAVAAGHPLAERAA-----------
SYL_HAES1       ------------------TLTVYTTRPDTFYGVSYLAVAAAHPLAESAA-----------
SYL_HISS2       ------------------TLTVYTTRPDTFYGVSYLAVAAAHPLAENAA-----------
SYL_PASMU       ------------------NLTVYTTRPDTFFGVSYVAVAAAHPLAEKAA-----------
SYL_HAEIG       ------------------KVAVYTTRPDTFYGVSYLGIAAAHPLASLAA-----------
SYL_HAEIN       ------------------KVAVYTTRPDTFYGVSYLGIAAAHPLASLAA-----------
SYL_HAEI8       ------------------KVAVYTTRPDTFYGVSYLGIAAAHPLASLAA-----------
SYL_HAEIE       ------------------KVAVYTTRPDTFYGVSYLGIAAAHPLASLAA-----------
SYL_ACTP2       ------------------ELPVYTTRPDTFFGVSYVAIAAAHPLAEMAA-----------
SYL_HAEDU       ------------------TLPVYTTRPDTFFGVSYLAVAAAHPLAELAS-----------
SYL_SHESA       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAELAA-----------
SYL_SHESM       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAELAA-----------
SYL_SHESR       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAELAA-----------
SYL_SHEON       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAEIAA-----------
SYL_SHEB9       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAEIAA-----------
SYL_SHEB5       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAEIAA-----------
SYL_SHEB8       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAEIAA-----------
SYL_SHESW       ------------------TFDIYTTRPDTLMGVTYVAIAAGHPLAEIAA-----------
SYL_SHEPC       ------------------TFDIYTTRPDTLMGVTYVAIAAGHPLAEIAA-----------
SYL_SHEAM       ------------------SFDIYTTRPDTVMGVTYVAIAAGHPLAEKAA-----------
SYL_SHEHH       ------------------SFDIYTTRPDTVMGVTYVAIAAGHPLAEQAA-----------
SYL_SHEPA       ------------------SFDIYTTRPDTVMGVTYVAIAAGHPLAEQAA-----------
SYL_SHELP       ------------------SFDIYTTRPDTVMGVTYVAIAAGHPLAQQAA-----------
SYL_SHESH       ------------------TFDIYTTRPDTVMGVTYVAIAAGHPLAEKAA-----------
SYL_SHEDO       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAEQAA-----------
SYL_SHEFN       ------------------SFDIYTTRPDTLMGVTYVAIAAGHPLAEQSA-----------
SYL_VIBPA       ------------------DLEVYTTRPDTLMGVTYVGIAAGHPLATLAA-----------
SYL_VIBCB       ------------------DLEVYTTRPDTLMGVTYVGIAAGHPLATIAA-----------
SYL_VIBVU       ------------------DLEVYTTRPDTLMGVTYVGIAAGHPLAKIAA-----------
SYL_VIBVY       ------------------DLEVYTTRPDTLMGVTYVGIAAGHPLAKIAA-----------
SYL_VIBCH       ------------------DLEVYTTRPDTLMGVTYVGIAAGHPLATKAA-----------
SYL_VIBC3       ------------------DLEVYTTRPDTLMGVTYVGIAAGHPLATKAA-----------
SYL_ALIF1       ------------------PLEVYTTRPDTLMGVTYVGIAAGHPLAEKAS-----------
SYL_PHOPR       ------------------PLEVYTTRPDTLMGVTYVGIAAGHPLAEKAA-----------
SYL_AERS4       ------------------QLEVYTTRPDTFMGVTYVGIAAGHPLALQAA-----------
SYL_AERHH       ------------------HLEVYTTRPDTFMGVTYVGIAAGHPLALQAA-----------
SYL_MARHV       ----------------EGGLTVYTTRPDTLMGVSYMAVAAEHPLAKAAA-----------
SYL_HAHCH       ----------------DGDLQVYTTRPDTIMGVTYVAIAPQHPLALEAA-----------
SYL_SACD2       ----------------TTGFDVYTTRPDTLMGVTYVSLAAEHPIAKALA-----------
SYL_MARMS       ----------------DERLSVYTTRPDTIMGVTYVAVATQHPLSLEAS-----------
SYL_ALCBS       -----------------ESLRVYTTRPDTLMGVSYVAVAAGHPLAQKAA-----------
SYL_PSEAB       ---------------HAGQLKVFTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_PSEAE       ---------------HAGQLKVFTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_PSEA7       ---------------HAGQLKVFTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_PSEU5       ---------------NEGVMKVFTTRPDTLMGATYVAVAAEHPLATLAA-----------
SYL_PSEMY       ---------------IDGQLKVYSTRPDTLMGATYVAVAAEHPLAQRAA-----------
SYL_PSEP1       ---------------HEGTLKVFTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_PSEPK       ---------------HEGTLKVFTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_PSEPG       ---------------HEGTLKVFTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_PSEE4       ---------------HEGTLKVFTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_PSEU2       ---------------EAGALKVFTTRPDTLMGATYVAVAAEHPLATLAA-----------
SYL_PSE14       ---------------EAGALKVFTTRPDTLMGATYVAVAAEHPLATLAA-----------
SYL_PSESM       ---------------EAGALKVFTTRPDTLMGATYVAVAAEHPLATLAA-----------
SYL_NEIMB       ---------------YAKFLQVYTTRPDTLMGATYVAVAAEHPLAAAAA-----------
SYL_NEIMF       ---------------YAKLLQVYTTRPDTLMGATYVAVAAEHPLAAAAA-----------
SYL_NEIG1       ---------------YAKFLQVYTTRPDTLMGATYVAVAAEHPLATAAA-----------
SYL_NEIM0       ---------------YARFLQVYTTRPDTLMGATYVAVAAEHPLATAAA-----------
SYL_NEIMA       ---------------YAKFLQVYTTRPDTLMGATYVAVAAEHPLATAAA-----------
SYL_CHRVO       ---------------HAGELKVYTTRPDTLMGATYVAVAAEHPLATQAA-----------
SYL_THIDA       ------------------KLWVFTTRADTLMGVTFVAVAAEHPLAARAA-----------
SYL_DECAR       ------------------KLWVFTTRADTIMGVTFVAVAAEHPLATKAA-----------
SYL_AZOSB       ------------------VLKVFTTRGDTLMGATYVAVAAEHPLATQAA-----------
SYL_CUPMC       ---------------DG-KLYVFTTRADTIMGVTFCAVAAEHPLATHAA-----------
SYL_CUPPJ       ---------------DG-KLYVFTTRADTIMGVTFCAVAAEHPLATHAA-----------
SYL_RALSO       ---------------DG-KLYVFTTRADTIMGVTFCAVAAEHPIAAHAA-----------
SYL_JANMA       ---------------DG-KLWVFTTRADTIKGVTFCAVAPEHALATFAA-----------
SYL_HERAR       ---------------DG-KLWVFTTRADTIKGVTFCAVAAEHPLATFAA-----------
SYL_BURCH       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLATRLA-----------
SYL_BURCA       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLATRLA-----------
SYL_BURL3       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLATRLA-----------
SYL_BURCM       ------------------LLRVFTTRADTILGVTFCAVAAEHPLATRLA-----------
SYL_BURVG       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLATRLA-----------
SYL_BURP0       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURPS       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURP6       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURP1       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURM7       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURM9       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURMA       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURMS       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_BURTA       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLAARLA-----------
SYL_PARXL       ------------------LLRVFTTRADTIMGVTFCAIAAEHPLATRLA-----------
SYL_POLAQ       ---------------DG-LLYVFTTRADTIMGVTFCAVAAEHPLASKAA-----------
SYL_BORBR       ---------------DG-KLYVFTTRADTIMGVTFCAVAPEHPLATHAA-----------
SYL_BORPA       ---------------DG-KLYVFTTRADTIMGVTFCAVAPEHPLATHAA-----------
SYL_BORPE       ---------------DG-KLYVFTTRADTIMGVTFCAVAPEHPLATHAA-----------
SYL_BORPD       ---------------DG-RLYVFTTRADTIMGVTFCAVAPEHPLATHAA-----------
SYL_BORA1       ---------------DG-KLFVFTTRADTVMGVTFCAVAPEHPLATLAA-----------
SYL_METPP       ---------------DG-LMHVFTTRADTIMGVTFCAVAPEHPLATHAA-----------
SYL_ACISJ       ---------------DG-KLYVFTTRADTIMGVTFCAVAPEHPLAQHAA-----------
SYL_ACIAC       ---------------DG-RMYVFTTRADTIMGVTFCAVAPEHPLAAHAA-----------
SYL_RHOFT       ---------------DG-RMYVFTTRPDTIKGVTFCAVAPEHPLALHAA-----------
SYL_VEREI       ---------------GG-RLYVFTTRADTIMGVTFCAVAPEHPLASHAA-----------
SYL_POLNA       ---------------DG-QMYVFTTRADTIMGVTFCAVAPEHPLAVHAA-----------
SYL_POLSJ       ---------------GG-KMYVFTTRADTIMGVTFCAVAPEHPLALHAA-----------
SYL_METCA       ------------------VLKVYTTRPDTLMGATYVAVAAEHPLALEAA-----------
SYL_DICNV       ---------------NAQFLQIYTTRPDTIFGVTFLAVAAEHPLALAAA-----------
SYL_PSYCK       ---------------QSNSLDVFTTRPDTLMGVTYVAVAAEHPLAQYAS-----------
SYL_PSYA2       ---------------ESNSLDVFTTRPDTLMGVTYVAVAAEHPLAQYAS-----------
SYL_PSYWF       ---------------DISTLDVFTTRPDTLMGVTYVAVAAEHRLAKLAA-----------
SYL_ACIAD       ---------------YADGLTVYTTRADTLMGVTYVAVAAEHPMALKAA-----------
SYL_NITEU       ------------------ALKVFTTRADTLMGVTYVAVAAEHPVALHAA-----------
SYL_NITEC       ------------------ALKVFTTRADTLMGATYVAVAAEHPVALYAA-----------
SYL_NITMU       ------------------DLKVFTTRADTLFGVTYVAVAAEHPVAQHAA-----------
SYL_METFK       ------------------TLKVYTTRPDTLMGATYVAIAAEHALATQAA-----------
SYL_HYDCU       ----------------NGSLKVYTTRPDTLMGVTYVAVAADHPWARKAS-----------
SYL_XYLFA       -----------------EALRVFTTRPDTLLGVTFVSIAAEHPLALHAA-----------
SYL_XYLFT       -----------------EALRVFTTRPDTLFGVTFVSIAPEHPLALHAA-----------
SYL_XANC8       -----------------DPLRVFTTRPDTLMGVTFVSIAAEHPLAQHAA-----------
SYL_XANCP       -----------------DPLRVFTTRPDTLMGVTFVSIAAEHPLAQHAA-----------
SYL_XANCB       -----------------DPLRVFTTRPDTLMGVTFVSIAAEHPLAQHAA-----------
SYL_XANC5       -----------------DPLRVFTTRPDTLMGVTFVSIAAEHPLALHAA-----------
SYL_XANAC       -----------------DPLRVFTTRPDTLMGVTFVSIAAEHPLALHAA-----------
SYL_XANOR       -----------------DPLRVFTTRPDTLMGVTFVSIAAEHPLALHAA-----------
SYL_XANOM       -----------------DPLRVFTTRPDTLMGVTFVSIAAEHPLALHAA-----------
SYL_NITOC       -----------------EALAVFTTRPDTLMGVTFVSVAAEHPLAREAA-----------
SYL_ALKEH       -----------------DTLRVYTTRPDTLYGVTYVGLAPEHPLAAEAA-----------
SYL_HALHL       -----------------EQLTVFTTRPDTLYGVTYMGLAPEHPISLELA-----------
SYL_CHRSD       -----------------EQLEVYTTRPDTLYGVTYVAVAAGHPLARQAA-----------
SYL_BUCAI       ---------------------VFTQRLDLLMGVTYISISSCHKLSINLS-----------
SYL_BUCAP       ---------------------AFTNRLDLIMGATYISISPCHEFSVHVS-----------
SYL_BUCCC       ---------------------IFTTKPETIMGISFFAISMYHPLINLFL-----------
SYL_BUCBP       ---------------------VFISKPSTLMGATFITLSPSHELSFKIA-----------
SYL_WIGBR       ---------------------IYVSKLEIFMGITFIVISKEHKLIKFIE-----------
SYL_BLOPB       ---------------------IYMTRLDIFMGITYLVISTDHPIALQVA-----------
SYL_BLOFL       ---------------------VYIARLDTFMGISYLTISVDHPITLQIA-----------
SYL_BAUCH       ---------------------IYTTRPDTLMGVTYLSIAINHHLAQQAA-----------
SYL_COXBU       -----------------DKLQVYTTRPDTLMGVTYLAIAPEHPLAKERA-----------
SYL_COXBR       -----------------DKLQVYTTRPDTLMGVTYLAIAPEHPLAKERA-----------
SYL_COXBN       -----------------DKLQVYTTRPDTLMGVTYLAIAPEHPLAKERA-----------
SYL_LEGPH       -----------------KRLKIYTTRPDTLMGATYLAVATDHPLAKEAA-----------
SYL_LEGPC       -----------------KRLKIYTTRPDTLMGATYLAVATDHPLAKEAA-----------
SYL_LEGPA       -----------------KRLKIYTTRPDTLMGATYLAVATDHPLAKEAA-----------
SYL_LEGPL       -----------------KRLKIYTTRPDTLMGATYLAVATDHPLAKEAA-----------
SYL_FRATT       -----------------QEIEVFTTRPDTLMGVNYLGIAPEHPLALKEA-----------
SYL_FRAT1       -----------------QEIEVFTTRPDTLMGVNYLGIAPEHPLALKEA-----------
SYL_FRATW       -----------------QEIEVFTTRPDTLMGVNYLGIAPEHPLALKEA-----------
SYL_FRATF       -----------------QEIEVFTTRPDTLMGVNYLGIAPEHPLALKEA-----------
SYL_FRATH       -----------------QEIEVFTTRPDTLMGVNYLGIAPEHPLALKEA-----------
SYL_FRATO       -----------------QEIEVFTTRPDTLMGVNYLGIAPEHPLALKEA-----------
SYL_FRATN       -----------------QEIEVFTTRPDTLMGVNYLGIAPEHPLALEEA-----------
SYL_FRAP2       -----------------KEIEVFTTRPDTLMGVSYLGIAPEHPLALEEA-----------
SYL_RUTMC       -----------------DSIKVYTTRPDTLMGVTYLVISSEHPIALEAG-----------
SYL_VESOH       -----------------DPLIIYTTRPDTLMGVTYLAISFEHPLALESG-----------
SYL_RICRS       -------------------IEVFSTKPETIFGASFIGIAFNHPIIERLV-----------
SYL_RICRO       -------------------IEVFSTKPETIFGASFIGIAFNHPIIERLV-----------
SYL_RICCN       -------------------IEVFSTKPETIFGASFIGIAFNHPIIERLV-----------
SYL_RICM5       -------------------IEVFSTKPETIFGASFIGIAFNHPIIERLV-----------
SYL_RICFE       -------------------IEVFSTKPETIFGAGFIGIAFNHPIIEKLI-----------
SYL_RICAH       -------------------IEVFSTKPETIFGAGFIGIAFNHPIIERLV-----------
SYL_RICCK       -------------------IEVFSTKPETIFGASFIGIAFNHPIIEKLI-----------
SYL_RICBR       -------------------IEVFSTKPETIFGASFVGIAFNHPIIEKLV-----------
SYL_RICPR       -------------------IEVFSTKPETIFGASFIGIAFNHPIIEQLI-----------
SYL_RICTY       -------------------IEVFSTKPETIFGASFIGIAFNHPIIEQLI-----------
SYL_ORITB       -------------------VKVFSTRPETLFGASFIALSYNHNLVQQYV-----------
SYL_WOLPM       -------------------LKVFTTYPHTLFGASFCAVAAEHPIVQDLK-----------
SYL_WOLTR       -------------------LKVFTTCPHTLFGASFCAVAIEHPIVQDLM-----------
SYL_EHRRW       -------------------LQVFTTSPHTLFGASFIAVSFDHPILKYVN-----------
SYL_EHRRG       -------------------LQVFTTSPHTLFGASFIAVSFDHPILKYVN-----------
SYL_EHRCJ       -------------------LQVFTTCPHTLFGASFIAVSFDHPILQCVS-----------
SYL_EHRCR       -------------------LQVFTTCPHTLFGAAFIAVSFDHPILQYVN-----------
SYL_ANAMM       -------------------LEVFSTMPHMLFGASFCAVSAEHPILRHVT-----------
SYL_NEOSM       -------------------IEVFTTRPETIFGASFCAISVNHPLVNELNLLSNAERE---
SYL2_RHIL3      --------------AGESEVTVYTTRPDTLFGASFLAIAADHPLAKDAA-----------
SYL_RHIEC       --------------AGETEITVYTTRPDTLFGASFLAIAADHPLAKDAA-----------
SYL_RHIME       --------------GEEKEVTVYTTRPDTLFGASFLAISADHPLARDAA-----------
SYL_SINMW       --------------GEEKELTVYTTRPDTLFGASFLAISADHPLARDAA-----------
SYL_AGRFC       --------------QGFSDITVYTTRPDTLFGASFLAIAADHPLAKELS-----------
SYL_BRUAB       --------------AGFSEVEVYTTRPDTLFGAAFVAISADHPLAKKLS-----------
SYL_BRUA2       --------------AGFSEVEVYTTRPDTLFGAAFVAISADHPLAKKLS-----------
SYL_BRUSI       --------------AGFSEVEVYTTRPDTLFGAAFVAISADHPLAKKLS-----------
SYL_BRUO2       --------------AGFSEVEVYTTRPDTLFGAAFVAISADHPLAKKLS-----------
SYL_BRUME       --------------AGFSEVEVYTTRPDTLFGAAFVAISADHPLAKKLS-----------
SYL_BRUSU       --------------AGFSEVEVYTTRPDTLFGAAFVAISADHPLAKKLS-----------
SYL_BRUC2       --------------AGFSEVEVYTTRPDTLFGAAFVAISADHPLAKKLS-----------
SYL_OCHA4       --------------EGFSEVEVYTTRPDTLFGAAFVGISADHPLAKKLA-----------
SYL_CHESB       --------------AGVGELEVYTTRPDTIFGASFLAVAPDHPLARKAA-----------
SYL_RHILO       ---------------GEHELEVYTTRPDTIFGASFMAVAADHPLAKKAA-----------
SYL_BART1       -------------CEAFDEVVCYSTRPDTLFGASFLALSVDHPIAQSLA-----------
SYL_BARHE       -------------CKSFDEVVCYSTRPDTLFGASFLALSVDHPLAQALA-----------
SYL_BARQU       -------------CEAFNEVVCYSTRPDTLFGASFLALSVDHPISQALA-----------
SYL_BARBK       -------------CEGFDEITCYSTRPDTLFGASFLALSVDHPVAQALA-----------
SYL_RHOP2       --------------AGETELKIFTTRPDTLFGAKFMAIAPDHPLAQAAA-----------
SYL_RHOPS       --------------AGETELKIFTTRPDTLFGAKFMAIAADHPLAQAAA-----------
SYL_RHOPA       --------------AGETELKIFTTRPDTLFGAKFMAIAADHPLAQAAA-----------
SYL_RHOP5       --------------AGESELKIFTTRADTLFGAKFMAIAADHPLALAAA-----------
SYL_NITHX       --------------NGEGELKIFTTRPDTLFGAKFMAIAPDHPLAQAAA-----------
SYL_NITWN       --------------NNESELKIFTTRPDTLFGARFMAIAPDHPLAQAAA-----------
SYL_BRASB       --------------AGETELKIFTTRPDTLFGAKFMAISADHPLAQAAA-----------
SYL_BRASO       --------------AGESELKIFTTRPDTLFGAKFMAISADHPLAQAAA-----------
SYL_BRADU       --------------AGESELKIFTTRPDTLFGAKFMAISADHPLATAAA-----------
SYL_RHOPB       --------------NHETEVEVFTTRPDTLFGAKFVALSPDHPLAAEAA-----------
SYL_AZOC5       -------------AAGTSAVKVYTTRPDTLFGASFLALSPDHPLTQHLA-----------
SYL_PARL1       ----------------NTKLEIFTTRPDTLYGASFCALSPHHPLTQSLA-----------
SYL_CAUVC       -------------DGMAEGLEVYTTRPDTLFGASFVGIAPEHPLAEQLA-----------
SYL_CAUSK       -------------AGHADGLEVYTTRPDTLFGASFVGIAPEHPLAEQLA-----------
SYL_MARMM       -------------EQFGATIDVFTTRPDTLFGASFLALAPDHPIVKALA-----------
SYL_HYPNA       -------------AGFEDGISVFTTRPDTLFGASFVALSPDHPLTLQLA-----------
SYL_RUEST       ---------------GEEAIEVYTTRPDTLMGASFVGISPDHPIAKKLE-----------
SYL_RUEPO       --------------HGIEALDVYTTRPDTLMGASFLGISPDHPLTKALE-----------
SYL_ROSDO       --------------DGHDRIEVYTTRPDTLLGASFVGISPDHPLAKLLE-----------
SYL_JANSC       --------------GGHDRVDVYTTRPDTLLGASFVGISPDHAIAKQLE-----------
SYL_DINSH       ---------------GGDPIPVYTTRPDTLMGASFVGISPGHPIAKALA-----------
SYL_RHOS1       --------------EGFDRLEVYTTRPDTLMGASFAAISPDHPLARHLE-----------
SYL_RHOS4       --------------EGFDRLEVYTTRPDTLMGASFAAISPDHPLARHLE-----------
SYL_RHOS5       --------------EGFDRLEVYTTRPDTLLGASFAAISPDHPLAKHLE-----------
SYL_PARDP       --------------D-FPTIEVYTTRPDTLMGASFVALSPDHPLVKALA-----------
SYL_ZYMMO       ------------------KIEVFTTRPDTLFGASFVAIACDHPIAKALA-----------
SYL_SPHWW       ------------------SFDVFTTRPDTMFGASFAAIAADHPIAQALS-----------
SYL_NOVAD       ------------------TVEVYTTRPDTIFGASFVAVAPDHPIAQGVA-----------
SYL_SPHAL       ------------------AFAVFTTRPDTLYGASFAAISPDHPLAEKLA-----------
SYL_GRABC       ---------------DQREIEVYTTRPDTLYGMSFVAIAADHPVAAALA-----------
SYL_GLUOX       ---------------DLDSVEVFTTRPDTLFGLSFIGISAEHPLARKVA-----------
SYL_ACICJ       ---------------GIESVPVYSTRPDTLFGMSFVALAPDHPLATAVA-----------
SYL_MAGSA       -------------------LEIFTTRPDTLFGAKFVAIAANHPLAAELA-----------
SYL_RHORT       -------------------LEVYTTRPDTLFGASFCAISANHPLAAEIA-----------
SYL_MAGMM       -------------------LPVYTTRPDTLMGVTFCSVAAEHPIAAAVA-----------
SYL_CAMJ8       -----------------SSLEVFTTRADTIYGVSYIALAPEHKIVQNLLS----------
SYL_CAMJJ       -----------------SSLEVFTTRADTIYGVSYIALAPEHKIVQNLLS----------
SYL_CAMJR       -----------------SSLEVFTTRADTIYGVSYIALAPEHKIVQNLLS----------
SYL_CAMJE       -----------------SSLEVFTTRADTIYGVSYIALAPEHKIVQNLLS----------
SYL_CAMJD       -----------------SSLEVFTTRADTIYGVSYVALAPEHKIVQNLLL----------
SYL_CAMC1       ----------------FDGFEVFTTRPDTIYGVSYTALAPEHPIVKALLE----------
SYL_CAMC5       ----------------FDGFEVFTTRPDTIYGVSYVALAPEHKVVRALLS----------
SYL_CAMFF       ----------------MDGFKVFTTRPDTIYGVSYAAIAPEHIVVKKLLE----------
SYL_CAMHC       ----------------VKSFKVFTTRPDTIYGMSYAALAPEHAVVKAVLE----------
SYL_ARCB4       ----------------FTKYFVFTTRPDTIYGVSYSALAPEHPIVKYIVE----------
SYL_NITSB       -----------------DGFEVFTTRPDTIYGVTYTALAPEHPVVKHLIE----------
SYL_WOLSU       ----------------FDSFEVFTTRPDTLYGVTYCALAPEHPLVRELMR----------
SYL_HELHP       ----------------KVKLEVFTTRPDTIYGVTYCAVAPEHPIVQQLIE----------
SYL_HELPY       ----------------IQEIEVFTTRADTIYGVTYIAIAPEHPLVEHAIK----------
SYL_HELPH       ----------------IQEIEVFTTRADTIYGVTYIAIAPEHPLVEHAIK----------
SYL_HELPJ       ----------------IQEIEVFTTRADTIYGVTYIAIAPEHPLVEHAIK----------
SYL_HELAH       ----------------IQEIEVFTTRADTIYGVTYIAIAPEHPLVEHAIK----------
SYL_THEMA       ------------------KIRVFTTRPDTLWGVTFMALAPESPLVEELVPEEKKE-----
SYL_THEP1       ------------------KIRVFTTRPDTLWGVTFMALAPESPLVEELVLEEKKE-----
SYL_THEM4       ------------------KIKVFTTRPDTIWGVTFMAIAPESPLVEMLVTDERKD-----
SYL_FERNB       ------------------KIRIFTTRPDTIYGVTFMAIAPESPLVMELVTEDKKK-----
SYL_PSELT       ------------------NIEVFTTRPDTLWGVTFMVLAPESDLVNHITLPELKG-----
SYL_CALS8       ------------------RIKVFTTRPDTLFGVTYLVLAPEHPLTKEIIAGKPQE-----
SYL_HUNT2       ------------------AVRVYTTRPDTIYGVTYVVIAPEHPVVKELIKGTEQE-----
SYL_DESHY       ------------------KIRVYTTRVDTIFGVSYVVLAPEHPLVQKLIAGTEYE-----
SYL_SYNWW       ------------------VLTVFTTRPDTVFGVTYMVLAPEHPLVEKICHP-EQE-----
SYL_CARHZ       ------------------TISVFTTRPDTIFGVTYMVLAPEHPLVEKISRGTQYE-----
SYL_PELTS       ------------------IITVYTTRPDTVFGVTYMVLAPEHPLVEKLIAGSKQE-----
SYL_MOOTA       ------------------EIPVFTTRPDTLYGVTYLVLAPEHPLVEKLTAGTPYE-----
SYL_DESRM       ------------------SITVFTTRPDTVYGVSYMVLAPEHPLVAKLIAGRPQE-----
SYL_SYMTH       ------------------KIPIFTTRPDTIYGVTFMVVAPEHPIVEKICTSGLIPE----
SYL_DESVH       ------------------SITVFTTRPDTIFGATFMSIAPEHPLVEELIDGKPQA-----
SYL_DESVV       ------------------SITVFTTRPDTIFGATFMSIAPEHPLVEELIDGKPQA-----
SYL_DESAG       ------------------TVKVFTTRPDTVFGSTFMSIAPEHPLVEKLITGTGQE-----
SYL_LAWIP       ------------------FITIFTTRPDTIFGATAIILAPEHPILETLLNDTPQK-----
SYL_GEOMG       ------------------KIKVFTTRQDTLYGATFMSLAPEHPMALELTTPD-RR-----
SYL_GEOSL       ------------------KVKVFTTRQDTLYGATFMSLAPEHPQALELTTPE-RR-----
SYL_GEOUR       ------------------KIKVFTTRQDTLFGATFMSLAPEHPMALELTTPE-NM-----
SYL_PELPD       ------------------SVRVFTTRPDTLFGATFMSLAPEHPQARELTTPD-RR-----
SYL_PELCD       ------------------KIKVFTTRQDTLYGATFMSLAAEHPLAMELVSAE-CK-----
SYL_SYNAS       ------------------DIKVFTTRQDTLFGATFMLIAAEHPLVMELIKGKPVE-----
SYL_SYNFM       ------------------SITVFTTRADTLFGATFMSLAPEHPLVEGLCRGNPQE-----
SYL_DESPS       ------------------KISIFTTRPDTIYGVTFMSLAPEHPLVEQLIAGTDRE-----
SYL_FUSNN       ------------------DLPIFTTRIDTIYGVSYAVVAPEHPIVEKILK----------
SYL_TRIV2       -------------------IAVYTTRPDTVYGVSYVVLAPEHPLTKQVTSK---------
SYL_NOSS1       -------------------IAVYTTRPDTVYGVSYVVLAPEHPLTKQVTTK---------
SYL_ACAM1       -------------------VAVFTTRPDTVYGVTYVVLAPEHPLTPQVTSK---------
SYL_TRIEI       -------------------IGVFTTRPDTVYGVSYVVLAPEHPLTAKVTTP---------
SYL_SYNY3       -------------------IAVFTTRPDTVYGVTYVVLAPEHPLTKVVTTA---------
SYL_SYNE7       -------------------VKVFTTRPDTVYGVSYVVLAPEHPLVTQVTTP---------
SYL_SYNP6       -------------------VKVFTTRPDTVYGVSYVVLAPEHPLVTQVTTP---------
SYL_THEEB       -------------------IGVFTTRPDTVYGVTYVVLAPEHPLTLKVTTS---------
SYL_SYNJB       -------------------LAVFTTRPDTLWGATFMVMSPEHPLVDKLTTA---------
SYL_SYNJA       -------------------LPVFTTRPDTLWGATFMVLAPEHPLVEKLTTP---------
SYL_GLOVI       -------------------IRVFTTRPDTVYGVTYLVLAPEHPLVERITAP---------
SYL_SYNS3       -------------------ITVFTTRPDTLFGVSYLVLAPDHALVDQLTTS---------
SYL_SYNPW       -------------------ITVFTTRADTLHGVSYVVLAPEHPLVATLTAE---------
SYL_PROMM       -------------------ITVFTTRPDTLHGASYVVLAPEHPLVESLTSP---------
SYL_PROM3       -------------------ITVFTTRPDTLHGASYVVLAPEHPLVEALTSP---------
SYL_SYNSC       -------------------ITVFTTRPDTLAGASYVVLAPENELVDSLSSE---------
SYL_SYNS9       -------------------ITVFTTRPDTLSGASYVVLAPEHQLVDGLTTE---------
SYL_SYNPX       -------------------ITVFTTRPDTLAGASCVVLAPDHPLVNSLTSP---------
SYL_SYNR3       -------------------IEVFTTRPDTVFGVSYVVLAPEHDLVDQLTSA---------
SYL_PROMT       -------------------ITAFTTRIDTVYGVSYLVLASNHPLIDQLISS---------
SYL_PROM1       -------------------ITAFTTRIDTVYGVSYLVLASNHPLIDQLISS---------
SYL_PROMA       -------------------ITVFTTRPDTLHGTEYLVLAPDHELINSIIDK---------
SYL_PROM0       -------------------LTVFTTRPDTLFGVTYLAISVNHSLIKNISDQ---------
SYL_PROM9       -------------------ITVFTTRPDTLFGVTYLAISINHSLIKNISDQ---------
SYL_PROMS       -------------------ITVFTTRPDTLFGVTYLAISVNHSLIKKITDQ---------
SYL_PROM2       -------------------ITVFTTRPDTLFGVTYLAISVNHSLIKYISDQ---------
SYL_PROMP       -------------------IQVFTTRPDTLFGVTYLAISVNHPLIKKISDN---------
SYL_PROM5       -------------------IKVFTTRPDTLFGVTYIAISINNPLINKISDN---------
SYL_SOLUE       ------------------PIRVFTTRVDTIYGATSVILAPEHPLNETLLD----------
SYL_DEIRA       -------------PA--GPETVFTTRPDTLMGATFMVLAPEHAKVKELTTD---------
SYL_DEIGD       -------------PA--GPETVFTTRPDTLMGATFLVLAPEHPKVPALTTP---------
SYL_RUBXD       -------------EGY-GGVTVFTTRPDTLFGATFFVVAPEHPAVESITTP---------
SYL_CLOPE       -------------KDSDLNFDVFTTRVDTLCGVSYVVLAPENPLVDEIVSA---------
SYL_CLOPS       -------------KDSDLNFDVFTTRVDTLCGVSYVVLAPENPLVDEIVSA---------
SYL_CLOP1       -------------KDSDLNFDVFTTRVDTLCGVSYVVLAPENPLVDEIVSA---------
SYL_CLOB8       -------------KDSDLKFDVFTTRVDTLNGVTYVVLAPENKLVDELTIP---------
SYL_CLOB1       -------------ADSDLSFNVFTTRVDTLFGVTYVVLAPENDLVDKLTTP---------
SYL_CLOBH       -------------ADSDLSFNVFTTRVDTLFGVTYVVLAPENDLVDKLTTP---------
SYL_CLOBL       -------------ADSDLSFNVFTTRVDTLFGVTYVVLAPENDLVDKLTTP---------
SYL_CLONN       -------------ENSDITFDVFTTRVDTLNGVTYVVLAPENELVDSLTTE---------
SYL_CLOAB       -------------DNSDLKFDVFTTRVDTLCGVTYVVLAPESPLADELTKP---------
SYL_CLOK5       -------------ADSDIKFNVFTTRVDTLFGVTYVVISPENDLVDSVTKE---------
SYL_CLOTE       -------------VDSDLSFDIFTTRADTLFGVTYAVLAPENPLVDKITKE---------
SYL_CALS4       -------------DGKDLSFRVFTTRADTLFGATYVVLAPEHELVDLITTE---------
SYL_ROSCS       -------------PPDAEPLVVFTTRPDTLWGATFMVLAPEHPLVSKLTAP---------
SYL_ROSS1       -------------PPDAEPLVVFTTRPDTLWGATFMVLAPEHPLAPKLTAP---------
SYL_THEFY       ----------------EEPVTVFTTRPDTLYGATFFVVAPDSPLADELCAP---------
SYL_ACIC1       ----------------AEPVTVFTTRPDTLYGATFFVIAADSPLAAEICAP---------
SYL_ARTS2       ----------------AKDVTVFTTRPDTLYGATFFVVAADAPMAVELVTD---------
SYL_PAEAT       ----------------EREVTVFTTRPDTLYGATFFVVAADAHLALDLVTP---------
SYL_RENSM       ----------------AKKVTVFTTRPDTLYGATFFAVAVDAALADELVTE---------
SYL_CLAMS       ----------------DEPVTVFTTRPDTLHGATFMVVAPDSDLAAELVEGA--------
SYL_CLAM3       ----------------DEPVTVFTTRPDTLHGATFMVVAPDSDLAAELVEGA--------
SYL_LEIXX       ----------------EEPVAVYTTRPDTLYGVTFMVVAPDSELAAELAEDA--------
SYL_KINRD       ----------------DEPVTVYTTRPDTLHGATFMVVAADSDLAEELAAGA--------
SYL_NOCSJ       ----------------DEPITVYTTRPDTIFGTTFMVVAVDSPLAAELVTD---------
SYL_TROW8       ----------------KRPVMVFTTRPETIFGVTYLALAFDSEVTEELASK---------
SYL_TROWT       ----------------KRPVTVFTTRPETIFGVTYLALAFDSEVTEELASK---------
SYL_MYCPA       ----------TGADGAALDIEVFTTRPDTLFGATYMVLAPEHELVDELVAPAWP------
SYL_MYCA1       ----------TGADGAALDIEVFTTRPDTLFGATYMVLAPEHELVDELVAPAWP------
SYL_MYCLE       ----------SDAATTEVDVEVFTTRPDTMFGVTYLVLAPEHNLVDELVATVWP------
SYL_MYCTA       ----------ASDDGFEVDIEVFTTRPDTLFGATYLVLAPEHDLVDELVAASWP------
SYL_MYCBO       ----------ASDDGFEVDIEVFTTRPDTLFGATYLVLAPEHDLVDELVAASWP------
SYL_MYCTU       ----------ASDDGFEVDIEVFTTRPDTLFGATYLVLAPEHDLVDELVAASWP------
SYL_MYCBP       ----------ASDDGFEVDIEVFTTRPDTLFGATYLVLAPEHDLVDELVAASWP------
SYL_MYCUA       ----------TRSNGETVGLEVFTTRPDTLFGATYLVLAPEHDLVDDLVGAGWP------
SYL_MYCSS       ---------------DAGDIEVFTTRPDTLFGATYLVLAPEHPLVEQLAAEQWP------
SYL_MYCSK       ---------------DAGDIEVFTTRPDTLFGATYLVLAPEHPLVEQLAAEQWP------
SYL_MYCSJ       ---------------DAGDIEVFTTRPDTLFGATYLVLAPEHPLVEQLAAEQWP------
SYL_MYCS2       ---------------AADDIEVFTTRPDTLFGATYLVLAPEHDLVDTLVTDAWP------
SYL_MYCVP       ---------------DAGDIEVFTTRPDTLFGATYMVLAPEHDLVDRLVADQWP------
SYL_MYCGI       ---------------AAGDIEVFTTRPDTLFGATYMVLAPEHDLVDRLVASAWP------
SYL_NOCFA       ---------------PAGQIEVFTTRPDTLFGATYVVLAPEHDLVDALAAAQWP------
SYL_RHOJR       ---------------DGHEIEVFTTRPDTLFGATYVTLAPEHELVDDIVAAEWP------
SYL_SACEN       -------------DGSAGSIEVFTTRPDTLFGVTYLVLAPEHPLVDELTAAQWP------
SYL_CORGB       ---------------EGETVTVFTTRPDTLFGATYMVLAPEHELVDVLLEK-------AG
SYL_CORGL       ---------------EGETVTVFTTRPDTLFGATYMVLAPEHELVDVLLEK-------AG
SYL_COREF       ---------------EGETITVFTTRPDTLFGATYMVLAPEHELVDVLVSRG------TG
SYL_CORDI       ---------------LGHTITVFTTRPDTLFGASYMVLAPEHELVDALVAAG------TN
SYL_CORJK       ---------------LGNDIDVFTTRPDTLFGATYMVLAPEHELVDTLVAQSGNSSSGSD
SYL_STRCO       -----------------ERITVFTTRPDTLFGATYMVLAPEHPLVEKFTPAVWP------
SYL_STRAW       -----------------EAVTVFTTRPDTLFGATYMVLAPEHPLVEKFTPAAWP------
SYL_SALAI       ----------DSSAVGEPRINVFTTRPDTIFGATYLVLAPEHALVDDLVPTAWP------
SYL_BIFAA       ---------------GVKDMEIYTTRPDTLFGTTFAVVSPEHHLLEDVPAEWP-------
SYL_BIFLO       ---------------GDKDMEIYTTRPDTLFGTTFAVVSPEHHLLENVPAEWP-------
SYL_FRACC       ----------PSGSSTARRIEVYTTRPDTLAGATFLVLAPEHPLADALIADTWP------
SYL_FRAAA       ----------SAGAAPGQRIEVYTTRPDTLAGATFLVLAPEHPQVDALVADAWP------
                                      :        *     .:                     

SYL_GEOKA       --------------------------------------------------QKPAVDAYLK
SYL_GEOTN       --------------------------------------------------QKPAVDAYLK
SYL_BACCZ       --------------------------------------------------QKEAVEAYIN
SYL_BACAH       --------------------------------------------------QKEAVEAYIN
SYL_BACAN       --------------------------------------------------QKEAVEAYIN
SYL_BACHK       --------------------------------------------------QKEAVEAYIN
SYL_BACC1       --------------------------------------------------QKEAVEAYIN
SYL_BACCR       --------------------------------------------------QKEAVEAYIN
SYL_BACCN       --------------------------------------------------QKGAVEAYID
SYL_BACSU       --------------------------------------------------QKEAVEAYIK
SYL_BACVZ       --------------------------------------------------QKEAVDAYVK
SYL_BACLD       --------------------------------------------------QKDAVNAYIE
SYL_BACP2       --------------------------------------------------QKEAVEAYIK
SYL_BACHD       --------------------------------------------------QKQAVESYKK
SYL_BACSK       --------------------------------------------------QKEAVEAYQK
SYL_OCEIH       --------------------------------------------------QKEAVQNYLD
SYL_STAES       --------------------------------------------------KEQEVKLYQN
SYL_STAEQ       --------------------------------------------------KEQEVKLYQN
SYL_STAAW       --------------------------------------------------YKEKVKAYQT
SYL_STAAS       --------------------------------------------------YKEKVKAYQT
SYL_STAAN       --------------------------------------------------YKEKVKAYQT
SYL_STAA1       --------------------------------------------------YKEKVKAYQT
SYL_STAAM       --------------------------------------------------YKEKVKAYQT
SYL_STAA9       --------------------------------------------------YKEKVKAYQT
SYL_STAA2       --------------------------------------------------YKEKVKAYQT
SYL_STAA3       --------------------------------------------------YKEKVKAYQT
SYL_STAAC       --------------------------------------------------YKEKVKAYQT
SYL_STAA8       --------------------------------------------------YKEKVKAYQT
SYL_STAAT       --------------------------------------------------YKEKVKAYQT
SYL_STAAE       --------------------------------------------------YKEKVKAYQT
SYL_STAAB       --------------------------------------------------YKEKVKAYQT
SYL_STAAR       --------------------------------------------------YKDQVKAYQT
SYL_STAHJ       --------------------------------------------------KLEAVKKYQE
SYL_STAS1       --------------------------------------------------NKDDVEAYQK
SYL_LISMF       --------------------------------------------------QKEAVEAYKK
SYL_LISMO       --------------------------------------------------QKEAVEAYKK
SYL_LISIN       --------------------------------------------------QKEAVEAYKK
SYL_LISW6       --------------------------------------------------QKEAVETYKK
SYL_ENTFA       --------------------------------------------------QTAAVEAYIE
SYL_STRTD       --------------------------------------------------QAEAVANYKH
SYL_STRT2       --------------------------------------------------QAEAVANYKH
SYL_STRT1       --------------------------------------------------QAEAVANYKH
SYL_STRP2       --------------------------------------------------QAEAVADYKH
SYL_STRR6       --------------------------------------------------QAEAVADYKH
SYL_STRPN       --------------------------------------------------QAEAVADYKH
SYL_STRSV       --------------------------------------------------QAQAVADYKH
SYL_STRGC       --------------------------------------------------QAQAVADYKH
SYL_STRS2       --------------------------------------------------QAEAVAEYKR
SYL_STRSY       --------------------------------------------------QAEAVAEYKR
SYL_STRPD       --------------------------------------------------QAEAVADYKR
SYL_STRPG       --------------------------------------------------QAEAVADYKR
SYL_STRP6       --------------------------------------------------QAEAVADYKR
SYL_STRPM       --------------------------------------------------QAEAVADYKR
SYL_STRPF       --------------------------------------------------QAEAVADYKR
SYL_STRPB       --------------------------------------------------QAEAVADYKR
SYL_STRPC       --------------------------------------------------QAEAVADYKR
SYL_STRP3       --------------------------------------------------QAEAVADYKR
SYL_STRP1       --------------------------------------------------QAEAVAKYKR
SYL_STRP8       --------------------------------------------------QAEAVADYKR
SYL_STRA3       --------------------------------------------------QAEAVAEYKR
SYL_STRA5       --------------------------------------------------QAEAVAEYKR
SYL_STRA1       --------------------------------------------------QAEAVAEYKR
SYL_STRMU       --------------------------------------------------QAQAVADYKH
SYL_LACLM       --------------------------------------------------QKEAVAEYRR
SYL_LACLA       --------------------------------------------------QKEAVAEYRR
SYL_LACLS       --------------------------------------------------QVQAVADYRR
SYL_LACSS       --------------------------------------------------QKAAVDAYLK
SYL_LACDA       --------------------------------------------------QKEAVDAYIK
SYL_LACDB       --------------------------------------------------QKEAVDAYIK
SYL_LACP3       --------------------------------------------------QQAVVDAYID
SYL_LACPL       --------------------------------------------------QADAIKAYKA
SYL_LACBA       --------------------------------------------------QADAVKAYQE
SYL_PEDPA       --------------------------------------------------SKAAVEEYKK
SYL_LACS1       --------------------------------------------------HENEVEAYIE
SYL_LACRD       --------------------------------------------------HKAEVEKYKE
SYL_LEUMM       --------------------------------------------------QKEAIANYKK
SYL_OENOB       --------------------------------------------------CRADVDAYKA
SYL_SALRD       --------------------------------------------------HREDVDEYCR
SYL1_RHIL3      --------------------------------------------------MSEAVAAYIA
SYL_RHOBA       --------------------------------------------------QKDEVDAYRE
SYL_PELLD       --------------------------------------------------QLVEVKNYIS
SYL_CHLPM       --------------------------------------------------QLVAVKEYIA
SYL_CHLCH       --------------------------------------------------QLLVVKEYIT
SYL_CHLTE       --------------------------------------------------QLVAVKKYIE
SYL_CHLPD       --------------------------------------------------QLVAVTQYIK
SYL_LEPBL       --------------------------------------------------QKQKVEEYQK
SYL_LEPBJ       --------------------------------------------------QKQKVEEYQK
SYL_LEPIC       --------------------------------------------------QKQKVEEYQK
SYL_LEPIN       --------------------------------------------------QKQKVEEYQK
SYL_BACTN       --------------------------------------------------QKAEVDAYLD
SYL_BACV8       --------------------------------------------------QKAEVEAYLD
SYL_BACFR       --------------------------------------------------QKAEVDAYLD
SYL_BACFN       --------------------------------------------------QKAEVDAYLD
SYL_PARD8       --------------------------------------------------QKAEVDAYLD
SYL_PORGI       --------------------------------------------------QRAAVETYLT
SYL_FLAPJ       --------------------------------------------------QKAAIEAYIE
SYL_FLAJ1       --------------------------------------------------QKEAVEAYIE
SYL_GRAFK       --------------------------------------------------RKEEVQAYIE
SYL_CYTH3       --------------------------------------------------QKAAVEEYVT
SYL_BDEBA       --------------------------------------------------QYTAVENYIA
SYL_SORC5       --------------------------------------------P-----RREAVRAYVA
SYL_TREDE       ----------------------------------------------------KAVAAYIE
SYL_TREPA       ----------------------------------------------------AAVQAYVQ
SYL_BORAP       ----------------------------------------------------SNVLKYIK
SYL_BORBP       ----------------------------------------------------RNVLKYVK
SYL_BORBU       ----------------------------------------------------QNVLKYVK
SYL_CHLTR       ----------------------------------------------------AVVAQYIK
SYL_CHLTA       ----------------------------------------------------AVVAQYIK
SYL_CHLMU       ----------------------------------------------------TIVAQYVK
SYL_CHLFF       ----------------------------------------------------EEVEAYIC
SYL_CHLCV       ----------------------------------------------------EAVESYIR
SYL_CHLAB       ----------------------------------------------------SAVESYIR
SYL_CHLPN       ----------------------------------------------------DEVTAYVQ
SYL_PARUW       ----------------------------------------------------QAVRAYQA
SYL_ALKOO       ----------------------------------------------------DDLVHYRE
SYL_UREP2       --------------------------------------------------QINVVQSYIE
SYL_UREPA       --------------------------------------------------QINVVQSYIE
SYL_MYCPU       --------------------------------------------------NKEKVKDFIK
SYL_MYCPE       --------------------------------------------------KK--IEAFLN
SYL_MYCGA       --------------------------------------------------K-------NN
SYL_MYCGE       --------------------------------------------------KK--VASFLK
SYL_MYCPN       --------------------------------------------------PK--IAQFLQ
SYL_MYCCT       --------------------------------------------------KLDEVKKYIE
SYL_MYCMS       --------------------------------------------------KLEEVKKYIE
SYL_MESFL       --------------------------------------------------QLKEVQTYIE
SYL_ACHLI       --------------------------------------------------EEKDVLRYIE
SYL_PSEA6       -------------------------------------------------QTRPELAEFIE
SYL_COLP3       -------------------------------------------------VDNADLAAFID
SYL_IDILO       -------------------------------------------------KTNPELAKFIE
SYL_PSEHT       -------------------------------------------------KNSDSVALFVE
SYL_PSYIN       -------------------------------------------------KNNPTLAAFCK
SYL_SALCH       -------------------------------------------------ANNAELAAFID
SYL_SALTI       -------------------------------------------------ANNAELAAFID
SYL_SALTY       -------------------------------------------------ANNAELAAFID
SYL_SALPB       -------------------------------------------------ANNAELAAFID
SYL_SALPA       -------------------------------------------------ANNAELAAFVD
SYL_CITK8       -------------------------------------------------ANNPELAAFID
SYL_SALAR       -------------------------------------------------ANNPELAVFID
SYL_SHIFL       -------------------------------------------------ENNPELAAFID
SYL_SHIF8       -------------------------------------------------ENNPELAAFID
SYL_SHIBS       -------------------------------------------------ENNPELAAFID
SYL_ECOL6       -------------------------------------------------ENNPELAAFID
SYL_ECOL5       -------------------------------------------------ENNPELAAFID
SYL_ECO57       -------------------------------------------------ENNPELAAFID
SYL_SHISS       -------------------------------------------------ENNPELAAFID
SYL_ECOLI       -------------------------------------------------ENNPELAAFID
SYL_ECOLC       -------------------------------------------------ENNPELAAFID
SYL_SHIDS       -------------------------------------------------ENNPELAAFID
SYL_ECOHS       -------------------------------------------------ENNPELAAFID
SYL_ECOUT       -------------------------------------------------ENNPELAAFID
SYL_ECOK1       -------------------------------------------------ENNPELAAFID
SYL_ECO24       -------------------------------------------------ENNPELAAFID
SYL_KLEP7       -------------------------------------------------ANNPALATFID
SYL_CROS8       -------------------------------------------------AANPALGDFIA
SYL_ENT38       -------------------------------------------------ANNPALAAFID
SYL_YERPA       -------------------------------------------------ATNPALADFVA
SYL_YERP3       -------------------------------------------------ATNPALADFVA
SYL_YERPE       -------------------------------------------------ATNPALADFVA
SYL_YERPN       -------------------------------------------------ATNPALADFVA
SYL_YERPS       -------------------------------------------------ATNPALADFVA
SYL_YERPP       -------------------------------------------------ATNPALADFVA
SYL_YERE8       -------------------------------------------------ATNPALADFVA
SYL_SERP5       -------------------------------------------------VNNPALAEFIE
SYL_PECAS       -------------------------------------------------VTNPALADFIA
SYL_SODGM       -------------------------------------------------ASNPALADFIQ
SYL_PHOLL       -------------------------------------------------ENNPELVAFID
SYL_MANSM       -------------------------------------------------QNNAELARFIQ
SYL_ACTSZ       -------------------------------------------------QNNPDLAKFIQ
SYL_HAES1       -------------------------------------------------KNNPELAAFIH
SYL_HISS2       -------------------------------------------------KNNPELAAFIH
SYL_PASMU       -------------------------------------------------ENNPELAQFIQ
SYL_HAEIG       -------------------------------------------------QNNPELAAFIQ
SYL_HAEIN       -------------------------------------------------QNNSELAAFIQ
SYL_HAEI8       -------------------------------------------------QNNSELAAFIQ
SYL_HAEIE       -------------------------------------------------QNNSELAAFIQ
SYL_ACTP2       -------------------------------------------------ENNPALAEFIR
SYL_HAEDU       -------------------------------------------------TNNPALAEFIR
SYL_SHESA       -------------------------------------------------QTNPELAQFIE
SYL_SHESM       -------------------------------------------------QTNPELAQFIE
SYL_SHESR       -------------------------------------------------QSNPELAQFIE
SYL_SHEON       -------------------------------------------------QTNPELAAFID
SYL_SHEB9       -------------------------------------------------QTNPELAAFID
SYL_SHEB5       -------------------------------------------------HTNPELAAFID
SYL_SHEB8       -------------------------------------------------QTNPELAAFID
SYL_SHESW       -------------------------------------------------QTNPELAAFID
SYL_SHEPC       -------------------------------------------------QTNPELAAFID
SYL_SHEAM       -------------------------------------------------LNNPELAAFVE
SYL_SHEHH       -------------------------------------------------INNPALAEFIE
SYL_SHEPA       -------------------------------------------------INNPALVEFIE
SYL_SHELP       -------------------------------------------------ENNPVLAEFIE
SYL_SHESH       -------------------------------------------------ANNSELSDFIE
SYL_SHEDO       -------------------------------------------------STNPALAAFIE
SYL_SHEFN       -------------------------------------------------QNNPELAAFLE
SYL_VIBPA       -------------------------------------------------ENNPELAAFIE
SYL_VIBCB       -------------------------------------------------ENNPELAAFIE
SYL_VIBVU       -------------------------------------------------ENNPELAAFIE
SYL_VIBVY       -------------------------------------------------ENNPDLAAFIE
SYL_VIBCH       -------------------------------------------------ANNPALAAFID
SYL_VIBC3       -------------------------------------------------ANNPALAAFID
SYL_ALIF1       -------------------------------------------------QNNPELAAFVE
SYL_PHOPR       -------------------------------------------------ATNPELFAFTE
SYL_AERS4       -------------------------------------------------ATNPGLAAFIE
SYL_AERHH       -------------------------------------------------ESNPELAAFIE
SYL_MARHV       -------------------------------------------------ERHRDVAEFVD
SYL_HAHCH       -------------------------------------------------ASNPQLAKFLD
SYL_SACD2       -------------------------------------------------ETNPALAAFIQ
SYL_MARMS       -------------------------------------------------ANNADLAAFIE
SYL_ALCBS       -------------------------------------------------AANHEVADFIK
SYL_PSEAB       -------------------------------------------------QNDPQLQAFID
SYL_PSEAE       -------------------------------------------------QNDPQLQAFID
SYL_PSEA7       -------------------------------------------------QNDPQLQAFID
SYL_PSEU5       -------------------------------------------------QHNPELQAFID
SYL_PSEMY       -------------------------------------------------ESNPAIAAFIA
SYL_PSEP1       -------------------------------------------------QGNPALQAFID
SYL_PSEPK       -------------------------------------------------QGNPALQAFID
SYL_PSEPG       -------------------------------------------------QGNPALQAFID
SYL_PSEE4       -------------------------------------------------QGNAALQAFID
SYL_PSEU2       -------------------------------------------------QGNPALQAFID
SYL_PSE14       -------------------------------------------------QGNPGLQAFID
SYL_PSESM       -------------------------------------------------QGNPALQAFID
SYL_NEIMB       -------------------------------------------------ADKPELQAFIA
SYL_NEIMF       -------------------------------------------------ADKPELQAFIA
SYL_NEIG1       -------------------------------------------------ADKPELQAFIA
SYL_NEIM0       -------------------------------------------------ADKPELQAFIA
SYL_NEIMA       -------------------------------------------------ADKPELQAFIA
SYL_CHRVO       -------------------------------------------------AGNAALQAFIA
SYL_THIDA       -------------------------------------------------ENNPELAAFVA
SYL_DECAR       -------------------------------------------------ANNPELAAFIE
SYL_AZOSB       -------------------------------------------------AGNPELAAFID
SYL_CUPMC       -------------------------------------------------ESNPALAAFIE
SYL_CUPPJ       -------------------------------------------------ANNPELAAFID
SYL_RALSO       -------------------------------------------------QGNPALAAFID
SYL_JANMA       -------------------------------------------------KSNPELTDFIA
SYL_HERAR       -------------------------------------------------KSNPELAEFIA
SYL_BURCH       -------------------------------------------------QDKPELLAFIE
SYL_BURCA       -------------------------------------------------QDKPELLAFIE
SYL_BURL3       -------------------------------------------------QDKPELLTFID
SYL_BURCM       -------------------------------------------------QGKPELQAFID
SYL_BURVG       -------------------------------------------------QGKPELQAFID
SYL_BURP0       -------------------------------------------------RDKPALQAFID
SYL_BURPS       -------------------------------------------------RDKPALQAFID
SYL_BURP6       -------------------------------------------------RDKPALQAFID
SYL_BURP1       -------------------------------------------------RDKPALQAFID
SYL_BURM7       -------------------------------------------------RDKPALQAFID
SYL_BURM9       -------------------------------------------------RDKPALQAFID
SYL_BURMA       -------------------------------------------------RDKPALQAFID
SYL_BURMS       -------------------------------------------------RDKPALQAFID
SYL_BURTA       -------------------------------------------------QDKPELQAFID
SYL_PARXL       -------------------------------------------------KDKPELQAFIE
SYL_POLAQ       -------------------------------------------------ENNPTLAAFIE
SYL_BORBR       -------------------------------------------------QSNPALAAFVE
SYL_BORPA       -------------------------------------------------QSNPALAAFVE
SYL_BORPE       -------------------------------------------------QSNPALAAFVE
SYL_BORPD       -------------------------------------------------ATNPELASFIE
SYL_BORA1       -------------------------------------------------RNNPALATFIE
SYL_METPP       -------------------------------------------------ASDPDLAAFIE
SYL_ACISJ       -------------------------------------------------ASNAALAAFIE
SYL_ACIAC       -------------------------------------------------RSNPDVAAFIQ
SYL_RHOFT       -------------------------------------------------RGNPALAAFIE
SYL_VEREI       -------------------------------------------------KSNPALAAFID
SYL_POLNA       -------------------------------------------------ASNPALAAFVE
SYL_POLSJ       -------------------------------------------------ALNPQLAAFIE
SYL_METCA       -------------------------------------------------RDNPELAAFIE
SYL_DICNV       -------------------------------------------------EDNPALRQFMT
SYL_PSYCK       -------------------------------------------------ENNKAIADFCA
SYL_PSYA2       -------------------------------------------------EHNEAIAAFCA
SYL_PSYWF       -------------------------------------------------EKDPKIAEFCE
SYL_ACIAD       -------------------------------------------------ENNPELAAFIE
SYL_NITEU       -------------------------------------------------HNQPDLVAFIE
SYL_NITEC       -------------------------------------------------QNQPKLAAFIE
SYL_NITMU       -------------------------------------------------KSNPALAAFIE
SYL_METFK       -------------------------------------------------KDNPALQAFIE
SYL_HYDCU       -------------------------------------------------VNNEPLERFIE
SYL_XYLFA       -------------------------------------------------KSNPALAGLLT
SYL_XYLFT       -------------------------------------------------KSNPGLAGLLT
SYL_XANC8       -------------------------------------------------KSNPELASMLE
SYL_XANCP       -------------------------------------------------KSNPELASMLE
SYL_XANCB       -------------------------------------------------KSNPELASMLE
SYL_XANC5       -------------------------------------------------KSNPELAALLE
SYL_XANAC       -------------------------------------------------KSNPELAALLE
SYL_XANOR       -------------------------------------------------KSNPELAALLE
SYL_XANOM       -------------------------------------------------KSNPELAALLE
SYL_NITOC       -------------------------------------------------TSNPALAAFLE
SYL_ALKEH       -------------------------------------------------EGNPEMQRFIE
SYL_HALHL       -------------------------------------------------EHHPAIAELVE
SYL_CHRSD       -------------------------------------------------QDNPALGDFLE
SYL_BUCAI       -------------------------------------------------KKNELIKKFI-
SYL_BUCAP       -------------------------------------------------KEKKEIQKFID
SYL_BUCCC       -------------------------------------------------RKNIEIQKFLK
SYL_BUCBP       -------------------------------------------------RKKHKIQEFIE
SYL_WIGBR       -------------------------------------------------NKLPSIAKLIK
SYL_BLOPB       -------------------------------------------------KTDLNVAHFIQ
SYL_BLOFL       -------------------------------------------------KINPDLANFIS
SYL_BAUCH       -------------------------------------------------NNNRLLSDFIE
SYL_COXBU       -------------------------------------------------KKSKKIAAFLK
SYL_COXBR       -------------------------------------------------KKSKKIAAFLK
SYL_COXBN       -------------------------------------------------KKSKKIAAFLK
SYL_LEGPH       -------------------------------------------------SNNKKVQEFLD
SYL_LEGPC       -------------------------------------------------SNNKKVQEFLD
SYL_LEGPA       -------------------------------------------------SNNKKVQEFLD
SYL_LEGPL       -------------------------------------------------SNNKKVQEFLD
SYL_FRATT       -------------------------------------------------KSNSQLAAFIE
SYL_FRAT1       -------------------------------------------------KSNSQLAAFIE
SYL_FRATW       -------------------------------------------------KSNSQLAAFIE
SYL_FRATF       -------------------------------------------------KSNSQLAAFIE
SYL_FRATH       -------------------------------------------------KSNSQLAAFIE
SYL_FRATO       -------------------------------------------------KSNSQLAAFIE
SYL_FRATN       -------------------------------------------------KTNSKLAAFIE
SYL_FRAP2       -------------------------------------------------KTNSQLKSFID
SYL_RUTMC       -------------------------------------------------KNNPQVQAFID
SYL_VESOH       -------------------------------------------------KNNYQVQSFIE
SYL_RICRS       -------------------------------------------------SKTPEILAFIT
SYL_RICRO       -------------------------------------------------SKTPEILAFIT
SYL_RICCN       -------------------------------------------------SKTPEILAFIT
SYL_RICM5       -------------------------------------------------SKTPEILAFIT
SYL_RICFE       -------------------------------------------------SKTPEILSFIT
SYL_RICAH       -------------------------------------------------SKTPEISNFIA
SYL_RICCK       -------------------------------------------------SKTPEISNFIT
SYL_RICBR       -------------------------------------------------SKTPEIENFIA
SYL_RICPR       -------------------------------------------------CKTPEIVNFIT
SYL_RICTY       -------------------------------------------------FKTDEIANFIT
SYL_ORITB       -------------------------------------------------NTTPETQKFID
SYL_WOLPM       -------------------------------------------------NGSSVVIPVLD
SYL_WOLTR       -------------------------------------------------SKE------IQ
SYL_EHRRW       -------------------------------------------------DVQLIQLIDNF
SYL_EHRRG       -------------------------------------------------DVQLIQLIDSF
SYL_EHRCJ       -------------------------------------------------DSDIIQQINDF
SYL_EHRCR       -------------------------------------------------DSKVIQLINDF
SYL_ANAMM       -------------------------------------------------DEAF-----SA
SYL_NEOSM       --------------------------------------------ILRIQTTCESDHYDDN
SYL2_RHIL3      -------------------------------------------------AKNPEIEAFCD
SYL_RHIEC       -------------------------------------------------AKNVEIEAFCE
SYL_RHIME       -------------------------------------------------AKNAEIEAFCE
SYL_SINMW       -------------------------------------------------AKSAEIEAFCE
SYL_AGRFC       -------------------------------------------------ATNPAIAEFCD
SYL_BRUAB       -------------------------------------------------EGNAALSSFIE
SYL_BRUA2       -------------------------------------------------EGNAALSSFIE
SYL_BRUSI       -------------------------------------------------EGNAALSSFIE
SYL_BRUO2       -------------------------------------------------EGNAALSSFIE
SYL_BRUME       -------------------------------------------------EGNAALSSFIE
SYL_BRUSU       -------------------------------------------------EGNAALSSFIE
SYL_BRUC2       -------------------------------------------------EGNAALSSFIE
SYL_OCHA4       -------------------------------------------------ENNASLTGFIE
SYL_CHESB       -------------------------------------------------EGNPALATFIE
SYL_RHILO       -------------------------------------------------ETNPALAKFID
SYL_BART1       -------------------------------------------------KKDKALAAFIE
SYL_BARHE       -------------------------------------------------QKDKALEFFIE
SYL_BARQU       -------------------------------------------------QKDKALSAFIE
SYL_BARBK       -------------------------------------------------RNDEELRAFIE
SYL_RHOP2       -------------------------------------------------AKNEKIAAFVE
SYL_RHOPS       -------------------------------------------------AKDPKIAAFVE
SYL_RHOPA       -------------------------------------------------AKAPKVAAFID
SYL_RHOP5       -------------------------------------------------PKNPKIKDFID
SYL_NITHX       -------------------------------------------------KDNPALAEFIA
SYL_NITWN       -------------------------------------------------KDNPALAGFIA
SYL_BRASB       -------------------------------------------------AKNPELAAFIA
SYL_BRASO       -------------------------------------------------AKNPELAAFIA
SYL_BRADU       -------------------------------------------------AKDPKLAEFIA
SYL_RHOPB       -------------------------------------------------KSNPALAAFIE
SYL_AZOC5       -------------------------------------------------ATRPDLAAFVA
SYL_PARL1       -------------------------------------------------KDNPALTDFIR
SYL_CAUVC       -------------------------------------------------AANPQIQTFIA
SYL_CAUSK       -------------------------------------------------AADPAVAAFVA
SYL_MARMM       -------------------------------------------------ADDPEIDRFMH
SYL_HYPNA       -------------------------------------------------EKSDALQAFRA
SYL_RUEST       -------------------------------------------------AESQEVADFVA
SYL_RUEPO       -------------------------------------------------AENPDLAAKVA
SYL_ROSDO       -------------------------------------------------RDNDNVAAFCA
SYL_JANSC       -------------------------------------------------SESEDIAAFCA
SYL_DINSH       -------------------------------------------------AQRPEVADFLA
SYL_RHOS1       -------------------------------------------------RHDAEVAEFVA
SYL_RHOS4       -------------------------------------------------RHDPEVAEFVA
SYL_RHOS5       -------------------------------------------------RHDAGVAEFVA
SYL_PARDP       -------------------------------------------------ASDPKVAAFVE
SYL_ZYMMO       -------------------------------------------------EKNAALPEFIA
SYL_SPHWW       -------------------------------------------------AGNPALQAFIA
SYL_NOVAD       -------------------------------------------------AINCEAANFIA
SYL_SPHAL       -------------------------------------------------KDSPELAAFIA
SYL_GRABC       -------------------------------------------------AHHPALAAFVA
SYL_GLUOX       -------------------------------------------------ESNPQAAAFIE
SYL_ACICJ       -------------------------------------------------AANPEAAAFIA
SYL_MAGSA       -------------------------------------------------AGNPALAEFVA
SYL_RHORT       -------------------------------------------------ATNPDLAAFIA
SYL_MAGMM       -------------------------------------------------ENNPAAAAFIK
SYL_CAMJ8       ---------------------------------------------------QNLLNQDVL
SYL_CAMJJ       ---------------------------------------------------QNLLNQDVL
SYL_CAMJR       ---------------------------------------------------QNLLNQDVL
SYL_CAMJE       ---------------------------------------------------QNLLNQDVL
SYL_CAMJD       ---------------------------------------------------QNLLNQDVL
SYL_CAMC1       ---------------------------------------------------SDKFDENKK
SYL_CAMC5       ---------------------------------------------------SEILDDTKK
SYL_CAMFF       ---------------------------------------------------KNILDDATS
SYL_CAMHC       ---------------------------------------------------KNLVSKETA
SYL_ARCB4       ---------------------------------------------------KNLLPEKKI
SYL_NITSB       ---------------------------------------------------TKQLSDEAV
SYL_WOLSU       ---------------------------------------------------QGKLPQESL
SYL_HELHP       ---------------------------------------------------NKSLDESVI
SYL_HELPY       ---------------------------------------------------Q--VSQEVS
SYL_HELPH       ---------------------------------------------------R--VSQEDS
SYL_HELPJ       ---------------------------------------------------R--VSQEDS
SYL_HELAH       ---------------------------------------------------Q--VNQEDL
SYL_THEMA       -----------------------------------------------------ELQEFLE
SYL_THEP1       -----------------------------------------------------DLQEFLE
SYL_THEM4       -----------------------------------------------------ELSQFLK
SYL_FERNB       -----------------------------------------------------EVEEFLA
SYL_PSELT       -----------------------------------------------------ELEKFLN
SYL_CALS8       ----------------------------------------------------KECLEFIE
SYL_HUNT2       ----------------------------------------------------QVCNEFIN
SYL_DESHY       ----------------------------------------------------NDVQAFIE
SYL_SYNWW       ----------------------------------------------------KEVKAFVN
SYL_CARHZ       ----------------------------------------------------KDVLEFKR
SYL_PELTS       ----------------------------------------------------AEIKEFIR
SYL_MOOTA       ----------------------------------------------------GPVEEFVQ
SYL_DESRM       ----------------------------------------------------AEVIGFVN
SYL_SYMTH       -------------------------------------------------ERVAAIRAFQE
SYL_DESVH       ----------------------------------------------------DDVRAFVE
SYL_DESVV       ----------------------------------------------------DDVRAFVE
SYL_DESAG       ----------------------------------------------------ETVRAFVT
SYL_LAWIP       ----------------------------------------------------EKLYNVIE
SYL_GEOMG       ----------------------------------------------------AEVEAFID
SYL_GEOSL       ----------------------------------------------------AEVEAFID
SYL_GEOUR       ----------------------------------------------------ATVAAFIE
SYL_PELPD       ----------------------------------------------------DEVERFIE
SYL_PELCD       ----------------------------------------------------AEVEAFIA
SYL_SYNAS       ----------------------------------------------------KDARTFAE
SYL_SYNFM       ----------------------------------------------------SEVLRFVQ
SYL_DESPS       ----------------------------------------------------QEVRDFVK
SYL_FUSNN       --------------------------------------------------DNPSIKDKVT
SYL_TRIV2       -------------------------------------------------TQQAVVDTFIQ
SYL_NOSS1       -------------------------------------------------TQQAAVDTFIQ
SYL_ACAM1       -------------------------------------------------AQKKAVDKFIE
SYL_TRIEI       -------------------------------------------------EQQITVETFIK
SYL_SYNY3       -------------------------------------------------EQQGTVDEFVA
SYL_SYNE7       -------------------------------------------------EQQTAVAAFAA
SYL_SYNP6       -------------------------------------------------EQQTAVAAFAA
SYL_THEEB       -------------------------------------------------RRRKTVEAFIA
SYL_SYNJB       -------------------------------------------------EQLQAVRAYQA
SYL_SYNJA       -------------------------------------------------EQEVAVKAYRA
SYL_GLOVI       -------------------------------------------------ERREAVRAFVA
SYL_SYNS3       -------------------------------------------------EERISVTAFRD
SYL_SYNPW       -------------------------------------------------HQRESVAAFRD
SYL_PROMM       -------------------------------------------------EQRLAVTAFCD
SYL_PROM3       -------------------------------------------------QQRIAVTAFCD
SYL_SYNSC       -------------------------------------------------EQKDTVEAFRK
SYL_SYNS9       -------------------------------------------------EHLASVDQFRK
SYL_SYNPX       -------------------------------------------------DQQDVVQAFQA
SYL_SYNR3       -------------------------------------------------DQRQAVEAFRQ
SYL_PROMT       -------------------------------------------------NDIDKLNDFRQ
SYL_PROM1       -------------------------------------------------NDIDKLNDFRQ
SYL_PROMA       -------------------------------------------------NKITELEQFRT
SYL_PROM0       -------------------------------------------------ETIQHIENLKK
SYL_PROM9       -------------------------------------------------ETIQDIENLKQ
SYL_PROMS       -------------------------------------------------ETIQDIENLKQ
SYL_PROM2       -------------------------------------------------ETIQDIENLKQ
SYL_PROMP       -------------------------------------------------KILSKLENLKI
SYL_PROM5       -------------------------------------------------EILSKLENLKI
SYL_SOLUE       -----------------------------------------------------SEKKAKA
SYL_DEIRA       -------------------------------------------------EQRAEVEAYVA
SYL_DEIGD       -------------------------------------------------EQAEAVRAYVE
SYL_RUBXD       -------------------------------------------------ERGEEVRAYVE
SYL_CLOPE       -------------------------------------------------EQKEAVENYKE
SYL_CLOPS       -------------------------------------------------EQKEAVENYKE
SYL_CLOP1       -------------------------------------------------EQKEAVENYKE
SYL_CLOB8       -------------------------------------------------EYKAAVEEYKE
SYL_CLOB1       -------------------------------------------------ENKAEVESYKT
SYL_CLOBH       -------------------------------------------------ENKAEVESYKT
SYL_CLOBL       -------------------------------------------------ENKAEVESYKT
SYL_CLONN       -------------------------------------------------ENKAAVEAYKI
SYL_CLOAB       -------------------------------------------------EYKEKVEEYKL
SYL_CLOK5       -------------------------------------------------EYKEEIEKYRE
SYL_CLOTE       -------------------------------------------------DHKAEIEAYKE
SYL_CALS4       -------------------------------------------------EYKEAVEEYKE
SYL_ROSCS       -------------------------------------------------ERRAEVEAYIA
SYL_ROSS1       -------------------------------------------------ERRAEVEAYIA
SYL_THEFY       -------------------------------------------------EQREAFEAYRT
SYL_ACIC1       -------------------------------------------------EQRAAFEAYVD
SYL_ARTS2       -------------------------------------------------EHAAALDAYRE
SYL_PAEAT       -------------------------------------------------EQHDELMAYRE
SYL_RENSM       -------------------------------------------------EQRAELSAYQE
SYL_CLAMS       -----------------------------------------------SEEVRESFRGYLE
SYL_CLAM3       -----------------------------------------------SDEVRERFRGYLE
SYL_LEIXX       -----------------------------------------------RPEVKQRFEEYLA
SYL_KINRD       -----------------------------------------------PDDVRAAFEAYRT
SYL_NOCSJ       -------------------------------------------------AQRPAFEAYRE
SYL_TROW8       ------------------------------------------------------SGVLGE
SYL_TROWT       ------------------------------------------------------SGVLGE
SYL_MYCPA       --DGTDPRWTYGAA-----------------------------------TPGESVAAYRR
SYL_MYCA1       --DGTDPRWTYGAA-----------------------------------TPGEAVAAYRR
SYL_MYCLE       --DRTDPRWTYGAA-----------------------------------TPGAAVAAYRR
SYL_MYCTA       --AGVNPLWTYGGG-----------------------------------TPGEAIAAYRR
SYL_MYCBO       --AGVNPLWTYGGG-----------------------------------TPGEAIAAYRR
SYL_MYCTU       --AGVNPLWTYGGG-----------------------------------TPGEAIAAYRR
SYL_MYCBP       --AGVNPLWTYGGG-----------------------------------TPGEAIAAYRR
SYL_MYCUA       --AGVDPLWTGGGA-----------------------------------TPAEAVAAYRR
SYL_MYCSS       --DDVDGRWTFGAT-----------------------------------TPREAVAAYRA
SYL_MYCSK       --DDVDGRWTFGAT-----------------------------------TPREAVAAYRA
SYL_MYCSJ       --DDVDGRWTFGAT-----------------------------------TPREAVAAYRA
SYL_MYCS2       --DGTDERWTYGAA-----------------------------------TPREAVAAYRT
SYL_MYCVP       --ADVDARWTFGAA-----------------------------------TPREAVAAYRA
SYL_MYCGI       --DGTDARWTFGAA-----------------------------------TPAEAVAAYRA
SYL_NOCFA       --ADTDPRWTGGAA-----------------------------------TPAEAVAQYRK
SYL_RHOJR       --RGVDSRWTGGAA-----------------------------------TPAEAVAAYRK
SYL_SACEN       --QDPDLRWTGGAA-----------------------------------TPAEAVAQYRR
SYL_CORGB       SYEGVDARWTNGQA-----------------------------------SPAEAVAAYRA
SYL_CORGL       SYEGVDARWTNGQA-----------------------------------SPAEAVAAYRA
SYL_COREF       SYDGVDPRWTNGQA-----------------------------------TPAEAVAAYRA
SYL_CORDI       SYEGIDPRWTFGQA-----------------------------------TPAEAVKAYRA
SYL_CORJK       AYTDVDPRWTYGQA-----------------------------------NPAAAVEAYRA
SYL_STRCO       --EGTRDAWTGGHA-----------------------------------TPTEAVAAYRA
SYL_STRAW       --EGTHDVWTGGHA-----------------------------------TPAEAVAAYRA
SYL_SALAI       --SGTRDAWTGGQA-----------------------------------SPRAAVAGYRK
SYL_BIFAA       --AETPEDWKGGYA-----------------------------------TPVEAVKAYRL
SYL_BIFLO       --ADVPEDWKGGYA-----------------------------------NPVEAVKAYRL
SYL_FRACC       --ADTPVSWRFPAGRPGGGTEPADTAGPE-------------AGADPAWTPRAAVDAYRE
SYL_FRAAA       --AGTPGAWRFPAGRGPAVGEAAEVAAEEVAAEEVGAAEVEAAAADPAWTPRAAVEAYRA
                                                                            

SYL_GEOKA       EIQSKSDLER-TDLAKEKTGV-FTGAYAIHPVT-GDRLPIWIADYVL-MSYGT-GAIMAV
SYL_GEOTN       EVQSKSDLER-TDLAKEKTGV-FTGAYAIHPVT-GDKLPIWIADYVL-MGYGT-GAIMAV
SYL_BACCZ       SVKMKSDLER-TELAKEKTGV-FTGAYAVNPVN-GEKLPIWIADYVL-ATYGT-GAVMAV
SYL_BACAH       SVKMKSDLER-TELAKEKTGV-FTGAYAVNPVN-GEKLPIWIADYVL-ATYGT-GAVMAV
SYL_BACAN       SVKMKSDLER-TELAKEKTGV-FTGAYAVNPVN-GEKLPIWIADYVL-ATYGT-GAVMAV
SYL_BACHK       SVKMKSDLER-TELAKEKTGV-FTGAYAVNPVN-GEKLPIWIADYVL-ATYGT-GAVMAV
SYL_BACC1       SVKMKSDLER-TELAKEKTGV-FTGAYAVNPVN-GEKLPIWIADYVL-ATYGT-GAVMAV
SYL_BACCR       AVKMKSDLER-TELAKEKTGV-FTGAYAVNPVN-GEKLPIWIADYVL-ATYGT-GAVMAV
SYL_BACCN       VVKSKSDLER-TELAKEKTGV-FTGAYAINPVN-GEKLPIWIADYVL-ASYGT-GAVMAV
SYL_BACSU       EIQSKSDLER-TDLAKTKTGV-FTGAYAINPVN-GEKLPIWIADYVL-ASYGT-GAVMAV
SYL_BACVZ       EVQAKSDLER-TDLAKTKTGV-FTGAYAVNPAN-GEKLPIWIADYVL-ASYGT-GAVMAV
SYL_BACLD       EVQSKSDLER-TDLAKTKTGV-FTGAYAVNPAN-GEKIPVWIADYVL-ATYGT-GAVMAV
SYL_BACP2       EIQSKSDLER-TDLAKTKTGI-FTGAYAVNPLN-GEKMPIWIADYVL-ATYGT-GAIMAV
SYL_BACHD       EVATKSDLER-TELAKEKTGV-FTGAYAINPVN-GEKVPIWIADYVL-VSYGT-GAIMAV
SYL_BACSK       QVALKSDIER-TDLAKEKTGA-FTGAYAINPVN-GEKIPVWIADYVL-ISYGT-GAVMAV
SYL_OCEIH       EIQTKSDLER-TDLAKDKTGV-FTGAYAINPVN-GEEMPIWVADYVL-MSYGT-GAIMAV
SYL_STAES       EASKKSDLER-TDLAKEKTGV-FTGTFAINPLS-GDKLPIWIADYVL-STYGT-GAVMAV
SYL_STAEQ       EASKKSDLER-TDLAKEKTGV-FTGTFAINPLS-GDKLPIWIADYVL-STYGT-GAVMAV
SYL_STAAW       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAS       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAN       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAA1       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAM       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAA9       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAA2       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAA3       EASKKSDLER-TDLAKDKSGV-FTGAYATNPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAC       EASKKSDLER-TDLAKDKSGV-FTGAYATNPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAA8       EASKKSDLER-TDLAKDKSGV-FTGAYATNPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAT       EASKKSDLER-TDLAKDKSGV-FTGAYATNPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAE       EASKKSDLER-TDLAKDKSGV-FTGAYATNPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAB       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAAR       EASKKSDLER-TDLAKDKSGV-FTGAYAINPLS-GEKVQIWIADYVL-STYGT-GAIMAV
SYL_STAHJ       DSSKKSDLER-TDLAKDKSGV-FTGAYAINPLT-GKKLPIWIADYVL-SSYGT-GAVMAV
SYL_STAS1       EAAKKSDLER-TGLSKEKSGV-FTGAYAVNPLS-GQQVPIWIADYVL-STYGT-GAVMAV
SYL_LISMF       QVELKSELER-TDLAKDKTGV-FTGAYAINPIN-GEEVPIWIADYVL-IQYGT-GAIMAV
SYL_LISMO       QVELKSELER-TDLAKDKTGV-FTGAYAINPIN-GEEVPIWIADYVL-IQYGT-GAIMAV
SYL_LISIN       QVELKSELER-TDLAKDKTGV-FTGAYAINPIN-GEEVPIWIADYVL-IQYGT-GAIMAV
SYL_LISW6       QVELKSELER-TDLAKDKTGV-FTGAYAINPIN-GEEVPIWIADYVL-IQYGT-GAIMAV
SYL_ENTFA       ETSKKSDLNR-TDLAKEKTGV-FTGAYAINPVN-GQEIPIWIGDYVL-ASYGT-GAIMAV
SYL_STRTD       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GREIPIWIADYVL-ASYGT-GAVMAV
SYL_STRT2       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GREIPIWIADYVL-ASYGT-GAVMAV
SYL_STRT1       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GREIPIWIADYVL-ASYGT-GAVMAV
SYL_STRP2       QASLKSDLVR-TDLAKEKTGV-WTGAYAINPVN-GKEMPIWIADYVL-ASYGT-GAVMAV
SYL_STRR6       QASLKSDLVR-TDLAKEKTGV-WTGAYAINPVN-GKEMPIWIADYVL-ASYGT-GAVMAV
SYL_STRPN       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GKEMPIWIADYVL-ASYGT-GAVMAV
SYL_STRSV       AASLKSDLAR-TDLAKDKTGV-WTGAYAINPVN-GKEIPIWIADYVL-ASYGT-GAIMAV
SYL_STRGC       AASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GKEIPIWIADYVL-ASYGT-GAIMAV
SYL_STRS2       QASLKSDLAR-TDLAKDKTGV-WTGAYAINPVN-GKEIPIWIADYVL-ASYGT-GAIMAV
SYL_STRSY       QASLKSDLAR-TDLATDKTGV-WTGAYAINPVN-GKEIPIWIADYVL-ASYGT-GAIMAV
SYL_STRPD       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GKEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRPG       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GNEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRP6       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GNEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRPM       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GNEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRPF       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GNEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRPB       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GKEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRPC       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GKEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRP3       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GKEIPVWIADYVL-ASYGT-GAIMAV
SYL_STRP1       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GNEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRP8       QASLKSDLAR-TDLAKEKTGV-WTGSYAINPVN-GNEMPVWIADYVL-ASYGT-GAIMAV
SYL_STRA3       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GKEIPVWIADYVL-ASYGT-GAIMAV
SYL_STRA5       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GKEIPVWIADYVL-ASYGT-GAIMAV
SYL_STRA1       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GKEIPVWIADYVL-ASYGT-GAIMAV
SYL_STRMU       QASLKSDLAR-TDLAKEKTGV-WTGAYAINPVN-GKEIPIWIADYVL-ASYGT-GAIMAV
SYL_LACLM       KASLKSDLAR-TDLSKEKTGA-FTGAYAINPIN-GRKMPIWVADYVL-ASYGH-GAVMAV
SYL_LACLA       KASLKSDLAR-TDLSKEKTGA-FTGAYAINPIN-GRKMPIWVADYVL-ASYGH-GAVMAV
SYL_LACLS       QASLKSDLAR-TDLAKEKTGA-FTGAYAINPIN-GRKMPIWVADYVL-ASYGH-GAVMAV
SYL_LACSS       EIEHKSDLER-TDLAKDKTGA-FTGAYAINPVN-GERLPIWISDYVL-ASYGT-GAVMAV
SYL_LACDA       SIESKSDLER-TDLNKDKTGV-FTGAYAINPVN-GEEVPVWISDYVL-ATYGT-GAVMAV
SYL_LACDB       SIESKSDLER-TDLNKDKTGV-FTGAYAINPVN-GEEVPVWISDYVL-ATYGT-GAVIAV
SYL_LACP3       EAAHKSDLDR-TALDKEKTGV-WTGAYATNPVN-GEKLPIWISDYVL-ASYGT-GAIMSV
SYL_LACPL       KIASKSDLER-TDLNKDKTGV-FTGSYGINPVN-GEKLPIWIADYVL-ASYGT-GAIMAV
SYL_LACBA       AIESKSDLER-TDLNKDKTGV-FTGAYGINPLS-GKKLPIWIGDYVL-SSYGT-GAIMAV
SYL_PEDPA       AVATKSDLER-TDLNKDKTGV-FTGAYAVNPVN-GKKIPVWISDYVL-ASYGT-GAVMAV
SYL_LACS1       KISHKSDLER-TDLAKDKTGV-FTGSYVVNPVS-GEKLPIWIADYVL-NSYGT-GAVMVV
SYL_LACRD       EASRRSDLER-TDLNKDKTGV-FTGSYVINPVN-GEKLPIWISDYVL-ASYGT-GAVMAV
SYL_LEUMM       EVETKSDLER-TDLNKDKTGA-FTGAYATNPIN-GEKLPIWIADYVL-SSYGT-GAIMAV
SYL_OENOB       KIASKSDLER-TDLNREKTGA-FTGAYGINPVN-GEKIPIWIADYVL-SSYGT-GAIMAV
SYL_SALRD       QALRKSERKR-QQQG-DKTGV-FTGGYAVNPVN-GEEIPIWVADYVL-VSYGT-GAIMAV
SYL1_RHIL3      EAEGLEETVR-ADAGREKTGV-FTGAYAINPAN-GARLPVWVADYVL-AGYGT-GALMAV
SYL_RHOBA       KASFKSDRER-TDGDRAKTGV-FTGSYAINPAD-GRSIPIWVADYVL-AGYGT-GAIMAV
SYL_PELLD       KAKLKTELER-TGLQKDKTGV-FTGSYAINPAN-GEALPVWISDFVL-TSYGT-GAIMSV
SYL_CHLPM       KAKLKTELER-TGLQKDKTGV-FTGSYAINPAT-GEPLPVWISDFVL-TSYGT-GAIMSV
SYL_CHLCH       KAKLKSDLER-TGLQKEKSGV-FTGSYAINPAT-GQPLPIWISDFVL-ISYGT-GAIMSV
SYL_CHLTE       QAKLKTELER-TGLQKEKTGV-FTGSYAINPAN-GEALPVWISDFVL-TSYGT-GAIMSV
SYL_CHLPD       EAKLKSELER-TGLQKDKTGI-FTGSFAINPAT-GDPLPVWISDFVL-TSYGT-GAIMSV
SYL_LEPBL       VSSLKSDLDR-MELTKEKTGV-FTGSFVLNPANPSKEIPIWISDYVL-YGYGT-GAIMAV
SYL_LEPBJ       VSSLKSDLDR-MELTKEKTGV-FTGSFVLNPANPSKEIPIWISDYVL-YGYGT-GAIMAV
SYL_LEPIC       TSSLKSDLDR-MELNKEKTGV-FTGTFVFNPADPSQKIPVWISDYVL-YGYGT-GAIMAV
SYL_LEPIN       TSSLKSDLDR-MELNKEKTGV-FTGTFVFNPADPSQKIPVWISDYVL-YGYGT-GAIMAV
SYL_BACTN       RTKKRTERER-IAD-RSVTGV-FSGSYAINPFT-GEAVPIWISDYVL-AGYGT-GAIMAV
SYL_BACV8       RTKKRTERER-IAD-RRVTGV-FSGSYAINPFT-GEAVPVWISDYVL-AGYGT-GAIMAV
SYL_BACFR       RTKKRTERER-IAD-RSVSGV-FSGSYAINPLT-NEPIPVWISDYVL-AGYGT-GAIMAV
SYL_BACFN       RTKKRTERER-IAD-RSVSGV-FSGSYAINPLT-NEPIPVWISDYVL-AGYGT-GAIMAV
SYL_PARD8       RTKKRTERER-IAD-RQVTGV-FSGSYAINPFT-GEAVPIWISDYVL-AGYGT-GAIMAV
SYL_PORGI       ETKRRTERER-ISD-KRVSGV-FSGSYAINPLT-GKEIPIWISDYVL-AGYGT-GAIMAV
SYL_FLAPJ       KTAKRSERER-MADVKTISGV-FTGAYAEHPFT-KEQIPVWIGDYVL-AGYGT-GAVMAV
SYL_FLAJ1       KTAKRSERER-MADVKTISGV-FTGAYAEHPFT-KEAIPVWIGDYVL-AGYGT-GAVMAV
SYL_GRAFK       ASAKRSERER-MADVKTISGA-FTGAYAEHPFT-KKPVPIWIGDYVL-AGYGT-GAVMAV
SYL_CYTH3       KAKNRSERDR-MSDVKTVSGC-FTGSYVTNPFN-NEKIPVWIADYVL-AGYGT-GVVMAV
SYL_BDEBA       DTAKKSEVDR-KAS-TEKTGV-FTGAHATHPIT-GDKIEIWISDYVL-MDYGT-GAIMAV
SYL_SORC5       AAAGKSDRERLAAAAREKTGV-DTGLVAVHPIT-GVEVPIWVADYVL-GGYGT-GAVMAV
SYL_TREDE       EAAKKSDLER-TDLAKNKTGV-FTGAYAINPLT-EQKIPVWISDYIL-ISYGT-GAIMAV
SYL_TREPA       RAAKKNDLER-TDLAKEKTGV-FTGAYVRNPIN-DMRIPVWVGDYVL-VSYGT-GAVMAV
SYL_BORAP       QEELKSDLKR-TSLEKDKSGV-FTGSYAFHPIT-NVKIPIWVGSYVL-GTYGS-GAVMGV
SYL_BORBP       HEELKSDLKR-TSLEKDKSGV-FTGSYAFHPIT-NEKIPIWIGSYVL-GTYGS-GAVMGV
SYL_BORBU       HEELKSDLNR-TSLEKDKSGV-FTGSYAFHPIT-NEKIPIWVGSYVL-GTYGT-GAVMGV
SYL_CHLTR       ETQSKSERDR-ISEMKTKSGV-FTGSYAKHPVT-HKLIPIWIADYVL-IGFGS-GAVMGV
SYL_CHLTA       ETQSKSERDR-ISEMKTKSGV-FTGSYAKHPVT-HELIPIWIADYVL-IGFGS-GAVMGV
SYL_CHLMU       ETQSKSERDR-ISEMKTKSGV-FTGAYAKHPVT-QNPIPIWIADYVL-MGYGS-GAVMGV
SYL_CHLFF       RAQSKSERDR-ISESKIKSGV-FTGTYAKHPIT-GADIPIWVSDYVI-LGYGS-GVVMGV
SYL_CHLCV       AAQSKSERDR-ISETKVKTGV-FTGTYAKHPVT-GADIPIWISDYVI-LGYGS-GVVMGV
SYL_CHLAB       CAQSKSERER-ISETKVKSGV-FTGAYAKHAIT-GAALPIWVSDYVI-MGYGS-GVVMGV
SYL_CHLPN       ESLRKSERDR-ISSVKTKTGV-FTGNYAKHPIT-GNLLPVWISDYVV-LGYGT-GVVMGV
SYL_PARUW       QIASKSDLDR-TELNRDKTGV-FTGAYAVNPVN-HKEIPIWISDYVL-MNVGT-GAIMAV
SYL_ALKOO       EAAKKSEFER-TELVKDKTGVKIEGIEATNPAT-GKQIPIFISDYVM-MSYGT-GAIMAV
SYL_UREP2       QTKKISDLDR-IADTNK-TGV-FSGAYAINPIN-QEIIPIWVSDYVL-MNFAT-GAVMGV
SYL_UREPA       QTKKISDLDR-IADTNK-TGV-FSGAYAINPIN-QEIIPIWVSDYVL-MNFAT-GAVMGV
SYL_MYCPU       EFEKLDDRQK-ADKNEK-NGI-FTGSYAINPFN-QKKIPIWIGDFVL-LSYGT-GAIMSV
SYL_MYCPE       ELSSLKEYER-TAINVEKKGV-LLDIKAIHPIT-KQLVPVYVCNYVL-SNYGN-GAIMGV
SYL_MYCGA       AIEQFIKDNS-IDQRVRYQGI-NTNYFAIHPIT-KKKIPIYLADYIL-SDYGT-GAVMGV
SYL_MYCGE       KQLQKTTTLK-QKATLY-DGI-DLLTNAIHPLT-NELIPVYVANYVI-EGYGT-DAIMGV
SYL_MYCPN       KQAQKTTTVK-QPETLH-DGV-DLKLKAINPAT-NTAIPLYVANYVV-EGYGT-DAVMGV
SYL_MYCCT       LTANKSEIER-KDESKTKTGV-FIGSYAINPLT-KEQIQIWISDYVL-NDYGS-GAIMAV
SYL_MYCMS       LTANKSEIER-KDESRTKTGV-FIGSYATNPLT-KEQIQIWISDYVL-NDYGS-GAIMAV
SYL_MESFL       LAKNKSEIDR-KDESKPKTGV-FTGSYATNPHT-NELVQVWVSDYVL-ANYGT-GAVMAV
SYL_ACHLI       QTKMKSDLDR-IAD-KSKTGV-FTGAFAKHPLT-NQLIPIWIGDYVL-PQYGM-GAVMAV
SYL_PSEA6       SCKNTKVAEAEL--ATMEKKGCDTGLFAIHPLTGE-KVAVWVANFVL-MGYGS-GAVMSV
SYL_COLP3       ECKNSKTTEADM--AAMEKKGVDTGLKAIHPLTGK-LVPVWAANFVL-MDYGS-GAVMSV
SYL_IDILO       ECKNSKVAEADI--ATMEKLGMDTGIKAVHPMTGE-EIPVWVANFVL-MDYGS-GAVMAV
SYL_PSEHT       ECKNNKVSEADM--ATMEKKGIATGFFATHPLTGE-QVPIWIANFVL-MHYGS-GAVMAV
SYL_PSYIN       KCKNVKLAEAEI--ATMAKEGVDTGFKAIHPISGL-EVPIWTANFVL-MGYGS-GAVMSV
SYL_SALCH       ECRNTKVAEAEM--ATMEKKGVDTGYKAIHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SALTI       ECRNTKVAEAEM--ATMEKKGVDTGYKAIHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SALTY       ECRNTKVAEAEM--ATMEKKGVDTGYKAIHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SALPB       ECRNTKVAEAEM--ATMEKKGVDTGYKAIHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SALPA       ECRNTKVAEAEM--ATMEKKGVDTGYKAIHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_CITK8       ECRNTKVAEADM--ATMEKKGVDTGFKAIHPLTGE-AIPVWAANFVL-MEYGT-GAVMAV
SYL_SALAR       ECRNTKVAEAEM--ATMEKKGVDTGFKAIHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SHIFL       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SHIF8       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SHIBS       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECOL6       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECOL5       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECO57       ECRNTKVAEAEM--ATMEKKGVNTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SHISS       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECOLI       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECOLC       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_SHIDS       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECOHS       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECOUT       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECOK1       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_ECO24       ECRNTKVAEAEM--ATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_KLEP7       ECRNTKVAEADM--ATMEKKGVDTGFKAIHPLTGE-EIPVWAANFVL-MEYGT-GAVMAV
SYL_CROS8       ECRNTKVAEADM--ATMEKKGVDTGLKAIHPLTGE-AIPVWAANFVL-MEYGT-GAVMAV
SYL_ENT38       ECRNTKVAEADM--ATMEKKGVATGFNAIHPLTGE-AVPVWAANFVL-MEYGT-GAVMAV
SYL_YERPA       ECRNTKVAEAEM--ATMEKKGMATGLYAIHPLTGE-KLPIWAANFVL-MDYGT-GAVMAV
SYL_YERP3       ECRNTKVAEAEM--ATMEKKGMATGLYAIHPLTGE-KLPIWAANFVL-MDYGT-GAVMAV
SYL_YERPE       ECRNTKVAEAEM--ATMEKKGMATGLYAIHPLTGE-KLPIWAANFVL-MDYGT-GAVMAV
SYL_YERPN       ECRNTKVAEAEM--ATMEKKGMATGLYAIHPLTGE-KLPIWAANFVL-MDYGT-GAVMAV
SYL_YERPS       ECRNTKVAEAEM--ATMEKKGMATGLYAIHPLTGE-KLPIWAANFVL-MDYGT-GAVMAV
SYL_YERPP       ECRNTKVAEAEM--ATMEKKGMATGLYAIHPLTGE-KLPIWAANFVL-MDYGT-GAVMAV
SYL_YERE8       ECRNTKVAEAEM--ATMEKKGMATGLYAIHPLTGE-KLPIWAANFVL-MDYGT-GAVMAV
SYL_SERP5       ECRNTKVAEAEM--ATMEKKGMPTGLFAIHPLSGE-QVPVWVANFVL-MEYGT-GAVMAV
SYL_PECAS       ECRNTKVAEADM--ATMEKKGMATGLYAIHPLNGE-KVAIWVANFVL-MEYGT-GAVMAV
SYL_SODGM       ECRTTKVAEADM--ATMEKKGMATGLHAVHPLTGE-MLPVWVANFVL-MDYGT-GAVMAV
SYL_PHOLL       ECRNTKVAEADM--ATMEKKGMATGMFAIHSLTKE-KVAIWVANFVL-MEYGT-GAVMAV
SYL_MANSM       ECKNTKVAEAEL--ATMEKKGMATGINAIHPITGK-PVPVWVANFVL-MHYGT-GAVMAV
SYL_ACTSZ       ECKNTKVAEAEL--ATMEKKGMATGLNAVHPITGK-PVPIWVANFVL-MHYGT-GAVMAV
SYL_HAES1       EAKNTKVAEAEL--ATMEKKGMATGLYAVHPMTGK-QLPIWVANFVL-MHYGT-GAVMAV
SYL_HISS2       EAKNTKVAEAEL--ATMEKKGMATGLYAVHPMTGK-QLPIWVANFVL-MHYGT-GAVMAV
SYL_PASMU       ECKNTKVAEAEL--ATMEKKGMATGVYAIHPLTGE-KVPVWVANFVL-MHYGT-GAVMAV
SYL_HAEIG       EAKNAKVAEADL--ATMEKKGMATGLFAIHPLTGE-KLPIWVANFVL-MHYGT-GAVMAV
SYL_HAEIN       EAKNAKVAEADL--ATMEKKGMATGLFAIHPLTGD-KLPIWVANFVL-MHYGT-GAVMAV
SYL_HAEI8       EAKNAKVAEADL--ATMEKKGMATGLFAIHPLTGE-KLPIWVANFVL-MHYGT-GAVMAV
SYL_HAEIE       EAKNAKVAEADL--ATMEKKGMATGLFAIHPLTGE-KLPIWVANFVL-MHYGT-GAVMAV
SYL_ACTP2       EAKNTKVAEAEL--ATMEKKGMATGLFAIHPLTGK-EVPVWVANFVL-MHYGT-GAVMAV
SYL_HAEDU       EAKNTKVAEAEL--ATMEKKGMPTGLFAIHPLTGK-EIPVWVANFVL-MHYGT-GAVMAV
SYL_SHESA       ECKNSTTSEADL--ATMEKRGVATGLYAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHESM       ECKNSTTSEADL--ATMEKRGVATGLYAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHESR       ECKNSTTSEADL--ATMEKRGVATGLYAIHPISGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHEON       ECKNSTTSEAEL--ATMEKRGVATGLYAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHEB9       ECKNSTTSEAEL--ATMEKRGVATGLFAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHEB5       ECKNSTTSEAEL--ATMEKRGVATGLFAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHEB8       ECKNSTTSEAEL--ATMEKRGVATGLFAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHESW       ECKNSTTSEAEL--ATMEKRGVATGLFAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHEPC       ECKNSTTSEAEL--ATMEKRGVATGLFAIHPITGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHEAM       ECKQSGTSEAEL--ATMEKKGVATGLYAIHPLTGE-EVPVWAANFVL-MNYGT-GAVMSV
SYL_SHEHH       ECKNADTTEAAM--AAMEKKGVATGLNAIHPITGK-EVPIWVGNFVL-MNYGT-GAVMSV
SYL_SHEPA       ECKNADTTEAAM--AAMEKKGVATGLNAIHPITGK-EVPIWVGNFVL-MNYGT-GAVMSV
SYL_SHELP       ECKNADTTEAAM--AAMEKKGVDTGLKAIHPLTGK-LVPIWAANFVL-MNYGT-GAVMSV
SYL_SHESH       ECKNADTTEAAM--AAMEKKGVATGLYATHPLTGK-QVPIWAANFVL-MNYGT-GAVMSV
SYL_SHEDO       ECKNADTTEAAM--ASMEKKGVATGLEAVHPISGK-LVPIWVANFVL-MNYGT-GAVMSV
SYL_SHEFN       ECKNADTTEAAM--ASMEKKGVATGLQAIHPISGK-LVPIWVANFVL-MNYGT-GAVMSV
SYL_VIBPA       ECKNTKVAEAEL--ATMEKKGMATGLTAIHPLNGR-EVPVYVANFVL-MDYGT-GAVMAV
SYL_VIBCB       ECKNTKVAEAEL--ATMEKKGMATGLTAIHPLNGR-EVPVYVANFVL-MDYGT-GAVMAV
SYL_VIBVU       ECKNTKVAEAEL--ATMEKKGMATGLTAIHPLNGR-EVPVYVANFVL-MDYGT-GAVMAV
SYL_VIBVY       ECKNTKVAEAEL--ATMEKKGMATGLTAIHPLNGR-EVPVYVANFVL-MDYGT-GAVMAV
SYL_VIBCH       ECKNTKVAEAEI--ATMEKKGMATGLTAIHPLNGR-EVPIYIANFVL-MDYGT-GAVMAV
SYL_VIBC3       ECKNTKVAEAEI--ATMEKKGMATGLTAIHPLNGR-EVPIYIANFVL-MDYGT-GAVMAV
SYL_ALIF1       ECRNTKVAEAEL--ATMEKKGMDTGLRAIHPLNGR-EVPVFVANFVL-MDYGT-GAVMAV
SYL_PHOPR       ECRNTKVAEAEL--ATMEKKGMDTGLRAVHPLNGR-EVPIYVANFVL-MDYGT-GAVMAV
SYL_AERS4       ECKNTKVAEAEL--ATMEKKGMATGLYAIHPLDGR-KVPVWVANFVL-MNYGT-GAVMAV
SYL_AERHH       ECKNTKVAEAEL--ATMEKKGMATGLYAIHPLDGR-KVPVWVANFVL-MNYGT-GAVMAV
SYL_MARHV       QCRNSKVAEAEL--ATMEKKGIDTGFKAIHPLTQE-EIPVWVANFVL-MDYGT-GALMAV
SYL_HAHCH       ECKNTKVAEADM--ATMEKRGMDTGFFVIHPLTNE-PAPIWVANFVL-MDYGS-GAVMSV
SYL_SACD2       ECKVQSVAEADM--ANMEKKGIDTGIKAKHPITGD-EVSVWVANYVL-MDYGS-GAVMAV
SYL_MARMS       ESKKMSTTEADM--ATVEKKGMDTGFKAIHPITGE-AVPVYAANFVL-MDYGS-GAVMSV
SYL_ALCBS       ECQNTKTAEADM--ATMEKKGIYTGLTATHPISGE-AVPVWIANFVL-MGYGT-GAVMAV
SYL_PSEAB       ECKRGGVAEADI--ATQEKKGMATSLFVEHPLTGD-KLPVWVANYVL-MNYGE-GAVMAV
SYL_PSEAE       ECKRGGVAEADI--ATQEKKGMATSLFVEHPLTGD-KLPVWVANYVL-MNYGE-GAVMAV
SYL_PSEA7       ECKRGGVAEADI--ATQEKKGLATSLFVEHPLTGD-KLPVWVANYVL-MNYGE-GAVMAV
SYL_PSEU5       ECKRGGVAEADI--ATQEKKGLATSLRVQHPLTGE-LLPVWVANYVL-MNYGE-GAVMAV
SYL_PSEMY       ECKAGSVAEADM--ATMEKKGLATGQFVIHPLTGD-KLPVFVANYVL-WGYGE-GAVMAV
SYL_PSEP1       ECKSGSVAEADM--ATQEKKGMATSLLVEHPLTGE-KLPVWVANYVL-MHYGD-GAVMAV
SYL_PSEPK       ECKSGSVAEADM--ATQEKKGMATSLLVEHPLTGE-KLPVWVANYVL-MHYGD-GAVMAV
SYL_PSEPG       ECKSGSVAEADM--ATQEKKGMATSLLVEHPLTGE-KLPVWVANYVL-MHYGD-GAVMAV
SYL_PSEE4       ECKSGSVAEADM--ATQEKKGMATSLFVEHPLTGE-KLPVWVANYVL-MHYGD-GAVMAV
SYL_PSEU2       ECKGGSVAEADV--ATQEKKGQATSLFVEHPLTGE-KLPVWVANYVL-MHYGD-GAVMAV
SYL_PSE14       ECKGGSVAEADV--ATQEKKGQPTSLFVEHPLTGE-KLPVWVANYVL-MHYGD-GAVMAV
SYL_PSESM       ECKGGSVAEADV--ATQEKKGQPTSLFVEHPLTGE-KLPVWVANYVL-MHYGD-GAVMAV
SYL_NEIMB       ECKAGSVAEADM--ATMEKKGVPTGRYVVNPLNGD-KLEVWIANYVL-WGYGD-GAVMAV
SYL_NEIMF       ECKAGSVAEADM--ATMEKKGVPTGRYVVNPLNGD-KLEVWIANYVL-WGYGD-GAVMAV
SYL_NEIG1       ECKAGSVAEADM--ATMEKKGVPTGRYVVNPLNGD-KLEVWIANYVL-WGYGD-GAVMAV
SYL_NEIM0       ECKAGSVAEADM--ATMEKKGVPTGRYVVNPLNGD-KLEVWIANYVL-WGYGD-GAVMAV
SYL_NEIMA       ECKAGSVAEADM--ATMEKKGVPTGRYVVNPLNGD-KLEVWIANYVL-WGYGD-GAVMAV
SYL_CHRVO       ECKSGSVAEADV--AKMEKKGMDTGLSVIHPLTGE-RLPVWVANYVL-WGYGE-GAVMAV
SYL_THIDA       ECKQGSVAEADM--ATMEKKGMDTGFKVTHPLTGE-EVPVWVGNYVL-MSYGE-GAVMAV
SYL_DECAR       ECKKGGVAEADI--ATMEKKGMPTGIYVTHPLTGQ-QVEVWVGNYVL-MSYGD-GAVMAV
SYL_AZOSB       ECKQGGVAEADL--ATMEKKGMPTGLRVVHPITGE-YLPVWVANYVL-MGYGE-GAVMAV
SYL_CUPMC       ECKHGSVMEADM--ATMEKKGMPTGLKVTHPLTGE-QVDVWVGNYVL-MTYGD-GAVMGV
SYL_CUPPJ       ECKHGSVMEADM--ATMEKKGMPTGLQVTHPLTGE-QVDVWVGNYVL-MSYGD-GAVMGV
SYL_RALSO       ECKHGSVMEADM--ATMEKKGMPTGLTVTHPLTGE-AVPVWVGNYVL-MTYGD-GAVMGV
SYL_JANMA       ECKLGSVIEADM--ATMEKKGMPTGLFVKHPLTGQ-LVEVWVGNYVL-ITYGD-GAVMGV
SYL_HERAR       ECKLGSVIEADM--ATMEKKGMPTGLFVKHPLTGS-LVEVWVGNYVL-ITYGD-GAVMGV
SYL_BURCH       ECKRGGVAEADV--ATMEKKGVATGFSVKHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURCA       ECKRGGVAEADV--ATMEKKGVATGFSVKHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURL3       ECKRGGVAEADV--ATMEKKGVATGFSVAHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURCM       ECKRGGVAEADV--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURVG       ECKRGGVAEADV--ATMEKKGIATGFSVTHPLTGE-AVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURP0       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURPS       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURP6       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURP1       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURM7       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURM9       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURMA       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURMS       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGE-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_BURTA       ECKRGGVAEADI--ATMEKKGVATGFSVSHPLTGA-PVEVWIGNYVL-MSYGE-GAVMGV
SYL_PARXL       ECKRGGVAEADV--ATMEKKGMATGFTVTHPLTQE-QVEVWIGNYVL-MSYGE-GAVMGV
SYL_POLAQ       KCKTGSVIEADL--ATQEKEGMFTGLYVTHPLTNE-SVPVWVGNYVL-MSYGD-GAVMGV
SYL_BORBR       QCKLGGTTEAEM--ATREKEGMPTGLTVTHPLTGA-EIDVWVGNYVL-MTYGD-GAVMGV
SYL_BORPA       QCKLGGTTEAEM--ATREKEGMPTGLTVTHPLTGA-EIDVWVGNYVL-MTYGD-GAVMGV
SYL_BORPE       QCKLGGTTEAEM--ATREKEGMPTGLTVTHPLTGA-EIDVWVGNYVL-MTYGD-GAVMGV
SYL_BORPD       QCKLGGTTEAEI--ATREKAGMRTGLTVTHPLTGA-PVDVWVGNYVL-MSYGD-GAVMGV
SYL_BORA1       QCKLGGTTEAEI--ATREKEGIPTGLSVKHPLTGQ-AVDLWVGNYVL-MSYGD-GAVMGV
SYL_METPP       TCKAGGTTEAEL--ATKDKEGRPTGLFVKHPLSGA-PVPVWVGNYVL-MGYGD-GAVMGV
SYL_ACISJ       ECKKGGTTEAEL--ALKEKEGMPTGLFVTHPLTGE-QVEVWVGNYVL-MSYGD-GAVMGV
SYL_ACIAC       ECKTGGTTEAEL--ATQEKKGVRTGLTVTHPLTDE-PIEVWVGNYVL-MGYGD-GAVMGV
SYL_RHOFT       ECKTGGTTEAEL--ATQEKKGLDTGLIVTHPLTQL-PVAVWVGNYVL-MSYGD-GAVMGV
SYL_VEREI       ECRSGGTTEAAL--ATQEKKGLRTGLYVTHPLTDE-PLEVWVGNYVL-MGYGD-GAVMGV
SYL_POLNA       ECKSGGTTEAEL--ATQEKKGQPTGLFVTHPLTGD-KVEVWVGNYVL-MSYGD-GAVMGV
SYL_POLSJ       ECKAGGTTEAEL--ATQEKKGKPTGLFVTHPLTGE-QVEVWVGNYVL-MSYGD-GAVMGV
SYL_METCA       ECRHGGTAEADL--ATMEKKGMATGRFVVHPLNGE-KLPVWIANYVL-WGYGE-GAVMAV
SYL_DICNV       ECKTGSVAEADL--ATMPKKGMATGRFVTHPLTGK-RLPVWVGNYVL-SGYGD-AAVMGV
SYL_PSYCK       LCKKGSVAEADL--AKAEKIGMDTGLTVTHPLTGE-EVPVWVANYVL-MSYGS-GAVMAV
SYL_PSYA2       LCKKGSVAEADL--AKAEKVGIDTGLTVTHPLTGE-EVPVWVANYVL-MSYGS-GAVMAV
SYL_PSYWF       LCKKGSVAEADL--AKAEKIGMDTGLTVTHPLTGE-EVPVWVANYVL-MSYGS-GAVMAV
SYL_ACIAD       ECRMGSVAEADL--ATAEKKGMATGLFVKHPVTGE-EVPVWIANYVL-MSYGS-GAVMAV
SYL_NITEU       SCRQGATMEAEL--AVQEKKGMATGLYVLHPLTGE-RLPVWVANYVL-MSYGE-GAVMAV
SYL_NITEC       SCRQGATMEAEL--ALQEKKGMATGLYVLHPLTGE-RLPVWVANYVL-MSYGE-GAVMAV
SYL_NITMU       ECRQGAMMEAEL--ATQEKKGRDTGLYVIHPLTGA-RLPVWIANYVL-MGYGE-GAVMAV
SYL_METFK       ECKRGSVAEADL--ATAEKKGMNSGLFVLHPITGE-KLPVWVANYVL-ISYGE-GAVMAV
SYL_HYDCU       ECSHISTAEADM--ETMEKKGVDTGIRVKHPITGD-EVPVWAANFVL-MGYGT-GAVMSV
SYL_XYLFA       EMKQGGLSEAEL--KTQEKRGMDTGLKAIHPITNE-QLPVWVANFVL-MAYGT-GAVMAV
SYL_XYLFT       QMKQGGLSEAEL--KTQEKRGMDTGLKAIHPITNE-QLPVWVANFVL-MAYGT-GAVMAV
SYL_XANC8       TLKHGGVSEAEL--ETQEKRGMATGLTAVHPISGE-EVPVWVANFVL-MGYGT-GAVMAV
SYL_XANCP       TLKHGGVSEAEL--ETQEKRGMATGLTAVHPISGE-EVPVWVANFVL-MGYGT-GAVMAV
SYL_XANCB       TLKHGGVSEAEL--ETQEKRGMATGLTAVHPISGE-EVPVWVANFVL-MGYGT-GAVMAV
SYL_XANC5       TLKHGGVSEAEL--ETQEKRGMATGLTAVHPISGE-QVPVWVANFVL-MGYGT-GAVMAV
SYL_XANAC       TLKHGGVSEAEL--ETQEKRGMATGLTAVHPISGE-QVPVWVANFVL-MGYGT-GAVMAV
SYL_XANOR       TLKHGGVSEAEL--ETQEKRGMATGLTAVHPISGE-QVPVWVANFVL-MGYGT-GAVMAV
SYL_XANOM       TLKHGGVSEAEL--ETQEKRGMATGLTAVHPISGE-QVPVWVANFVL-MGYGT-GAVMAV
SYL_NITOC       QCQRTATSEAIL--ETLEKEGMDTGFKAIHPITGE-AVPIWVANFVL-MGYGT-GAVMAV
SYL_ALKEH       DCRKGGVAEADI--ATMEKRGMDTGLKAVHPLTGE-QVPIWVANFVL-MEYGH-GAVMAV
SYL_HALHL       EARSGGTAEADL--ATREKRGADTGLEAIHPLTGE-RIPVWVANFVL-MEYGS-GAVMAV
SYL_CHRSD       ECQQGGNSEAEL--ATMEKKGMDTGHKAIHPLTGR-EVPIFVANFVL-MEYGT-GAVMAV
SYL_BUCAI       -KKYRYISQEEQ--YKVKYTGINTNLFVVHPITKK-TIPIWISNATH-IEYGT-NAVLSI
SYL_BUCAP       QKINNSASQEDI--EKIKFEGINSNMFVIHPITNK-KIPVWISNFIQ-KEYGT-NAIISV
SYL_BUCCC       -KNKYSINTEFQ--KSNILFGINTHLYVIHPINKK-KIPLWISNYVK-YNYAT-GAIMSV
SYL_BUCBP       -NCSSNTNTYND--INNTNIGINTNEFALHPITKK-KLPIWITNYVL-SDYDT-NSILCV
SYL_WIGBR       NYNNEKTLELNL--RKKTKDGIFTSLFAIHPISKK-ILPIWISNFFF-TNNDIYQSIAAI
SYL_BLOPB       KNDDFYTKLNKKNVFYFEKMGMPTHIYAIHPITNS-KLPIWVANFVIPMECDGMGAAISI
SYL_BLOFL       IYNTISIQLHNKQFICHKKKGIFTNLYAVHPITFT-KLPIWVANFITPLEFDGQGAIASC
SYL_BAUCH       HSRPTKLSEAEIVKVNRVKTGIFTGLYAIHPLTEE-KLPIWVTNFVL-MDYGT-GAIMAV
SYL_COXBU       KCKQTRVAEADI--ATQEKEGIDSGLFAVHPLSKE-KLPIWIANFVL-MEYAS-GVVMAV
SYL_COXBR       KCKQTRVAEADI--ATQEKEGIDSGLFAVHPLSKE-KLPIWIANFVL-MEYAS-GVVMAV
SYL_COXBN       KCKQTRVAEADI--ATQEKEGIDSGLFAVHPLSKE-KLPIWIANFVL-MEYAS-GVVMAV
SYL_LEGPH       SCQGIKIAEAEL--ATMEKRGIDTGMTAIHPITGK-ELPIWVANFVL-MQYGS-GAVMAV
SYL_LEGPC       SCQGIKIAEAEL--ATMEKRGIDTGMTAIHPITGK-ELPIWVANFVL-MQYGS-GAVMAV
SYL_LEGPA       SCQGIKIAEAEL--ATMEKRGIDTGMTAIHPITGK-ELPIWVANFVL-MQYGS-GAVMAV
SYL_LEGPL       SCQGIKIAEAEL--ATMEKRGIDTGMTAIHPITGK-ELPIWVANFVL-MQYGS-GAVMAV
SYL_FRATT       ECKKTSTMEADL--ATQEKKGFKTSIKVIHPISAE-TIDVWVANFVL-MGYGS-GAVMSV
SYL_FRAT1       ECKKTSTMEADL--ATQEKKGFKTSIKVIHPISAE-TIDVWVANFVL-MGYGS-GAVMSV
SYL_FRATW       ECKKTSTMEADL--ATQEKKGFKTSIKVIHPISAE-TIDVWVANFVL-MGYGS-GAVMSV
SYL_FRATF       ECKKTSTMEADL--ATQEKKGFKTSIKVIHPISAE-TIDVWVANFVL-MGYGS-GAVMSV
SYL_FRATH       ECKKTSTMEADL--ATQEKKGFKTSIKVIHPISAE-TIDVWVANFVL-MGYGS-GAVMSV
SYL_FRATO       ECKKTSTMEADL--ATQEKKGFKTSIKVIHPISAE-TIDVWVANFVL-MGYGS-GAVMSV
SYL_FRATN       ECKKTSTMEADL--ATQEKKGFKTSIKVIHPISAE-TIDVWVANFVL-MGYGS-GAVMSV
SYL_FRAP2       ECKRISTMEADL--ATQEKKGFKTSIQAIHPISGE-TVNVWVANFVL-MGYGS-GAVMSV
SYL_RUTMC       ECKTIQITKETM--KTIDKKGIDLGVKCIHPITSD-DVPIWIANFVL-IGYGT-GAVMSV
SYL_VESOH       KCKTIQTSEILN--EIMDKKGIDSGFKCIHPITNN-EVPIWITNFVL-MSYGT-GAIMSV
SYL_RICRS       QCSH-ITRSSKL--EKAEKEGVFTGLFVTHPFDSNIVLPVIITNFVL-MDYGT-GAIFGC
SYL_RICRO       QCSH-ITRSSKL--EKAEKEGVFTGLFVTHPFDSNIVLPVIITNFVL-MDYGT-GAIFGC
SYL_RICCN       QCSH-ITRSSEL--EKAEKEGVFTGLFVTHPFDSNIVLPVIITNFVL-MDYGT-GAIFGC
SYL_RICM5       KCSH-ITGSSEL--EKAEKEGVFTGLFVIHPFDSNIVLPVIITNFVL-MDYGT-GAIFGC
SYL_RICFE       KCSH-ITGSSEL--EKTEKEGVFTGLYVIHPFDSNIVLPVIITNFVL-MDYGT-GAVFGC
SYL_RICAH       KCAN-ITCSVEL--DKAEKEGVFTGLYVTHPFDSNIVLPVIITNFVL-MDYGT-GAVFGC
SYL_RICCK       KCLH-ITGSSEL--EKAEKDGILTSLYVIHPFDPSIILPVIITNFVL-MDYGT-GAIFGC
SYL_RICBR       KCSN-ITGSAEF--DKAEKEGIFTGLYVVHPFDSNITLPVVITNFVL-MDYGT-GAVFGC
SYL_RICPR       KCSY-ITRSSEI--DKAEKEGIFSGLYVIHPFDANIFLPVIITNFVL-MDYGT-GAIFGC
SYL_RICTY       KCSY-ITKSSEL--EKSEKEGVFTGLYVIHPFDANIILPVIITNFVL-MDYGT-GAIFGC
SYL_ORITB       KCSN-VGTSNVN--IDKMKIAVLTNLKVIHPLNSSIELPVILSNFVL-MDYGT-GALFGC
SYL_WOLPM       TGIQ-EIKSKR---ENDEKIGVYTGLNVKHPFLDK-ELPLYIANFVL-MEYGE-GAIFGC
SYL_WOLTR       DLIS-SIKIQG---KNNEKVGIYTGLNVKHPFLDK-ELPLYVANFVL-MEYRE-GAIFGC
SYL_EHRRW       DRKD-LIDESSI--NTVEKFGINSGLVARHPLLDV-DLPIYVANFVL-MNYGT-GAVFCC
SYL_EHRRG       DRKD-LIDDSSI--NTVEKFGINSGLVAKHPLLDM-DLPIYVANFVL-MNYGT-GAVFCC
SYL_EHRCJ       DKNN-LITDAS---STVEKFGINSGLVVKHPFLCM-NLPVYVVNFVL-MDYAT-GAVFGC
SYL_EHRCR       DRKN-LISDVS---STIEKFGIDSGLVVKHPLLNV-NLPVYIVNFVL-MDYAT-GAIFGC
SYL_ANAMM       RVRG-IIECSGD--EEKQKIGADTGLFATHPLLDR-KLPIYAANYVL-SEYGT-GAVFGC
SYL_NEOSM       KNFS-GTTNLEK--VHEQKLGILTKIKVKHPFSGD-ELPLYVANFVF-AEYGS-GAIFGC
SYL2_RHIL3      ECRRAGTSLAAL--ETAEKKGMDTGIRVRHPLDPSWELPVYIANFVL-MDYGT-GAIFGC
SYL_RHIEC       ECRRAGTSLAAL--ETAEKKGLDTGIRVRHPLDPSWELPVYIANFVL-MDYGT-GAIFGC
SYL_RHIME       ECRRAGTSLAAL--ETAEKKGIDTGIRARHPFDPNWELPVYVANFVL-MDYGT-GAIFGC
SYL_SINMW       ECRRAGTSLAAL--ETAEKMGIDTGIRARHPFDPDWELPVYVANFVL-MDYGT-GAIFGC
SYL_AGRFC       ECRRHGTSLAAL--ETAEKKGIDTGVKVVHPLDPSWELPVYVANFVL-MDYGT-GAIFGC
SYL_BRUAB       ECHQQGTSLAAL--ETAEKKGFDTGIKVKHPFDDNWELPVYVANFVL-MEYGT-GAVFGC
SYL_BRUA2       ECHQQGTSLAAL--ETAEKKGFDTGIKVKHPFDDNWELPVYVANFVL-MEYGT-GAVFGC
SYL_BRUSI       ECHQQGTSLAAL--ETAEKKGFDTGIKVKHPFDDNWELPVYVANFVL-MEYGT-GAVFGC
SYL_BRUO2       ECHQQGTSLAAL--ETAEKKGFDTGIKVKHPFDDNWELPVYVANFVL-MEYGT-GAVFGC
SYL_BRUME       ECHQQGTSLAAL--ETAEKKGFDTGIKVKHPFDDNWELPVYVANFVL-MEYGT-GAVFGC
SYL_BRUSU       ECHQQGTSLAAL--ETAEKKGFDTGIKVKHPFDDNWELPVYVANFVL-MEYGT-GAVFGC
SYL_BRUC2       ECHQQGTSLAAL--ETAEKKGFDTGIKVKHPFDDNWELPVYVANFVL-MEYGT-GAVFGC
SYL_OCHA4       ECHQHGTSLAAL--ETAEKKGFDTGVKVKHPFDENWELPVYVANFVL-MEYGT-GAVFGC
SYL_CHESB       ECRHMGTSVAAL--ETAEKKGFDTGIRVKHPFDAEWTLPVYVANFVL-MEYGT-GAIFGC
SYL_RHILO       EVRHMGTSVAAL--ETAEKKGFDTGIRVVHPFDDSWTLPVYVANFVL-MEYGT-GAIFGC
SYL_BART1       NCRCGGTTTAAL--ETAEKQGFLTPLVAVHPFDETVHIPVYIANFVL-MDYGT-GAIFGC
SYL_BARHE       NCRSGGTTTAEL--ETAEKQGFRTSLVAVHPFDVAVHIPVYIANFVL-MDYGT-GAVFGC
SYL_BARQU       NCRCGGMTTAAL--ETAEKQGFCTSLLAVHPFNPRIHLPVYIANFVL-MDYGT-GAVFGC
SYL_BARBK       MCRCGSTTTEAL--ETAEKQGFRTGVLAVHPLNPAVRLPVYIANFVL-MDYGT-GAIFGC
SYL_RHOP2       ECKKRGTAQAEI--DTAEKQGIDTGIRALHPFDPTWQIPVYVANFVL-MEYGT-GAIFGC
SYL_RHOPS       DCKKRGTAQAEI--DTAEKLGIDTGIRALHPFDPNWQIPVYVANFVL-MEYGT-GAIFGC
SYL_RHOPA       DCKKRGTAQAEI--DTAEKQGIDTGIRAVHPFDPSWKLPVYVANFVL-MEYGT-GAIFGC
SYL_RHOP5       ECKKRGTAQADI--DTAEKQGIDTGIRAVHPFDPEWKLPVYVANFVL-MEYGT-GAIFGC
SYL_NITHX       ECKRRGTAQAEI--DTAEKMGFDTGIRAIHPFDPDWTLPVYVANFIL-MEYGT-GAIFGC
SYL_NITWN       ECKQRGTAQAEI--DTAEKMGFDTGIRAIHPFDAAWALPVYVANFIL-MEYGT-GAIFGC
SYL_BRASB       EIKRIGTAQEAI--DTAEKQGFDTGIRAVHPFDPSWTLPVYVANFVL-MEYGT-GAIFGC
SYL_BRASO       EIKRIGTAQEAI--DTAEKQGFDTGIRAVHPFDPSWTLPVYVANFVL-MEYGT-GAIFGC
SYL_BRADU       EIKKIGTAQEII--DTAEKQGFDTGIRAIHPFDPSWKLPVYVANFVL-MEYGT-GAIFGC
SYL_RHOPB       ECRKTGTAQAEI--DTAEKQGFDTGIRAVHPFDPSWQLPVYVANFVL-MDYGT-GAIFGC
SYL_AZOC5       DCKTGGTSAEAI--ETQEKKGFDTGLTVVHPLDAARTVPVYVANFVL-MDYGT-GAIFGC
SYL_PARL1       ECDRIGTSEEAI--ETADKMGFDTGLKARHPFIEGKTLPVYVANFVL-MDYGT-GAIFAC
SYL_CAUVC       DCRKGGTSEAEI--ESAEKLGYDTGLRVKHPLDPSITLPVWIANFIL-MDYGT-GAIFAC
SYL_CAUSK       ECRKGGTSEADI--EGAEKLGRDTGLRVVHPLDPTLTLPVWIANFIL-MDYGT-GAIFAC
SYL_MARMM       ECARMGTTAEEI--EKAPKRGVDLGITVRHPFDENWELPVWSANFVL-SGYGT-GAIFGS
SYL_HYPNA       KCAQIGTSEEAI--EKAEKLGFDTGLTVAHPFEPGRTVPVWVANFVL-MGYGT-GAIFGC
SYL_RUEST       ECRKGGTTEEAI--ETAEKLGYDTGLRVKHPLDPNWELPVWIANFIL-MDYGT-GAIFAC
SYL_RUEPO       EMRKGGTTEEAI--EKAEKLGADTGLRVRHPLNPDWELPVWVANFIL-MDYGT-GAIFAC
SYL_ROSDO       ECRKGGTTEEAI--ETAEKLGFDTGLRVRHPFDTAAELPVYIANFIL-MDYGT-GAIFGC
SYL_JANSC       ECRKGGTTAAEV--ETAEKLGFDTGLKVRHPFDTAAQLPVYIANFIL-MDYGT-GAIFGC
SYL_DINSH       EVARGGTTEAAL--ETAPKLGFDTGITVRHPLDPNWELPVWIANFIL-MDYGT-GAIFAC
SYL_RHOS1       ECRRVGTSEEAL--EKAEKKGFDTGLRVRHPFDTAWELPVYIANFIL-MDYGT-GAIFGC
SYL_RHOS4       ECRRVGTSEEAL--EKAEKKGFDTGLRVRHPFDAAWELPVYIANFIL-MDYGT-GAIFGC
SYL_RHOS5       ECRRVGTSEEAL--EKAEKKGFDTGIRVRHPFDTALELPVYIANFIL-MDYGT-GAIFGC
SYL_PARDP       ECRRIGTTEEAI--ETAPKMGFDTGLTVRHPLDADWRLPIWIANFVL-MDYGT-GAIFGS
SYL_ZYMMO       DCQKMGTAAEDI--ETAEKKGFDTGLSLVHPLNPELKLPLFVANFVL-MDYGT-GAVFGC
SYL_SPHWW       DCKRTGTAAAEI--ETAEKKGYDTGLSVVHPLDPDWKLPLFVANFVL-MDYGT-GAVFGC
SYL_NOVAD       LCKKGGTTAAEL--ETAEKLGFDTGIGARHPLTGKY-LPVYIANFVL-MEYGT-GAIMAV
SYL_SPHAL       ECRRQGTSAEQL--ETAEKLGFDTGLAVEHPLDPDWHLPVWVVNYVL-MDYGT-GAIFGC
SYL_GRABC       ECRSLGTSEAAI--EAAEKRGFDTGLRVKHPFCDE-TFPVWIANFVL-MDYGT-GAVFGC
SYL_GLUOX       ECRRLGTSEEVI--EAAEKRGFDTGLRVANPLDPEKTAPVWIANFVL-MDYGT-GAVFGC
SYL_ACICJ       ECQSAGTSEAAI--EAAEKRGFDTGLRVVHPFDPSRTHPVWIANFVL-MDYGT-GAIFGC
SYL_MAGSA       ECNRMGTSEAAI--ETAEKKGFDTGLRAVHPFDSTWTLPIYVANFVL-MDYGS-GAIFGC
SYL_RHORT       ECGRMGTSEVEI--ETAEKKGFDTGLKVRHPFDPAWELPVYVANFVL-MEYGT-GAIFGC
SYL_MAGMM       TCQGVGTSEEAL--EKLEKKGFDTGIKAIHPITGE-SLPVYIANFVL-MSYGT-GAVMAV
SYL_CAMJ8       NKIKAIQNQSPRERQSSEKEGYFLGIYAIHPLSGE-KIPLWVANFVL-ADYGS-GAVMAV
SYL_CAMJJ       NKIKAIQNQSPRERQSSEKEGYFLGIYAIHPLSGE-KIPLWVANFIL-ADYGS-GAVMAV
SYL_CAMJR       NKIKVIQNQSPRERQSSEKEGYFLGIYAIHPLSGE-KIPLWVANFVL-ADYGS-GAVMAV
SYL_CAMJE       NKIKVIQNQSPRERQSSEKEGYFLGIYAIHPLSGE-KIPLWVANFVL-ADYGS-GAVMAV
SYL_CAMJD       NKIKAIQNQSPRERQSSEKEGYFLGIYAIHPLSGE-KIPLWVANFVL-SDYGS-GAVMAV
SYL_CAMC1       AKIKAILNQSPRERQASDKDGEFLGIYVVHPLTNE-KIPVWVANFIL-ADYGS-GAIMAV
SYL_CAMC5       AKIKSILNQSPRERQASDKDGVFLDIYMLHPLTNE-PVPVWVANFIL-ADYGS-GAIMAV
SYL_CAMFF       AKLKFILNQSPKQRQSIDKDGVSLGLNVIHPLTNE-LIPVWCANFVL-AEYGG-GAVMSV
SYL_CAMHC       DKIKKILNQSPRERQANDKDGAFLNLFAIHPLSGK-KIPVWMANFVL-AEYGG-GAVMAV
SYL_ARCB4       KAIKAMQKIPERDRATQEKEGIDLEIEVMHPLTGK-TIPVWVANFVL-SSYGG-GAVMAV
SYL_NITSB       QKICTMQNQNARTRQQAEKEGLFLDLYVIHPLTKQ-KIPVWVANFVL-AEYGS-GAVMAV
SYL_WOLSU       EALAKMQNIPAKERAMIPKEGVALGLEAIHPLTGE-AIPLWAANFVL-TDYGS-GAVMAV
SYL_HELHP       KSIEAIKNTTARARAMSEKVGFDLGVYVIHPLTQE-KLPVWVANFVL-MDYGS-GAVMSV
SYL_HELPY       KMIKAILNTTQRER-ALEKKGAFLGIYAIHPLTKQ-KIPVWVANFAL-ANYGS-GALMGV
SYL_HELPH       KIIKAILNTTQRER-ALEKKGAFLGIYAIHPLTKQ-KIPVWVANFAL-ANYGS-GALMGV
SYL_HELPJ       KMIKAILNTTQRER-ALEKKGAFLGIYAIHPLTKQ-KIPVWVANFAL-ANYGS-GALMGV
SYL_HELAH       KTIKAILNTTPRER-TLEKKGAFLGIYAIHPLTKQ-KIPIWVANFAL-ANYGS-GALMGV
SYL_THEMA       RVKQQDRFRRTS--VEAEKEGFFLGRYAINPVTGE-RIPIYVANYIL-MEYGT-GAIMGV
SYL_THEP1       RVKQQDRFRRTS--VEAEKEGFFLGRYAINPVTGE-RIPIYVANYIL-MEYGT-GAIMGV
SYL_THEM4       KVSLEDRFKRTS--LEAEKEGFFLGRYAINPVTGE-KIPIYVANYIL-YEYGT-GAIMAV
SYL_FERNB       KVALEDRFKRTS--VEAKKEGVFLGRYAINPLTNE-KIPIYVANYIL-YEYGT-GAIMAV
SYL_PSELT       YVGQQDRHKRGS--ADVEKEGFFTGRYAINPVSGE-RIPIYVANYVL-MEYGT-GAVMGV
SYL_CALS8       KMQYLNEIERTS--TETEKEGRFTGGYAIHPLTGK-KVPIYIANYVL-VDYGT-GAVMGV
SYL_HUNT2       KMMFLNEIDRTA--TDVEKEGVFTGRYVINPLNGD-RVPLYLANYVL-AEYGT-GVVMAV
SYL_DESHY       RMKGLNEIARTS--TETEKEGLFTGAYCINPYSGE-KVPIWIANYVL-FEYGT-GAVMGV
SYL_SYNWW       KMKYLNEMARTS--TEAEKEGVFTGAYAINPMDGS-RIPIWIANYVL-MDYGT-GAIMAV
SYL_CARHZ       KMMYLSEIERTA--ETAEKEGVFTGAYAINPFTGE-EIPILLANYVL-VEYGT-GAVMGV
SYL_PELTS       KVRNLREIDRTS--TEAEKVGMPTGAHCINPLTGE-KVPVLIANYVL-MEYGT-GCVMGV
SYL_MOOTA       AARYLSALDRTA--TEKEKEGLFTGAYAINPVNNE-RVPIWIANYVL-MEYGT-GAVMGV
SYL_DESRM       RVNKLTELDRTS--S--DKEGVFTGAYCINPFDGA-RVPILIANYVL-YHYGT-GAVMGV
SYL_SYMTH       KMKHLSEIARTS--TEAEKEGLYTGLDVINPFNGE-KAQLWIANYVL-MDYGT-GAVMGV
SYL_DESVH       RIRNMDRIDRQS--DTLEKEGVFTGAYCVNPFTGR-KMPIWVANFVL-AEYGT-GAVMAV
SYL_DESVV       RIRNMDRIDRQS--DTLEKEGVFTGAYCVNPFTGR-KMPIWVANFVL-AEYGT-GAVMAV
SYL_DESAG       RIRNMDRIERTA--DTLEKEGVFTGAYCINPLSGR-RMPIYVANFVL-AEYGT-GAVMAV
SYL_LAWIP       KMRNMDRLERQS--NLLTKEGIFIDRYCINPCSGD-KIPIWIGNFVL-ADYGT-GAIMAV
SYL_GEOMG       KVKKTDKIKRTA--EDFEKEGVFTGSYCINPVTNR-RMPVFLANFVL-LDYGT-GAVMAV
SYL_GEOSL       KVKKTDKIKRTA--EDFEKEGVFTGAYCINPVTNL-RMPVYLANFVL-LDYGT-GAVMAV
SYL_GEOUR       KVKKTDRIRRTA--EDFEKEGVFTGSYCINPVTNR-RMPVYLANFVL-TDYGT-GAVMAV
SYL_PELPD       KVRNTDRSKRTA--DDYEKEGVFTGSYCINPLTQV-RMPIYLANFVL-TDYGT-GAVMAV
SYL_PELCD       RVRTQDKAKRTS--DDFVKEGVFTGSYGINPVNGR-RIPIYLANFVL-MDYGT-GAVMAV
SYL_SYNAS       EVKKQDKLMRTS--DYYEKQGLFLDCYCLNPLTGW-EMPIFATNFVL-ADYGT-GCVMAV
SYL_SYNFM       AAKQAKRNDREA--ELLEKEGVFTGSCCINPVTGA-KMPIYVANFVV-MEYGT-GAVMAV
SYL_DESPS       EVLEDKQRQDPT--QEPEKKGIFTGKYCTNPFNGD-RVPVYVANFVL-IEYGT-GAVMAV
SYL_FUSNN       EMKNTDIIERGA--EGREKNGIDSGWHIENPVNKE-IVPLWIADYVL-MNYGT-GAVMGV
SYL_TRIV2       EVTNQSELERTA--EDKPKRGVATGGKAINPFTGE-EVPIWIADYVL-YEYGT-GAVMGV
SYL_NOSS1       EVTNQSELERTA--EDKPKRGIATGGKAINPFTGE-EVPIWIADYVL-YEYGT-GAVMGV
SYL_ACAM1       AVGAESEMDRTA--EDKPKKGIPTGGKAINPFTGE-EIPIWIADYVL-YEYGT-GAVMGV
SYL_TRIEI       EVAAESELERTA--EDKPKRGVPTGGKAINPFNNQ-EVPIWIADYVL-YEYGT-GAVMGV
SYL_SYNY3       MVAKESEIERTA--EDKPKRGVKTGGIAINPFNGE-EIPILIADYVL-YEYGT-GAVMGV
SYL_SYNE7       EVSQTSELERTA--EDRPKRGVPTGGFVTNPFTGQ-AVPIWIADYVL-VEYGT-GAVMGV
SYL_SYNP6       EVSQTSELERTA--EDRPKRGVPTGGFVTNPFTGQ-AVPIWIADYVL-VEYGT-GAVMGV
SYL_THEEB       SVQQESELERTA--GDRPKRGVATGGKALNPFTGE-EIPIWIANYVL-YEYGT-GAVMGV
SYL_SYNJB       QAAARSEIERSA--EDREKTGVWTGSYAINPVNQE-RIPIWIADYVL-MGYGT-GAIMAV
SYL_SYNJA       EAAARSEIERSA--EDREKTGVWTGSYAINPVNQE-RIPIWIADYVL-MGYGT-GAIMAV
SYL_GLOVI       QVQSESEIERVS--EDRPKQGVSTGAVALNPFTGQ-AVPVWIADYVL-FEYGT-GAVMGV
SYL_SYNS3       LMAELSQDERTS--DDQPKRGVPTGAVAINPANGK-SIPIWIADYVL-ADYGT-GAVMGV
SYL_SYNPW       LVGELSADERTA--DDRPKRGVPIGATAVNPANGE-SIPIWIADYVL-AGYGT-GAVMGV
SYL_PROMM       LISQLSVKDRTA--EDQPKRGVPIGAQVINPVNGE-SLPVWIADYVL-ADYGS-GAVMGV
SYL_PROM3       LISQLSVKDRTA--EDQPKRGVPIGAQVINPVNGE-SLPVWIADYVL-ADYGS-GAVMGV
SYL_SYNSC       EVARLSTIERTC--DDRPKRGVPIGSHVINPLTGV-VLPVWIADYVL-AEYGT-GAVMGV
SYL_SYNS9       QVARLSTIERTS--DERPKQGVATGACVTNPLTGE-QLPVWIADYVL-ADYGT-GAVMGV
SYL_SYNPX       EVARLSALERTS--DDAPKRGVFTGATVLNPLNGR-ALPVWIADYVL-VDYGT-GAVMGV
SYL_SYNR3       SLQSISEQDRVA--DDRPKRGVATGGTVQHPFTGQ-AVPVWIADYVL-PDYGT-GAVMGV
SYL_PROMT       TQEKLSDLERNS--DTRQKLGMYLGVDAINPANNK-EIPIWIGDYVI-MEYGT-GAVMGV
SYL_PROM1       TQEKLSDLERNS--DTRQKLGMYLGVDAINPANNK-EIPIWIGDYVI-MEYGT-GAVMGV
SYL_PROMA       EISILTDQERTS--DGNNKRGMFLGCHAINPINKK-IIPIWVGEYVL-SSYAT-GAVMGV
SYL_PROM0       YLKKNKNNEL-------EKIGIKTSLIAINPVNSE-PIPIWVASYVL-DEYGT-GAVMGV
SYL_PROM9       YLKNNKNNEL-------EKIGIKTSLIAINPVNSE-PIPIWVASYVL-DEYGT-GAVMGV
SYL_PROMS       YLKDNKNNEL-------EKIGIKTSLIAINPVNSE-PIPIWVASYVL-DEYGT-GAVMGV
SYL_PROM2       YLKNNKNNEL-------EKIGIKTSLIAINPINSE-PIPIWVASYVL-DEYGT-GAVMGV
SYL_PROMP       YLQESKDKDQ-------KKIGIPTNLIAINPINSK-EIPILIASYVL-DEYGT-GAVMGV
SYL_PROM5       YLKKNQDKDQ-------KKIGIPTNLKAINPINSN-EIPIWIASYVL-DEYGT-GAVMGV
SYL_SOLUE       KAMVDSRAGRDP--GDIDKEGFFTGHYAVNPYNGE-QVPIWIANFVL-MGYGT-GAIMAV
SYL_DEIRA       AAGRKTDVERQQ--E-GEKTGVFTGSYATHPISGH-QLPIWVADYVL-VTYGT-GSIMAV
SYL_DEIGD       AAGRKTDVERQQ--ELGEKTGVFTGSYATHPVTGH-QIPIWVADYVL-MTYGT-GSIMAV
SYL_RUBXD       RAARMSEIDRAD--VTREKTGVFTGAYAVNPANGE-RIPVYVADYVL-MGYGT-GAIMAV
SYL_CLOPE       EAKKQSDIERQS--ISREKTGVFTGAYAIHPLTGK-EVPIWVGDYVL-ATYGT-GAVMAV
SYL_CLOPS       EAKKQSDIERQS--ISREKTGVFTGAYAIHPLTGK-EVPIWVGDYVL-ATYGT-GAVMAV
SYL_CLOP1       EAKKQSDIERQS--ISREKTGVFTGAYAIHPLTGK-EVPIWVGDYVL-ATYGT-GAVMAV
SYL_CLOB8       AAAKQSEIERQS--VSKEKTGVFTGSYAINPINGK-VVPIWISDYVL-ATYGT-GCVMAV
SYL_CLOB1       QAKNQSDIERQS--ITREKTGVFSGSYAINPINGK-KVPIWIGDYVL-NTYGT-GCVMAV
SYL_CLOBH       QAKNQSDIERQS--ITREKTGVFSGSYAINPINGK-KVPIWIGDYVL-NTYGT-GCVMAV
SYL_CLOBL       QAKNQSDIERQS--ITREKTGVFSGSYAINPINGK-KVPIWIGDYVL-NTYGT-GCVMAV
SYL_CLONN       EAQKQSDIERQS--STREKTGVFTGSYAINPINGN-KVPIWVGDYVL-ATYGT-GCVMAV
SYL_CLOAB       QAQKQSEIERQS--LTREKTGVFTGSYAINPINNK-KVPIWIADYVI-YTYGT-GAVMAV
SYL_CLOK5       AAKKQTDIERQS--ITREKTGVSTGSYAINPINGR-KVPIWIGDYVL-NTYGT-GAVMAV
SYL_CLOTE       QAKKQSEIERQS--ITREKTGVFTGSYAINPINGK-KVPVWVGDYVL-STYGT-GAVMAV
SYL_CALS4       YAKKQSEIERLS--TEKEKTGVFTGAYAIHPLTGE-KLPIWIADYVL-VTYGT-GCVMGV
SYL_ROSCS       RARMESEIERTS--ATREKTGVFLGSYAINPVNDE-RIPIWIADYVL-MGYGA-GAIMAV
SYL_ROSS1       RARMESEIERTS--ATREKSGVFLGSYAINPVNDE-RIPIWIADYVL-MGYGT-GAIMAV
SYL_THEFY       QVSKLSDIERQS--TEREKTGVFLGRYAINPVNGE-RIPVWAADYVL-ADYGH-GAIMAV
SYL_ACIC1       QVRRLSDIDRLS--TERQKTGVFLGRYAVNPVNGE-RIPVWAADYVL-ADYGT-GAIMAV
SYL_ARTS2       QVKALSEIERQS--TEREKTGVFTGRYAVNPLNGE-KLPVWAADYVL-ADYGT-GAIMAV
SYL_PAEAT       KVKALSEIERQS--TEREKTGVFTGRYAINPLNGE-KLPVWAADYVL-ADYGT-GAIMAV
SYL_RENSM       RVKHLSDIERQE--SDREKTGVFLGRYAINPIDGE-MLPIWAADYVL-ADYGT-GAIMAV
SYL_CLAMS       RTQRLNEIERST--TDRPKTGIPLGLTAINPVNGE-RIPVWAADYVL-ADYGT-GAVMAV
SYL_CLAM3       RTQRLNEIERST--TDRPKTGIPLGRTAINPVNGE-RIPVWAADYLL-ADYGT-GAVMAV
SYL_LEIXX       AVRGTTEMDRLS--TEREKTGVFLERHAVNPLTGE-SIPIWAADYVL-SDYGH-GAIMAV
SYL_KINRD       QVQETSDIDRLS--SEREKTGVPLGRYAVNPVNGE-RLPIWAADYVL-ADYGT-GAIMAV
SYL_NOCSJ       EIRKETEIERLS--TDRPKTGVDLGVTATNPVTGT-QIPVWATDYVL-ADYGT-GAVMGV
SYL_TROW8       LLELRHNIDK----THESVRGLDLKSFAIHPLTGQ-SIPIFAASYIL-SDYAK-GAVMSV
SYL_TROWT       LLELRHNIDK----THEGVRGLDLKSFAIHPLTGQ-SVPIFAASYIL-SDYAK-GAVMSV
SYL_MYCPA       AIASKSDLERQ---ESKAKTGVFLGSYATNPTNGK-PVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCA1       AIASKSDLERQ---ESKAKTGVFLGSYATNPTNGK-PVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCLE       AIVAKSDLDRQ---ESKEKTGVFLGRYATNPATGK-PVPIFVADYVL-VGYGT-GAVMAV
SYL_MYCTA       AIAAKSDLERQ---ESREKTGVFLGSYAINPANGE-PVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCBO       AIAAKSDLERQ---ESREKTGVFLGSYAINPANGE-PVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCTU       AIAAKSDLERQ---ESREKTGVFLGSYAINPANGE-PVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCBP       AIAAKSDLERQ---ESREKTGVFLGSYAINPANGE-PVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCUA       AIAVKSDLERQ---ESKEKTGVFLGSHAINPATGQ-PVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCSS       SIAAKSDLERQ---ENKTKTGAFLGAYATNPANGQ-QVPIFIADYVL-IGYGT-GAIMAV
SYL_MYCSK       SIAAKSDLERQ---ENKTKTGAFLGAYATNPANGQ-QVPIFIADYVL-IGYGT-GAIMAV
SYL_MYCSJ       SIAAKSDLERQ---ENKTKTGAFLGAYATNPANGQ-QVPIFIADYVL-IGYGT-GAIMAV
SYL_MYCS2       DIAAKSDLERQ---ENKTKTGVFLGAYATNPADGK-QVPIFIADYVL-AGYGT-GAIMAV
SYL_MYCVP       SIAAKSDLERQ---ENKAKTGVFIGAYATNPANAK-QVPVFIADYVL-AGYGT-GAIMAV
SYL_MYCGI       GIAAKSDLERQ---ENKTKTGVFLGAYATNPANGQ-QVPVFIADYVL-AGYGT-GAIMAV
SYL_NOCFA       SIAAKSDLERQ---ENKEKTGVFLGVHAVNPVNGA-RVPIFIADYVL-SGYGT-GAIMAV
SYL_RHOJR       SIAAKSDLERQ---EYKEKTGVFLGTYAVNPVNGH-KLPVFIADYVL-TGYGT-GAIMAV
SYL_SACEN       AASMKSDLDRQ---ENKEKTGVFTGAWATNPVNGE-QVPVFIADYVL-MGYGT-GAIMAV
SYL_CORGB       SIAAKSDLERQ---ENKEKTGVFLGVYATNPVNGD-QIPVFIADYVL-TGYGT-GAIMAV
SYL_CORGL       SIAAKSDLERQ---ENKEKTGVFLGVYATNPVNGD-QITVFIADYVL-TGYGT-GAIMAV
SYL_COREF       SIAAKSDLERQ---ENKDKTGVFLGVHATNPVNGE-QIPVFIADYVL-TGYGT-GAIMAV
SYL_CORDI       SIAAKSDLERQ---ENKEKTGVYLGVNAVNPVNGE-SIPVFIGDYVL-TGYGT-GAIMAV
SYL_CORJK       AIAAKSDLERQ---ENKEKTGVFLGVYATNPVNGA-QVPVFIADYVL-TGYGT-GAIMAV
SYL_STRCO       QAASKSDVERQA--EAKDKTGVFIGAYATNPVNGE-QVPVFVADYVL-MGYGT-GAIMAV
SYL_STRAW       QAASKSDVERQA--EAKDKTGVFTGAYATNPVSGE-QVPVFIADYVL-MGYGT-GAIMAV
SYL_SALAI       VAAAKTDMERQA--ETKEKTGVFIGAYATNPVTGA-QIPIFIADYVL-AGYGT-GAIMAV
SYL_BIFAA       AAEAKTAKDRVD--EAGEKTGLFTGLYAINPITGA-KLPLFTADYVL-MDYGT-GAIMAV
SYL_BIFLO       AAEAKTAKDRVN--EAGEKTGLFTGLYATNPITGA-KLPLFTADYVL-MDYGT-GAIMAV
SYL_FRACC       FAAHRSDRQRGE--EVIDRTGVFTGSYVRNPVGGG-VIPVFLADYVL-LGYGT-GAIMAV
SYL_FRAAA       FAARRSDRQRGE--E-VDRTGVFTGAYVRNPVGGG-LLPVFLADYVL-VGYGT-GAIMAV
                                             :.        :   .                

SYL_GEOKA       PAHDERDYEFAKKFHLP-----MKEVVAGG------------------------------
SYL_GEOTN       PAHDERDYEFAKTFNLP-----IKEVVAGG------------------------------
SYL_BACCZ       PAHDERDYEFASTFNLP-----MKEVVKGG------------------------------
SYL_BACAH       PAHDERDYEFASTFNLP-----MKEVVKGG------------------------------
SYL_BACAN       PAHDERDYEFASTFNLP-----MKEVVKGG------------------------------
SYL_BACHK       PAHDERDYEFASTFNLP-----MKEVVKGG------------------------------
SYL_BACC1       PAHDERDYEFASTFNLP-----MKEVVKGG------------------------------
SYL_BACCR       PAHDERDYEFASVFNLP-----MKEVVKGG------------------------------
SYL_BACCN       PAHDERDYEFAKTFDLP-----MKEVVKGG------------------------------
SYL_BACSU       PGHDERDFEFAKTFGLP-----VKEVVKGG------------------------------
SYL_BACVZ       PAHDERDFEFAKVFSLP-----VKEVVKGG------------------------------
SYL_BACLD       PAHDERDHEFASAFGLP-----IKEVVKGG------------------------------
SYL_BACP2       PAHDERDYEFAKTFDLP-----IKAVVEGG------------------------------
SYL_BACHD       PAHDERDYEFAKTFDLP-----IKEVVSGG------------------------------
SYL_BACSK       PAHDERDFEFANAFGLP-----IKEVVAGG------------------------------
SYL_OCEIH       PAHDERDYEFANTFGLP-----IKEVVAGG------------------------------
SYL_STAES       PGHDERDHEFATKFNLP-----IIEVIEGG------------------------------
SYL_STAEQ       PGHDERDHEFATKFNLP-----IIEVIEGG------------------------------
SYL_STAAW       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAAS       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAAN       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAA1       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAAM       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAA9       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAA2       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAA3       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAAC       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAA8       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAAT       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAAE       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAAB       PAHDDRDYEFAKKFDLL-----IIEVIEGG------------------------------
SYL_STAAR       PAHDDRDYEFAKKFDLP-----IIEVIEGG------------------------------
SYL_STAHJ       PAHDERDYEFASKFNLP-----INEVIAGG------------------------------
SYL_STAS1       PSGDQRDYEFAKTFDLP-----IIEVIEGG------------------------------
SYL_LISMF       PAHDERDFEFAQQFGLN-----IRPVLEGG------------------------------
SYL_LISMO       PAHDERDFEFAQQFGLN-----IRPVLEGG------------------------------
SYL_LISIN       PAHDERDFEFAQQFGLN-----IRPVLEGG------------------------------
SYL_LISW6       PAHDERDFEFAQQFGLN-----IRPVLEGG------------------------------
SYL_ENTFA       PAHDERDYEFAKTFGID-----ILPVIAGG------------------------------
SYL_STRTD       PAHDERDWEFAKQFGLP-----IVEVLEGG------------------------------
SYL_STRT2       PAHDERDWEFAKQFGLP-----IVEVLEGG------------------------------
SYL_STRT1       PAHDERDWEFAKQFGLP-----IVEVLEGG------------------------------
SYL_STRP2       PAHDQRDWEFAKQFDLP-----IVEVLEGG------------------------------
SYL_STRR6       PAHDQRDWEFAKQFDLP-----IVEVLEGG------------------------------
SYL_STRPN       PAHDQRDWEFAKQFDLP-----IVEVLEGG------------------------------
SYL_STRSV       PAHDERDWEFAKQFDLE-----IIPVLEGG------------------------------
SYL_STRGC       PAHDERDWEFAKQFDLE-----IIPVLEGG------------------------------
SYL_STRS2       PAHDERDWEFAKQFGLD-----IIPVLEGG------------------------------
SYL_STRSY       PAHDERDWEFAKQFGLD-----IIPVLEGG------------------------------
SYL_STRPD       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRPG       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRP6       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRPM       PAHDERDWEFAKQFKLD-----IIPVLEGG------------------------------
SYL_STRPF       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRPB       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRPC       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRP3       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRP1       PAHDERDWEFAKQFKLD-----IIPVLEGG------------------------------
SYL_STRP8       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRA3       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRA5       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_STRA1       PAHDERDWEFAKQFKLD-----IIPVLEGG------------------------------
SYL_STRMU       PAHDERDWEFAKQFNLD-----IIPVLEGG------------------------------
SYL_LACLM       PAHDERDWEFAKVYGLE-----ILPVVEGG------------------------------
SYL_LACLA       PAHDERDWEFAKVYGLE-----ILPVVEGG------------------------------
SYL_LACLS       PAHDERDWEFAKVYGLE-----ILPVVEGG------------------------------
SYL_LACSS       PAHDPRDWEFAKKFGLP-----LKPVVSGG------------------------------
SYL_LACDA       PAHDERDYAFATKFDLP-----IKEVVEGG------------------------------
SYL_LACDB       PAHDERDYAFATKFDLP-----IKEVVEGG------------------------------
SYL_LACP3       PAHDDRDYAFAKKFGIE-----IKPVIEGG------------------------------
SYL_LACPL       PAHDDRDFEFAQKFDLP-----IKPVIAGD--N---------------------------
SYL_LACBA       PAHDERDHEFATKFNLP-----ITQVIEGDADT---------------------------
SYL_PEDPA       PAHDGRDYEFAKKFKID-----MVPVYEGG------------------------------
SYL_LACS1       PAHDERDHEFAQKFDLP-----IVQVIEGG------------------------------
SYL_LACRD       PSGDQRDYDFATKFNLP-----IKPIIEGA------------------------------
SYL_LEUMM       PAHDDRDWEFAKKFNLP-----IKAVIEGG------------------------------
SYL_OENOB       PAHDTRDYEFAKKFDLP-----IRQVIKGG------------------------------
SYL_SALRD       PAHDERDHAFANKYDLP-----IREVVEGG------------------------------
SYL1_RHIL3      PAHDARDYAFAHSHELP-----IIRVIDSE--A---------------------------
SYL_RHOBA       PAHDERDFEFAVAFDLP-----VIPVVDPPADHKQR------------------------
SYL_PELLD       PAHDSRDWEFAKKFGLP----IVEVVKSPH------------------------------
SYL_CHLPM       PAHDSRDWEFAKQYGLP----IIEVVKSPH------------------------------
SYL_CHLCH       PAHDSRDWAFAKQYNLP----IIEVIKSPH------------------------------
SYL_CHLTE       PAHDSRDWEFAKKFGLP----IREVIKSPH------------------------------
SYL_CHLPD       PAHDSRDWEFAKKFGLP----IIEVIKSPD------------------------------
SYL_LEPBL       PAHDQRDYEFAKTFGLE----ILPVIEG--------------------------------
SYL_LEPBJ       PAHDQRDYEFAKTFGLE----ILPVIEG--------------------------------
SYL_LEPIC       PAHDQRDFEFARTFGLK----IIPVIEG--------------------------------
SYL_LEPIN       PAHDQRDFEFARTFGLK----IIPVIEG--------------------------------
SYL_BACTN       PAHDSRDYAFAKHFGLE-----IRPLVEGC------------------------------
SYL_BACV8       PAHDSRDYAFAKHFNLP-----IVPLVEGC------------------------------
SYL_BACFR       PAHDSRDYAFAKHFNLE-----IRPLIEGC------------------------------
SYL_BACFN       PAHDSRDYAFAKHFNLE-----IRPLIEGC------------------------------
SYL_PARD8       PAHDSRDYAFAKHFGLE-----IRPLVEGC------------------------------
SYL_PORGI       PAHDTRDFAFARHFDLP-----IVQVVVP-------------------------------
SYL_FLAPJ       PCGDERDYAFANFFKGQNGMPEIKNIFDNV------------------------------
SYL_FLAJ1       PCGDERDYAFANFFKGQNGMQEIKNIFANV------------------------------
SYL_GRAFK       PCGDQRDHDFARHFD-----LLIPNIFENV------------------------------
SYL_CYTH3       PSSDERDYKFASFYKLP---IISVQEGAHT------------------------------
SYL_BDEBA       PGHDARDFEFATKFNIP-----IKSVLESD------------------------------
SYL_SORC5       PGHDERDFSFARTYGLP-----IVEVVSPDG-----------------------------
SYL_TREDE       PAHDERDFEFAAQFNLP-----KIKVVAGAEEWESGKRD---------------------
SYL_TREPA       PAHDQRDWDFATRFGLP-----KLTVVSADYTATVPNSN---------------------
SYL_BORAP       PAHDERDFQFAKKYKLK-----ILPVISK-------------------------------
SYL_BORBP       PAHDERDFQFAKKYKLK-----ILPVISK-------------------------------
SYL_BORBU       PAHDERDFQFAKKYQLK-----ILPVISK-------------------------------
SYL_CHLTR       PAHDERDLLFAEQFNLP-----VVSVLNK-------------------------------
SYL_CHLTA       PAHDERDLLFAEQFNLP-----VVSVLNK-------------------------------
SYL_CHLMU       PAHDDRDLLFAQQFDLP-----IISVVSE-------------------------------
SYL_CHLFF       PAHDERDREFAETFSLP-----IYEVLDT-------------------------------
SYL_CHLCV       PAHDERDREFAEAFSLP-----IYEVLDK-------------------------------
SYL_CHLAB       PAHDERDREFANAFALP-----IDEVLDE-------------------------------
SYL_CHLPN       PAHDERDREFAEMFSLP-----IHEVIDD-------------------------------
SYL_PARUW       PAHDERDFEFAKTFKLP-----IIPVYDPVCEEIT---I---------------------
SYL_ALKOO       PGHDTRDWEFAKKFNLP-----IVEVVSG-------------------------------
SYL_UREP2       PAHDERDYAFAKKYALP-----IKSVIDTKQ-----------------------------
SYL_UREPA       PAHDERDYAFAKKYALP-----IKSVIDTKQ-----------------------------
SYL_MYCPU       PAHDKRDYEFANKYGLE-----IKQVIVSKEN----------------------------
SYL_MYCPE       PAGDKRDYDFAKLFNLE-----IKEIIKDHP-----------------------------
SYL_MYCGA       PAHDERDYQFAKQYDLE-----IIPVIKADQ-----------------------------
SYL_MYCGE       GAHNENDNFFARKQKLK-----IINVIDKKE-----------------------------
SYL_MYCPN       PAHNENDNFFARKQKLP-----IITVIDKQE-----------------------------
SYL_MYCCT       PAHDKRDWDFATKFNLP-----IRFVISTKD-----------------------------
SYL_MYCMS       PAHDKRDWDFAAKFNLP-----IKFVIQTKD-----------------------------
SYL_MESFL       PAHDKRDWEFATKFNLE-----KKFVIENKT-----------------------------
SYL_ACHLI       PAHDDRDYEFAMQYGLN-----IIEVIKGGS-----------------------------
SYL_PSEA6       PGHDQRDWEFAQKYGLP-----IKQVVEPSADEPQ-------------------------
SYL_COLP3       PGHDQRDYEFALKYGLA-----IEQVIAGQEAD---------------------------
SYL_IDILO       PAHDQRDWEFATKYQLE-----IRPVIEPLSGDS--------------------------
SYL_PSEHT       PAHDQRDFEFATAYGLD-----IKQVIAPVTGSDL-------------------------
SYL_PSYIN       PAHDQRDYEFAKKYDLT-----IKAVIKPANTDL--------------------------
SYL_SALCH       PGHDQRDYEFASKYGLT-----IKPVILAAD------------SSE--------------
SYL_SALTI       PGHDQRDYEFASKYGLT-----IKPVILAAD------------GSE--------------
SYL_SALTY       PGHDQRDYEFASKYGLT-----IKPVILAAD------------GSE--------------
SYL_SALPB       PGHDQRDYEFASKYGLT-----IKPVILAAD------------GSE--------------
SYL_SALPA       PGHDQRDYEFASKYGLT-----IKPVILAAD------------GSE--------------
SYL_CITK8       PGHDQRDYEFATKYGLT-----IKPVILAAD------------GSE--------------
SYL_SALAR       PGHDQRDYEFATKYGLT-----IKPVILAAD------------GSA--------------
SYL_SHIFL       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_SHIF8       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_SHIBS       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECOL6       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECOL5       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECO57       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_SHISS       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECOLI       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECOLC       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_SHIDS       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECOHS       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECOUT       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECOK1       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_ECO24       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_KLEP7       PGHDQRDYEFASKYGLN-----IKPVILAAD------------GSE--------------
SYL_CROS8       PGHDQRDYEFATKYSLP-----IKPVILTAE------------GTA--------------
SYL_ENT38       PGHDQRDYEFATKYGLP-----IKRVIKSPEQKAYEHALEYGLGSAKNPNDFEPLTHNQR
SYL_YERPA       PGHDARDWEFATKYNLP-----IKPVILAAD------------GSE--------------
SYL_YERP3       PGHDARDWEFATKYNLP-----IKPVILAAD------------GSE--------------
SYL_YERPE       PGHDARDWEFATKYNLP-----IKPVILAAD------------GSE--------------
SYL_YERPN       PGHDARDWEFATKYNLP-----IKPVILAAD------------GSE--------------
SYL_YERPS       PGHDARDWEFATKYNLP-----IKPVILAAD------------GSE--------------
SYL_YERPP       PGHDARDWEFATKYNLP-----IKPVILAAD------------GSE--------------
SYL_YERE8       PGHDARDWEFATKYNLP-----IKPVILAAD------------GSE--------------
SYL_SERP5       PAHDQRDWEFATKYGLP-----IKPVVLALD------------GSQ--------------
SYL_PECAS       PGHDQRDWEFATKYDLS-----IKPVILNAD------------GSE--------------
SYL_SODGM       PGHDQRDFEFARKYDLP-----VKPVIRNAD------------GSE--------------
SYL_PHOLL       PGHDQRDWEFATKYNLP-----IKAVILDNEGNE--------------------------
SYL_MANSM       PAHDQRDFEFATKYGLP-----IKQVIAPMN------------GEE--------------
SYL_ACTSZ       PAHDQRDFEFATKYDLP-----INQVIAPVN------------GED--------------
SYL_HAES1       PAHDQRDYEFAQKYQLP-----LFPVIKPAD------------NSA--------------
SYL_HISS2       PAHDQRDYEFAQKYQLP-----LFPVIKPAD------------NSA--------------
SYL_PASMU       PGHDERDAEFARKYGLP-----LLNVIKPIN------------GEP--------------
SYL_HAEIG       PAHDQRDFEFAQKYSLP-----IKQVIAPLA------------DEE--------------
SYL_HAEIN       PAHDQRDFEFAQKYSLP-----IKQVIAPLA------------DEE--------------
SYL_HAEI8       PAHDQRDFEFAQKYSLQ-----IKQVIEPIA------------DEE--------------
SYL_HAEIE       PAHDQRDFEFAQKYGLQ-----IKQVIEPIA------------DEE--------------
SYL_ACTP2       PAHDERDFEFAQKYGLQ-----INQVIQPLD------------GSE--------------
SYL_HAEDU       PAHDERDFDFAKKYGLQ-----INQVIQPLD------------AST--------------
SYL_SHESA       PGHDQRDYEFAKKYNLP-----IEAVIKPVDG----------------------------
SYL_SHESM       PGHDQRDYEFAKKYNLS-----IEAVIKPVDG----------------------------
SYL_SHESR       PGHDQRDYEFAKKYNLP-----IEAVIKPVDG----------------------------
SYL_SHEON       PGHDQRDYEFAKKYHLP-----IEAVIKPAEG----------------------------
SYL_SHEB9       PGHDQRDFEFAKKYGLA-----IEAVIKPVDG----------------------------
SYL_SHEB5       PGHDQRDFEFAKKYGLA-----IEAVIKPVDG----------------------------
SYL_SHEB8       PGHDQRDFEFAKKYGLA-----IEAVIKPVDG----------------------------
SYL_SHESW       PGHDQRDFEFAKKYGLA-----IEAVIKPVDG----------------------------
SYL_SHEPC       PGHDQRDFEFAKKYGLA-----IEAVIKPVDG----------------------------
SYL_SHEAM       PAHDQRDYEFAKKYGLA-----LKAVIKPADG----------------------------
SYL_SHEHH       PAHDQRDYEFAKKYSLN-----IEAVVKPADG----------------------------
SYL_SHEPA       PAHDQRDYEFAKKYGLN-----IEAVIKPVDG----------------------------
SYL_SHELP       PGHDQRDYEFATKYGLP-----IVGVIKPADG----------------------------
SYL_SHESH       PAHDQRDYEFATKYGLA-----IEGVIKPSDS----------------------------
SYL_SHEDO       PAHDQRDYEFAKAYGLE-----MQAVIKPADS----------------------------
SYL_SHEFN       PAHDQRDYEFATKYQLA-----IEAVIKPVDG----------------------------
SYL_VIBPA       PAHDQRDFEFATKYGLD-----IIPVIKPADGS---------------------------
SYL_VIBCB       PAHDQRDFEFATKYGLD-----IVPVIKPVDGS---------------------------
SYL_VIBVU       PAHDQRDFEFATKYGLD-----IIPVIKPIDGS---------------------------
SYL_VIBVY       PAHDQRDFEFATKYGLD-----IIPVIKPIDGS---------------------------
SYL_VIBCH       PAHDQRDFEFATKYGLD-----IIPVIKPADGS---------------------------
SYL_VIBC3       PAHDQRDFEFATKYGLD-----IIPVIKPADGS---------------------------
SYL_ALIF1       PAHDQRDFEFATKYGLD-----IIPVIKPEDGS---------------------------
SYL_PHOPR       PAHDQRDYEFATKYGLD-----IIPVIKPEDGS---------------------------
SYL_AERS4       PGHDQRDHEFATKYGLD-----IKAVIKPADGE---------------------------
SYL_AERHH       PGHDLRDHEFATKYGLE-----IKPVIKPVDGE---------------------------
SYL_MARHV       PGHDERDHEFAVKYKLP-----IKQVIAPNDSR---------------------------
SYL_HAHCH       PGHDERDHEFALKYGLP-----IKQVISVIDAD---------------------------
SYL_SACD2       PAHDQRDWEFAKKYDLE-----IKQVIAPEDGS---------------------------
SYL_MARMS       PAHDQRDFEFAKKYNLA-----IKQVVQPAGDE---------------------------
SYL_ALCBS       PAHDQRDFEFAQKYGLP-----INQVIEPANGE---------------------------
SYL_PSEAB       PGHDERDFEFANKYGLP-----IRQVIAK-------------------------------
SYL_PSEAE       PGHDERDFEFANKYGLP-----IRQVIAK-------------------------------
SYL_PSEA7       PGHDERDFEFANKYGLP-----IRQVIAR-------------------------------
SYL_PSEU5       PAHDERDFEFASKYGLP-----IKPVVRT-------------------------------
SYL_PSEMY       PAHDERDFEFANKYDLP-----IKQVYTG-------------------------------
SYL_PSEP1       PAHDERDFEFAHKYNLP-----VKAVVRT-------------------------------
SYL_PSEPK       PAHDERDFEFAHKYNLP-----VKAVVRT-------------------------------
SYL_PSEPG       PAHDERDFEFAHKYNLP-----VKAVVRT-------------------------------
SYL_PSEE4       PAHDERDFEFAHKYNLP-----VKAVVRT-------------------------------
SYL_PSEU2       PAHDERDFEFATQYGLP-----IKPVVRT-------------------------------
SYL_PSE14       PAHDERDFEFATHYGLP-----IKPVVRT-------------------------------
SYL_PSESM       PAHDERDFEFASKYDLP-----IKPVVRT-------------------------------
SYL_NEIMB       PAHDERDFEFATKYNLP-----KKQVIA--------------------------------
SYL_NEIMF       PAHDERDFEFAAKYNLP-----KKQVIA--------------------------------
SYL_NEIG1       PAHDERDFEFAAKYNLP-----KKQVIA--------------------------------
SYL_NEIM0       PAHDERDFEFATKYSLP-----KKQVIA--------------------------------
SYL_NEIMA       PAHDERDFEFAAKYSLP-----KKQVLQRVTIGLSPEQEEAMGFGGGSGCGAGYGDGSGS
SYL_CHRVO       PAHDERDFEFANKYQLP-----IKQVIALA------------------------------
SYL_THIDA       PAHDERDFGFAKKYDLP-----IKQVIGV-------------------------------
SYL_DECAR       PAHDERDFAFALKYNLP-----IKQVVAV-------------------------------
SYL_AZOSB       PAHDERDFAFATKYKLP-----IKMVVRS-------------------------------
SYL_CUPMC       PAHDERDFAFALKYNLP-----IKQVIDV-------------------------------
SYL_CUPPJ       PAHDERDFAFANKYKLP-----IRQVIDV-------------------------------
SYL_RALSO       PAHDERDFAFANKYGLA-----IKQVIDV-------------------------------
SYL_JANMA       PAHDERDFAFAQKYVLP-----IHPVIDV-------------------------------
SYL_HERAR       PAHDERDFAFAQKYVLP-----IHQVIDV-------------------------------
SYL_BURCH       PGHDERDFAFAKKYDLP-----IRQVIAS-------------------------------
SYL_BURCA       PGHDERDFAFAKKYDLP-----IRQVIAS-------------------------------
SYL_BURL3       PGHDERDFAFAKKYDLP-----IKQVISA-------------------------------
SYL_BURCM       PGHDERDFAFAKKYGLP-----IKQVIAS-------------------------------
SYL_BURVG       PGHDERDFAFAKKYGLP-----IKQVIAA-------------------------------
SYL_BURP0       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURPS       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURP6       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURP1       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURM7       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURM9       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURMA       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURMS       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_BURTA       PAHDERDFAFAKKYGLP-----IRQVIAV-------------------------------
SYL_PARXL       PAHDERDFAFVKKYGLP-----VRQVVAV-------------------------------
SYL_POLAQ       PAHDERDFAFALKYELP-----IKQVIAL-------------------------------
SYL_BORBR       PAHDERDFAFARKYGLP-----IRQVVAL-------------------------------
SYL_BORPA       PAHDERDFAFARKYGLP-----IRQVVAL-------------------------------
SYL_BORPE       PAHDERDFAFARKYGLP-----IRQVVAL-------------------------------
SYL_BORPD       PAHDERDFAFAKKYQLP-----IRQVVAH-------------------------------
SYL_BORA1       PAHDERDFAFARKYGLT-----IRQVIAQ-------------------------------
SYL_METPP       PAHDERDFAFAKKYGID-----ILQVVHV-------------------------------
SYL_ACISJ       PAHDERDFAFALKYQLP-----IKQVVLV-------------------------------
SYL_ACIAC       PAHDERDFAFALKYGIE-----IKQVVLV-------------------------------
SYL_RHOFT       PAHDERDFAFAKKYGLP-----IKQVVQV-------------------------------
SYL_VEREI       PAHDERDFAFALKYGIE-----IRQVVLV-------------------------------
SYL_POLNA       PAHDERDFEFAKKYGLP-----IKQVTDV-------------------------------
SYL_POLSJ       PAHDERDFEFAKKYGLP-----IKQVTDV-------------------------------
SYL_METCA       PAHDERDFEFANKYGLP-----IKTVIVS-------------------------------
SYL_DICNV       PAHDERDFHFAHQYGLP-----IVQVIQT-------------------------------
SYL_PSYCK       PAHDERDYEFATKYNLP-----IKQVIDIPAG----------------------------
SYL_PSYA2       PAHDERDYEFATKYSLP-----IKQVIDIPAR----------------------------
SYL_PSYWF       PAHDERDFEFANKYNLP-----IKTVIKTPE-----------------------------
SYL_ACIAD       PAHDERDFEFANKFNLP-----IKQVIDAKAA----------------------------
SYL_NITEU       PAHDERDFDFARQHSLP-----IKPVIRP-------------------------------
SYL_NITEC       PAHDERDFDFARQYALP-----IRPVIKP-------------------------------
SYL_NITMU       PAHDERDFEFATQYSLP-----IRAVIKP-------------------------------
SYL_METFK       PAHDERDFEFASKYKLP-----IKAVIKP-------------------------------
SYL_HYDCU       PAHDQRDYEFAKAYDLP-----IKAVIAP-------------------------------
SYL_XYLFA       PGHDQRDQEFANKYGLP-----IRQVIALKEPK---------------------------
SYL_XYLFT       PGHDQRDQEFANKYGLP-----IRQVIALKEPK---------------------------
SYL_XANC8       PGHDQRDFEFANKYGLP-----IVQVVKLREPR---------------------------
SYL_XANCP       PGHDQRDFEFANKYGLP-----IVQVVKLREPR---------------------------
SYL_XANCB       PGHDQRDFEFANKYGLP-----IVQVVKLREPR---------------------------
SYL_XANC5       PGHDQRDFEFANKYGLP-----IVQVVKLREPR---------------------------
SYL_XANAC       PGHDQRDFEFANKYGLP-----IVQVVKLREPR---------------------------
SYL_XANOR       PGHDQRDFEFANKYGLP-----IVQVVKLREPR---------------------------
SYL_XANOM       PGHDQRDFEFANKYGLP-----IVQVVKLREPR---------------------------
SYL_NITOC       PAHDQRDYEFAKVYGLP-----IQQVIAPKD-----------------------------
SYL_ALKEH       PAHDQRDWEFASKYGLD-----IRPVVHPSA-----------------------------
SYL_HALHL       PAHDQRDWEFASTYGLP-----IRPVVHPAD-----------------------------
SYL_CHRSD       PAHDQRDWEFATKYGIP-----IEPVIADAE-----------------------------
SYL_BUCAI       PGHNENDWNFAVKNNLK-----IKYVIFN-------------------------------
SYL_BUCAP       PGHNQNDWNFSIKHNLK-----IKYVIKN-------------------------------
SYL_BUCCC       PCSNKIDYNFSKLYNIP-----FIKIFSK-------------------------------
SYL_BUCBP       PAHNQHDLNFAIKYNLK-----IKAVILN-------------------------------
SYL_WIGBR       PAYNKNELDFAKKYNLP-----IRYVIKD-------------------------------
SYL_BLOPB       PAHNQQDWEFAYKYNLP-----IKPVIKN-------------------------------
SYL_BLOFL       PAHDQHDWEFAHQYDLP-----IKPVIKY-------------------------------
SYL_BAUCH       PGHDQRDWDFARQYNLP-----VKNIIRN-------------------------------
SYL_COXBU       PAHDERDHEFALKYDLP-----LKPVIEPADG----------------------------
SYL_COXBR       PAHDERDHEFALKYDLP-----LKPVIEPADG----------------------------
SYL_COXBN       PAHDERDHEFALKYDLP-----LKPVIEPADG----------------------------
SYL_LEGPH       PAHDQRDWEFAQKYQLP-----VKQVIKPID-----------------------------
SYL_LEGPC       PAHDQRDWEFAQKYQLP-----VKQVIKPID-----------------------------
SYL_LEGPA       PAHDQRDWEFAQKYQLP-----VKQVIKPID-----------------------------
SYL_LEGPL       PAHDQRDWEFAQKYQLP-----VKQVIKPIG-----------------------------
SYL_FRATT       PAHDQRDWEFAQKYNIP-----LKQVIESNDNK---------------------------
SYL_FRAT1       PAHDQRDWEFAQKYNIP-----LKQVIESNDNK---------------------------
SYL_FRATW       PAHDQRDWEFAQKYNIP-----LKQVIESNDNK---------------------------
SYL_FRATF       PAHDQRDWEFAQKYNIP-----LKQVIESNDNK---------------------------
SYL_FRATH       PAHDQRDWEFAQKYNIP-----LKQVIESNDNK---------------------------
SYL_FRATO       PAHDQRDWEFAQKYNIP-----LKQVIESNDNK---------------------------
SYL_FRATN       PAHDQRDWEFAQKYNIP-----LKQVIESNDKK---------------------------
SYL_FRAP2       PAHDQRDWEFAQKYNIA-----LKQVIKPSDNK---------------------------
SYL_RUTMC       PAHDKRDYEFAKKYGIA-----IKKVINENI-----------------------------
SYL_VESOH       PAHDKRDFKFAKKYGIF-----IKQVINKNE-----------------------------
SYL_RICRS       PAHDECDHELAVKMNLS-----IKQVI---------------------------------
SYL_RICRO       PAHDECDHELAVKMNLS-----IKQVI---------------------------------
SYL_RICCN       PAHDECDHELAVKMNLS-----IKQVI---------------------------------
SYL_RICM5       PANDERDHELAVKMNLS-----IKQVI---------------------------------
SYL_RICFE       PAHDERDHELAVKMNLP-----IKQVI---------------------------------
SYL_RICAH       PAHDERDHELAVKMNLT-----IKKVI---------------------------------
SYL_RICCK       PAHDERDHELAVKMNLP-----IKQVI---------------------------------
SYL_RICBR       PAHDQRDHELAVKINLP-----IKQVI---------------------------------
SYL_RICPR       PAHDKRDHELAIKMNLP-----IKQVI---------------------------------
SYL_RICTY       PAHDKRDHELAMKMNLP-----IKKVI---------------------------------
SYL_ORITB       PAHDERDHEIAKLLKLN-----IKQVITST------------------------------
SYL_WOLPM       PAHDQRDFEFAQKYNLP-----IIPVISSAHLGVIPARDQNSYNGS--------------
SYL_WOLTR       PAHDQRDFEFAQEYDLP-----IIPVISSARLGIIPACDQGSYTGS--------------
SYL_EHRRW       PAHDQRDFDFAKKYSLP-----IRQV-------IFPEQN---------------------
SYL_EHRRG       PAHDQRDFDFAKKYSLP-----IRQV-------IFPEQN---------------------
SYL_EHRCJ       PAHDQRDFEFAKKYNLQ-----IKQV-------VFPEID---------------------
SYL_EHRCR       PAHDQRDFEFAKKYSLP-----VKQV-------VFPEVD---------------------
SYL_ANAMM       PAHDQRDFEFAVAHGLD-----IYQV-------VFPDDG---------------------
SYL_NEOSM       PAHDTRDFAFAQQYNLP-----CLRV-------ISAKC----------------------
SYL2_RHIL3      PSGDQRDLDFARKYGLP-----VVAVVMPR----DGD-----------------------
SYL_RHIEC       PSGDQRDLDFARKYGLP-----VVPVVMPT----DGD-----------------------
SYL_RHIME       PSGDQRDLDFARKYDLP-----VVPVVMPK----DAD-----------------------
SYL_SINMW       PSGDQRDLDFARKYGLP-----VVPVVMPK----DAD-----------------------
SYL_AGRFC       PSGDQRDLDFARKYGLP-----VVAVVAPE----GPD-----------------------
SYL_BRUAB       PAHDQRDLDFANKYKLK-----VTPVVLPK----GED-----------------------
SYL_BRUA2       PAHDQRDLDFANKYKLK-----VTPVVLPK----GED-----------------------
SYL_BRUSI       PAHDQRDLDFANKYKLK-----VTPVVLPK----GED-----------------------
SYL_BRUO2       PAHDQRDLDFANKYKLK-----VTPVVLPK----GED-----------------------
SYL_BRUME       PAHDQRDLDFANKYKLK-----VTPVVLPK----GED-----------------------
SYL_BRUSU       PAHDQRDLDFANKYKLK-----VTPVVLPK----GED-----------------------
SYL_BRUC2       PAHDQRDLDFANKYKLK-----VTPVVLPK----GED-----------------------
SYL_OCHA4       PAHDQRDLDFANKYKLK-----VTPVVMPK----GED-----------------------
SYL_CHESB       PSGDQRDFDFANKYGLP-----VIPVVMPE----GAD-----------------------
SYL_RHILO       PSGDQRDLDFANKYGLP-----VIPVVMPE----GGD-----------------------
SYL_BART1       PAHDQRDFDFARKYDLP-----IKPVVLPR----ETK-----------------------
SYL_BARHE       PAHDQRDFDFARKYDLP-----VQPVVLPS----GVE-----------------------
SYL_BARQU       PAHDQRDWDFAHKYDLP-----VQPVVLPK----GSD-----------------------
SYL_BARBK       PAHDQRDLDFARKYDLP-----VQIVVAPK----EAE-----------------------
SYL_RHOP2       PAHDQRDLDFVNKYQLG-----NTPVVCPE----GQD-----------------------
SYL_RHOPS       PAHDQRDLDFVNKYQLG-----NTPVVCPE----GQD-----------------------
SYL_RHOPA       PAHDQRDLDFVNKYQLG-----NTPVVCPE----GQD-----------------------
SYL_RHOP5       PAHDQRDLDFVNKYDLG-----NTPVVCPE----GQD-----------------------
SYL_NITHX       PAHDQRDLDFVNKYGLG-----NTPVVCPE----GQD-----------------------
SYL_NITWN       PAHDQRDLDFVNKYGLG-----NTPVVCPE----GQD-----------------------
SYL_BRASB       PAHDQRDLDFVNKYGLG-----NTPVVCPE----GQD-----------------------
SYL_BRASO       PAHDQRDLDFVNKYGLG-----NTPVVCPE----GQD-----------------------
SYL_BRADU       PAHDQRDLDFVNKYNLG-----NTPVVCPE----GQD-----------------------
SYL_RHOPB       PAHDQRDLDFVNKYGLG-----NLPVVCPE----GQD-----------------------
SYL_AZOC5       PAHDQRDLDFARKYGLT-----VTPVVLPP----GAD-----------------------
SYL_PARL1       PAHDQRDLDFARKYNLP-----VIPVVAPK----DKQGAELDAF----------------
SYL_CAUVC       PAHDQRDLDFARKYDLP-----VLPVVLPN----GED-----------------------
SYL_CAUSK       PAHDQRDLDFARKYDLP-----VLPVVLPP----GED-----------------------
SYL_MARMM       PAGDQRDLDFARKYDLA-----VQPVVLPP----EAS-----------------------
SYL_HYPNA       PAHDQRDLDFARKFGLD-----VFPVVLPP----GAD-----------------------
SYL_RUEST       PAHDQRDFEFATKYNLP-----IIPVLEPV---EGA------------------------
SYL_RUEPO       PAHDQRDLDFCRKYDLP-----VIDTFVAL---DDP------------------------
SYL_ROSDO       PAHDQRDFEFATKYDLP-----IISTFLPS---QDAD-----------------------
SYL_JANSC       PAHDERDLDFARKYDLP-----VVSTYVPI---DDEG-----------------------
SYL_DINSH       PAHDQRDLDFCRKYDLP-----VIDTFFAL---DDP------------------------
SYL_RHOS1       PAHDQRDFEFATKYGLP-----IRPVFLP-------E-----------------------
SYL_RHOS4       PAHDQRDFEFATKYGLP-----IRPVFLP-------E-----------------------
SYL_RHOS5       PAHDQRDFEFASKYGLP-----IPPVFVA-------E-----------------------
SYL_PARDP       PAHDERDHEFATKYGLP-----IRATFGERG--MDLE-----------------------
SYL_ZYMMO       PAHDQRDLDFALKYNLP-----VKRVVAPSE--AESN-----------------------
SYL_SPHWW       PAHDQRDLDFARKYALP-----VKRVVAPSP--EEAA-----------------------
SYL_NOVAD       PGHDQRDFDFATKYALP-----ILRVVAADA--ADAD-----------------------
SYL_SPHAL       PAHDQRDLDFAHKYELP-----VHRVIADGD--ETAQ-----------------------
SYL_GRABC       PAHDQRDLDFARKYDLS-----VTPVVLPSD--QDAAS----------------------
SYL_GLUOX       PCGDQRDLDFARKYDLP-----VPQVLLPPG--QDAET----------------------
SYL_ACICJ       PAHDQRDLDFARKYGLD-----VTVVVAP----KDDPG----------------------
SYL_MAGSA       PAHDQRDLDFANKYGLG-----WTQVVEPAS--DGQAV----------------------
SYL_RHORT       PAHDQRDMDFARKYGLP-----VRAVVAPAG--VDAEA----------------------
SYL_MAGMM       PAHDQRDFEFAKKHGIE-----IKVVIQPEG-----------------------------
SYL_CAMJ8       PAHDERDFEFATKYNLA-----IKQVIQT-------------------------------
SYL_CAMJJ       PAHDERDFEFATKYNLA-----IKQVIQT-------------------------------
SYL_CAMJR       PAHDERDFEFATKYNLA-----IKQVIQT-------------------------------
SYL_CAMJE       PAHDERDFEFATKYNLA-----IKQVIQT-------------------------------
SYL_CAMJD       PAHDERDFEFAKKYNLA-----IKQVIQT-------------------------------
SYL_CAMC1       PAHDQRDFEFASKFNLP-----IKPVVKPLE-----------------------------
SYL_CAMC5       PAHDQRDYEFASKFGLP-----IKQVVMPKE-----------------------------
SYL_CAMFF       PAHDERDFEFASKFNLN-----IKQIIK--------------------------------
SYL_CAMHC       PAHDERDFEFAHKFNLP-----IIQSIGAKN-----------------------------
SYL_ARCB4       PAHDQRDFEFAKKYNLP-----IKQVIVGPDG----------------------------
SYL_NITSB       PAHDERDFEFAHKYNLP-----IKYIIKPKE-----------------------------
SYL_WOLSU       PAHDERDFEFAKKYQLP-----QKQVI---LS----------------------------
SYL_HELHP       PMHDERDFEFAKTYALP-----FKCVLTKEID----------------------------
SYL_HELPY       PACDERDFEFANLYHIP-----IKVITQS-------------------------------
SYL_HELPH       PACDERDFEFANLYHIP-----IKVITQS-------------------------------
SYL_HELPJ       PACDERDFEFANLYHIP-----IKVITQS-------------------------------
SYL_HELAH       PACDERDFEFANLYHIP-----IKVITQS-------------------------------
SYL_THEMA       PAHDQRDFSFAKKYGIP-----IKVVIKPADK----------------------------
SYL_THEP1       PAHDQRDFSFAKKYGIP-----IKVVIKPADR----------------------------
SYL_THEM4       PAHDQRDFDFAKKYGIS-----IRVVIDNPEE----------------------------
SYL_FERNB       PAHDQRDYDFAKTYNLP-----IKQVIKPKDG----------------------------
SYL_PSELT       PAHDQRDYEFAVKYNLP-----IKEVIKPSE-----------------------------
SYL_CALS8       PAHDQRDFEFAKKYNLP-----IKVVIKGDG-----------------------------
SYL_HUNT2       PAHDQRDFEFAKKYNLP-----IKVVIQPEGQ----------------------------
SYL_DESHY       PAHDERDFEFAGKYKLP-----IKTVILPEGT----------------------------
SYL_SYNWW       PAHDQRDFEFARKYDIP-----VKVVIKGEDT----------------------------
SYL_CARHZ       PAHDQRDFLFAKKYNLP-----IKVVITPP------------------------------
SYL_PELTS       PAHDQRDFEFARKYGYP-----IRVVIQPP------------------------------
SYL_MOOTA       PAHDQRDFEFARKYDLP-----VKVVIRPA------------------------------
SYL_DESRM       PAHDERDFEFAHKYNLP-----IKVVIYPAQ-----------------------------
SYL_SYMTH       PAHDQRDFEFAQKYGLP-----VKVVIQNP------------------------------
SYL_DESVH       PAHDQRDFEFARKYDLP-----MQVVIQPQG-----------------------------
SYL_DESVV       PAHDQRDFEFARKYDLP-----MQVVIQPQG-----------------------------
SYL_DESAG       PAHDERDFEFARKYDLP-----MEVVIQPEG-----------------------------
SYL_LAWIP       PAHDQRDFDFCKKYNLP-----ISIVIQPDE-----------------------------
SYL_GEOMG       PTHDQRDFEFARKYDLP-----LQVVIQPEGE----------------------------
SYL_GEOSL       PTHDQRDFEFARTYDLP-----LQVVIQPEGE----------------------------
SYL_GEOUR       PTHDQRDFEFARKYDIP-----MGVVIQPEGE----------------------------
SYL_PELPD       PTHDQRDFEFAKKYGLD-----LKVVIQPEGT----------------------------
SYL_PELCD       PTHDQRDFDFARKYDIP-----MIVVIQPEDQ----------------------------
SYL_SYNAS       PTHDQRDFEFAEKFGLR-----KVVVISPPDK----------------------------
SYL_SYNFM       PAHDQRDFEFARKYGLP-----VKVVIKPADA----------------------------
SYL_DESPS       PAHDQRDFEFAGKYKLP-----IIPVVVPEGE----------------------------
SYL_FUSNN       PAHDERDFVFAGKYNLP-----VKQVITSKK-----------------------------
SYL_TRIV2       PAHDVRDFKFAQRYDLP-----IDFVIAAPDDVAGFDLSPTS-----------------E
SYL_NOSS1       PAHDVRDFKFAQRYDLP-----IDFVIAAPDDVAGFDLSPTS-----------------E
SYL_ACAM1       PAHDTRDFVFAQQNKLP-----IQTVIVPEGGDA--------------------------
SYL_TRIEI       PAHDVRDFQFAKQYNLP-----IKTVIVPDDSND--------------------------
SYL_SYNY3       PAHDQRDFKFAQDNNLP-----MQVVIIPDDADNS-------------------------
SYL_SYNE7       PAHDSRDFAFAQRYGLP-----VQPVIQPTEGAI--------------------------
SYL_SYNP6       PAHDSRDFAFAQRYGLP-----VQPVIQPTEGAI--------------------------
SYL_THEEB       PAHDERDFQFAKAHRLP-----IRQVIIPPDGKA--------------------------
SYL_SYNJB       PAHDQRDFEFARKFGLP-----IKRVVQPPEGSLS------------------------S
SYL_SYNJA       PAHDQRDFEFARQFGLP-----IKLVVQPPQG----------------------------
SYL_GLOVI       PGHDERDFVFASQYELP-----IRLVVQAPDGSL--------------------------
SYL_SYNS3       PAHDVRDFSFARQHELP-----VQRVIEVSG-TNE-------------------------
SYL_SYNPW       PAHDERDFLFARTYELP-----VKRVIQAAG-TSD-------------------------
SYL_PROMM       PAHDERDFIFARSHELP-----IRIVVQLPD-TDE-------------------------
SYL_PROM3       PAHDERDFIFARSHELP-----IRIVVQMPD-SDE-------------------------
SYL_SYNSC       PAHDQRDIAFAQSNGLP-----IQQVIDAEG-AAE-------------------------
SYL_SYNS9       PAHDQRDIQFAKANALP-----IRQVIDAEG-AKE-------------------------
SYL_SYNPX       PAHDQRDRRFAQSYGLA-----VQQVIEAEG-AAA-------------------------
SYL_SYNR3       PAHDSRDFAFAKQYDLP-----ITTVVVEPGQAPD-------------------------
SYL_PROMT       PAHDSRDYQFAKSYDLP-----IQYVIK-PNID---------------------------
SYL_PROM1       PAHDSRDYQFAKSYDLP-----IQYVIK-PNIG---------------------------
SYL_PROMA       PAHDKRDYKFAKKYSLP-----IQYVIKSPSQE---------------------------
SYL_PROM0       PAHDLRDFEFAKKNNID-----IKQVIIKDKS----------------------------
SYL_PROM9       PAHDLRDFEFAKKNNID-----IKHVIIKDKS----------------------------
SYL_PROMS       PAHDLRDFEFAKKNNID-----IKQVIVKDKS----------------------------
SYL_PROM2       PAHDQRDFEFAKKNNID-----IKQVIINDKS----------------------------
SYL_PROMP       PAHDERDFEFAKINSID-----IKQVIIKEKD----------------------------
SYL_PROM5       PAHDQRDFEFAKINFID-----IKQVIIKDKDND--------------------------
SYL_SOLUE       PAHDERDFEFCTKYGIP-----ITPVIRPVDQ----------------------------
SYL_DEIRA       PAHDERDFAFAKKFDLP-----IREVIRAEGSEGMG------------------------
SYL_DEIGD       PAHDERDFDFARKFGLE-----IREVIRPEGGEPL-------------------------
SYL_RUBXD       PAHDERDFEFAKKHGIE-----IRTVIAPPDWDGS-------------------------
SYL_CLOPE       PAHDERDFAFAEKFNLP-----INRVIEAKDGSET-------------------------
SYL_CLOPS       PAHDERDFAFAEKFNLP-----INRVIEAKDGSET-------------------------
SYL_CLOP1       PAHDERDFAFAEKFNLP-----INRVIEAKDGSET-------------------------
SYL_CLOB8       PAHDERDFAFATKFNLP-----IERVITDKENTNP-------------------------
SYL_CLOB1       PAHDERDFAFATKYNLP-----IERVIEGGD-----------------------------
SYL_CLOBH       PAHDERDFAFATKYNLP-----IERVIEGGD-----------------------------
SYL_CLOBL       PAHDERDFAFATKYNLP-----IERVIEGGD-----------------------------
SYL_CLONN       PAHDERDYAFATKYDLP-----IVRVIEGGD-----------------------------
SYL_CLOAB       PSHDERDFAFATKYDLP-----IVRVVEGGE-----------------------------
SYL_CLOK5       PAHDERDFEFATKYKLP-----IERVIEGGS-----------------------------
SYL_CLOTE       PAHDERDFEFAKKHNLP-----IEKVIEGGE-----------------------------
SYL_CALS4       PGHDERDYEFATKYNLP-----IKRVIKGVGDVDD-------------------------
SYL_ROSCS       PAHDERDFAFARQFGLP-----VRVVVQPPGETLDG------------------------
SYL_ROSS1       PAHDQRDFEFARQFGLP-----VRVVVQPPGETLDG------------------------
SYL_THEFY       PAHDQRDLDFARKFNLP-----VRVVVDTGEP----------------------------
SYL_ACIC1       PAHDQRDLDFALTYGLP-----VRVVVDTGEG----------------------------
SYL_ARTS2       PAHDQRDLDFARTFDLP-----VRAVLDTGED----------------------------
SYL_PAEAT       PAHDQRDLDFAKTFGLP-----VRAVLDTGDE----------------------------
SYL_RENSM       PAHDQRDLDFARAFDLP-----VRQVLDTGAE----------------------------
SYL_CLAMS       PAHDQRDLDFARAFDLP-----VRVVVDTTQPVTGAIRIIPEDGE--------------L
SYL_CLAM3       PAHDQRDLDFARAFDLP-----VRVVVDTTQPVTGAIRIIPEDGE--------------L
SYL_LEIXX       PAHDQRDLDFARAFDLP-----VRVVVDTTQPATGAVPVIKTDPQTGEPL---------L
SYL_KINRD       PAHDQRDLDFARAFGLP-----VRVVVDVRD----------DDGN---------------
SYL_NOCSJ       PGGDQRDWEFATEMGLD-----IVRTTQTPEG----------------------------
SYL_TROW8       PGHDTRDERFAVRYNLP-----IVKIMEDNR-----------------------------
SYL_TROWT       PGHDTRDERFAVRYNLP-----IVKIMEDNR-----------------------------
SYL_MYCPA       PGHDQRDWDFAHEFGLP-----IVEVIA--------------------------------
SYL_MYCA1       PGHDQRDWDFAHEFGLP-----IVEVIA--------------------------------
SYL_MYCLE       PGHDPRDWDFAHKFHLP-----IVEVIA--------------------------------
SYL_MYCTA       PGHDQRDWDFARAFGLP-----IVEVIA--------------------------------
SYL_MYCBO       PGHDQRDWDFARAFGLP-----IVEVIA--------------------------------
SYL_MYCTU       PGHDQRDWDFARAFGLP-----IVEVIA--------------------------------
SYL_MYCBP       PGHDQRDWDFARAFGLP-----IVEVIA--------------------------------
SYL_MYCUA       PGHDQRDWDFARALGLP-----VVEVIA--------------------------------
SYL_MYCSS       PGHDQRDWEFAHEFGLP-----VVEVIS--------------------------------
SYL_MYCSK       PGHDQRDWEFAHEFGLP-----VVEVIS--------------------------------
SYL_MYCSJ       PGHDQRDWEFAHEFGLP-----VVEVIS--------------------------------
SYL_MYCS2       PGGDQRDWDFAKEFGLP-----IIEVVT--------------------------------
SYL_MYCVP       PGGDQRDWDFATEFGLP-----IIEVVRPVADR---------------------------
SYL_MYCGI       PSGDQRDWDFATEFGLP-----IVEVV---------------------------------
SYL_NOCFA       PGHDQRDWEFATAFGLP-----IVEVIS--------------------------------
SYL_RHOJR       PGHDHRDYEFATEFGLD-----IVEVIS--------------------------------
SYL_SACEN       PGEDQRDFDFAEAFGLP-----VVRTVQ--------------------------------
SYL_CORGB       PAHDERDYEFATVLGLP-----IKEVVA--------------------------------
SYL_CORGL       PAHDERDYEFATVLGLP-----IKEVVA--------------------------------
SYL_COREF       PAHDDRDYEFATVFGLP-----IVEVVA--------------------------------
SYL_CORDI       PAHDTRDYEFATEFGLP-----IREVVA--------------------------------
SYL_CORJK       PAHDSRDFEFATEFGLP-----IVPVLAPEGAE---------------------------
SYL_STRCO       PAHDSRDFEFARAFELP-----VRCVVEP-------------------------------
SYL_STRAW       PAHDTRDFAFARAFELS-----MRCVVEP-------------------------------
SYL_SALAI       PGQDERDWAFAEVFDLP-----IVRTVRP-------------------------------
SYL_BIFAA       PGGDQRDYDFAVKFGLP-----VIYTVKPLP-----------------------------
SYL_BIFLO       PGGDQRDYDFAVKFGLP-----VIYTVTPLP-----------------------------
SYL_FRACC       PAHDSRDFSFARAFDLP-----IPAVLEP-------------------------------
SYL_FRAAA       PAHDSRDFSFARAFDLP-----IPAVLAP-------------------------------
                   :  :  :                                                  

SYL_GEOKA       ---------DIEKEPYTGDGEHINSEF---------------LNGLNKQEAID-------
SYL_GEOTN       ---------NVENEPYTGDGEHINSEF---------------LNGLNKQEAIE-------
SYL_BACCZ       ---------DITKEAYTGDGAHVNSAF---------------LDGLNKEEAIA-------
SYL_BACAH       ---------DITKEAYTGDGAHVNSAF---------------LDGLNKEEAIA-------
SYL_BACAN       ---------DITKEAYTGDGAHVNSAF---------------LDGLNKEEAIA-------
SYL_BACHK       ---------DITKEAYTGDGAHVNSAF---------------LDGLNKEEAIA-------
SYL_BACC1       ---------DITKEAYTGDGEHVNSAF---------------LDGLNKEEAIA-------
SYL_BACCR       ---------DITKEVYTGDGAHVNSAF---------------LDGLNKEEAIA-------
SYL_BACCN       ---------DITKEAYTADGEHIDSAF---------------LNGLNKEEAIA-------
SYL_BACSU       ---------NVEEAAYTGDGEHVNSDF---------------LNGLHKQEAIE-------
SYL_BACVZ       ---------NTEEEAYTGDGEHVNSGF---------------LNGLKKAEAIE-------
SYL_BACLD       ---------DVEKEAYTGDGEHIHSDF---------------LNGLDKAAAIE-------
SYL_BACP2       ---------DIEEEAYTGDGKHINSDF---------------LDGLGKEEAIE-------
SYL_BACHD       ---------VIEQEAYTGDGPHVNSEF---------------LNGLSKEEAIE-------
SYL_BACSK       ---------DVSKAAYTGDGEHVNSDF---------------LNGLNKQEAVE-------
SYL_OCEIH       ---------NIDDEAYTGDGEHVNSEF---------------LNGLGKEEAIT-------
SYL_STAES       ---------EVQKYAYTGEGKHINSGE---------------LDGLENEAAIS-------
SYL_STAEQ       ---------EVQKYAYTGEGKHINSGE---------------LDGLENEAAIS-------
SYL_STAAW       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAS       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAN       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAA1       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAM       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAA9       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAA2       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAA3       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAC       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAA8       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAT       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAE       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAB       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAAR       ---------NVEEAAYTGEGKHINSGE---------------LDGLENEAAIT-------
SYL_STAHJ       ---------DIQKEAYTGVGEHINSGE---------------LNGLDNETAIS-------
SYL_STAS1       ---------DMSKEAYTGDGPHINSGE---------------LNGLYNEAAIE-------
SYL_LISMF       ---------DVTKEAFTGDGPHINSDF---------------LNGLAKAEAIT-------
SYL_LISMO       ---------DVTKEAFTGDGPHINSDF---------------LNGLAKAEAIT-------
SYL_LISIN       ---------DVTKEAFTGDGPHINSDF---------------LNGLAKAEAIT-------
SYL_LISW6       ---------DVTKEAFTGDGPHINSEF---------------LDGLAKEEAIT-------
SYL_ENTFA       ---------DITTEAYTGDGPHINSDF---------------LNGLNKAEAIA-------
SYL_STRTD       ---------NVEEAAYTEDGPHVNSDF---------------LNGLNKEEAIA-------
SYL_STRT2       ---------NVEEAAYTEDGPHVNSDF---------------LNGLNKEEAIA-------
SYL_STRT1       ---------NVEEAAYTEDGPHVNSDF---------------LNGLNKEEAIA-------
SYL_STRP2       ---------NVEEAAYTEDGLHVNSDF---------------LDGLNKEDAIA-------
SYL_STRR6       ---------NVEEAAYTEDGLHVNSDF---------------LDGLNKEDAIA-------
SYL_STRPN       ---------NVEEAAYTEDGLHVNSDF---------------LDGLNKEDAIA-------
SYL_STRSV       ---------NVAEAAYTEDGPHINSGF---------------LDGLDKAAAID-------
SYL_STRGC       ---------NVADAAYTEDGPHINSGF---------------LDGLDKAAAIE-------
SYL_STRS2       ---------NVEEAPYTEDGAHINSDF---------------LDGLNKEEAIA-------
SYL_STRSY       ---------NVEEAPYTEDGAHINSDF---------------LDGLNKEEAIA-------
SYL_STRPD       ---------NVEEAAFTEDGLHINSGF---------------LDGLDKASAIA-------
SYL_STRPG       ---------NVEEAAFTEDGLHINSGF---------------LDGLDKASAIA-------
SYL_STRP6       ---------NVEEAAFTEDGLHINSGF---------------LDGLDKASAIA-------
SYL_STRPM       ---------NVEEAAFTEDGLHINSDF---------------LDGLDKASAIA-------
SYL_STRPF       ---------NVEEAAFTEDGLHINSDF---------------LDGLDKASAIA-------
SYL_STRPB       ---------NVEEAAFTEDGLHINSDF---------------LDGLDKASAIA-------
SYL_STRPC       ---------NVEEAAFTEDGLHINSDF---------------LDGLDKASAIA-------
SYL_STRP3       ---------NVEEAAFTEDGLHINSGF---------------LDGLDKASAIA-------
SYL_STRP1       ---------NVEEAAFTEDGLHINSGF---------------LDGLDKASAIA-------
SYL_STRP8       ---------NVEEAAFTEDGLHINSGF---------------LDGLDKASAIA-------
SYL_STRA3       ---------NVEEAAFTEDGLHINSDF---------------LDGLDKAAAIA-------
SYL_STRA5       ---------NVEEAAFTEDGLHINSDF---------------LDGLDKAAAIA-------
SYL_STRA1       ---------NVEEAAFTEDGLHINSDF---------------LDGLDKASAIA-------
SYL_STRMU       ---------NVAEAAYTDDGLHINSGF---------------LNGLDKAAAID-------
SYL_LACLM       ---------NVEEAVYTEDGPHINSEF---------------LNGLDKAQAIE-------
SYL_LACLA       ---------NVEEAVYTEDGPHINSEF---------------LNGLDKAQAIE-------
SYL_LACLS       ---------NVEEAVYTEDGPHINSEF---------------LNGLDKAQAIE-------
SYL_LACSS       ---------NPEEAVHTEPGVMINSDF---------------LDGLDKQAAID-------
SYL_LACDA       ---------DISKEAFAGDGVHVNSDF---------------LNGLHNEEAKA-------
SYL_LACDB       ---------DISKEAFAGDGVHVNSDF---------------LNGLHNEEAKA-------
SYL_LACP3       ---------NVDEAAYTGDGVHINSGF---------------LDGLNEHDAID-------
SYL_LACPL       ---------DYDQQAYTGDGEHINSGF---------------VDGLAKQPAID-------
SYL_LACBA       ---------DITEAAYTDDGKHINSDF---------------MNGMDKQTAIS-------
SYL_PEDPA       ---------NLEDGVLDSEGGLINSGF---------------LDGMDKQTAID-------
SYL_LACS1       ---------DVQKEAYTGDGVHINSDF---------------LNGMDKEEAID-------
SYL_LACRD       ---------DISEGAFDGDGKHINSGF---------------LDGLNIADAKQ-------
SYL_LEUMM       ---------NVEEAAYTDDGTHINSGF---------------LDGLNKQEAID-------
SYL_OENOB       ---------DISKEAFTGDGTHINSAF---------------LDVLDKKQAIE-------
SYL_SALRD       ---------DIDEEAYTGDGPHVHSANEA-----------VSLNGLRNEEAKE-------
SYL1_RHIL3      ---------DIEKGAYEGEGAMVNSGF---------------LSGLGSPEARS-------
SYL_RHOBA       ------EEILAGKACFAAEGVAINSGE---------------YDGKTTAEVKA-------
SYL_PELLD       ---------DVQDAVYEGKDSTAVNSS----------NSEISLDGLAFPEAFE-------
SYL_CHLPM       ---------DVQQEVFEGKDSTVVNSS----------NNDISLNGLAFPEAFE-------
SYL_CHLCH       ---------DVQEAVFEEKNSTCVNSA----------NDEISLNGLDFATAFE-------
SYL_CHLTE       ---------DVQERVFDGKESVCVNSA----------NDEISINGLDFKTAFD-------
SYL_CHLPD       ---------GVDDAAFEGKESVSINSS----------NPEISIDGLHFSEAFQ-------
SYL_LEPBL       ---------EITDVAFDSKTSICIHSS----------SSEISIDGLDYSSASS-------
SYL_LEPBJ       ---------EITDVAFDSKTSICIHSS----------SSEISIDGLDYSSASS-------
SYL_LEPIC       ---------EISEAAFDSKTSTCINSS----------SSEISINGLDYTSASS-------
SYL_LEPIN       ---------EISEAAFDSKTSTCINSS----------SSEISINGLDYTSASS-------
SYL_BACTN       ---------DVSEESFDAKEGIVCNSPRPDVTP----YCDLSLNGLTIKEAIE-------
SYL_BACV8       ---------DVSEESFDAKEGIVCNSPRKDVTP----YCDLSLNGLTIKEAIA-------
SYL_BACFR       ---------DVSEESFDAKEGIMMNSPRP-GAP----EGGLVLNGLTVKEAIA-------
SYL_BACFN       ---------DVSEESFDAKEGIMMNSPRP-GAP----EGGLVLNGLTVKEAIA-------
SYL_PARD8       ---------DVSKESFDAKEGIVCNSPRTGVTP----YCDLSLNGLTIKEAIA-------
SYL_PORGI       ----------EGEPATDPATWEDAKDSKSGIMV----NSDF-LNGLSVEDAIA-------
SYL_FLAPJ       ---------DIATEAYGSKDNVIIA-------------NSDFLNGLNYKQATK-------
SYL_FLAJ1       ---------DISEAAYGSKDNVEIA-------------ASDFLNGLNYKDATA-------
SYL_GRAFK       ---------DVSQEAYAGKEGTVIA-------------NSDFLSGLEYKEALN-------
SYL_CYTH3       ---------DITKEDFDPKAGTMI--------------NSGFLNGLTVKQAIP-------
SYL_BDEBA       ---------MLPFE----GDSIMIN--------------SEFLDGLNKTEAIS-------
SYL_SORC5       ------SLHDQLEAAYVDPGVAVRSGE---------------FDGLATEECKR-------
SYL_TREDE       -----FSE--EPKACTTEDGYSVNSK---------------QFDGLKTEEAKT-------
SYL_TREPA       -----SPQGAVLQRCVSDEGFVVNSG---------------AFNGLASADARE-------
SYL_BORAP       -----SGKNEILEKAFINDGISINSPDE--------------FNNLKNSEVKD-------
SYL_BORBP       -----SGKNEILEKAFIDDGISINSPNE--------------FNNLKNSEVKD-------
SYL_BORBU       -----SGKNEILEKAFVDDGISINSPNE--------------FNNLKNSEVKD-------
SYL_CHLTR       ------------------EGVCINSCCEG-----------FHLDGLSGEEAKQ-------
SYL_CHLTA       ------------------EGVCINSCCEG-----------FHLDGLSGEEAKQ-------
SYL_CHLMU       ------------------DGVCINSCHED-----------FSLDGLSGEEAKQ-------
SYL_CHLFF       ------------------DGYCIHSNHGD-----------FLLDGLWGREAQD-------
SYL_CHLCV       ------------------DECCIHSNHGD-----------FLLDGLAGQEARD-------
SYL_CHLAB       ------------------NEHCINSNHGD-----------FLLNGLQGKEASD-------
SYL_CHLPN       ------------------NGVCIHSNYND-----------FCLNGLSGQEAKD-------
SYL_PARUW       -----RNQVLAGQQCWPGHGICVNSACGD-----------LSLNGLNLDQAKK-------
SYL_ALKOO       ------GNVDEAAYTDTEEGIIVNSDF---------------INGMQVKEAKE-------
SYL_UREP2       ------------KLPYAGDGLHINSAM---------------INGLNIKQSQN-------
SYL_UREPA       ------------KLPYAGDGLHINSAM---------------INGLNIKQSQN-------
SYL_MYCPU       -----------VELPYLESGHLINSSE---------------FNGLSSKEAIE-------
SYL_MYCPE       -------------APYEEDGIHINSDF---------------LNGLNNEDAIA-------
SYL_MYCGA       -------------YPYLLDGEHINSEF---------------NNGLNNEQAIQ-------
SYL_MYCGE       --------------------RLQNSFA---------------YNGLTTKEAQV-------
SYL_MYCPN       --------------------RLQHSGQ---------------FSGLNSQTANT-------
SYL_MYCCT       -----------ESKAFVGEGKHINSEF---------------LNDLDRIQSLQ-------
SYL_MYCMS       -----------QSKAFVGEGIHINSEF---------------LNDLDRIQALQ-------
SYL_MESFL       -----------DEKAFVGEGKIINSDI---------------LNGMDKKQAIQ-------
SYL_ACHLI       -----------EG-AYTGDGIHHHSGI---------------IDGLYNEEAIE-------
SYL_PSEA6       -------ECDLTTAAYTDKGV-------LVNSA--------EFNGLAFQEAFD-------
SYL_COLP3       ---------DINKAAITEKST-------LINSG--------EFDGLDFEEAFK-------
SYL_IDILO       ---------DIEKAAITEKGT-------VINSG--------PYNGMSSAQAFD-------
SYL_PSEHT       -------EVNLNKEAFTDKGV-------LVNSG--------EFDGLDFDAAFN-------
SYL_PSYIN       ---------DISVEAYTEKGV-------CFDSG--------EFDGLDFSAAFD-------
SYL_SALCH       --------PDLSEQALTEKGV-------LFNSG--------EFDGLAFEAAFN-------
SYL_SALTI       --------PDLSEQALTEKGV-------LFNSG--------EFDGLAFEAAFN-------
SYL_SALTY       --------PDLSEQALTEKGV-------LFNSG--------EFDGLAFEAAFN-------
SYL_SALPB       --------PDLSEQALTEKGV-------LFNSG--------EFDGLAFEAAFN-------
SYL_SALPA       --------PDLSEQALTEKGV-------LFNSG--------EFDGLAFEAAFN-------
SYL_CITK8       --------PDLSEQALTEKGV-------LFNSG--------EFNGLGFEDAFN-------
SYL_SALAR       --------PDLSTQALTEKGV-------LFNSG--------EFDGLAFEAAFN-------
SYL_SHIFL       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_SHIF8       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_SHIBS       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECOL6       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECOL5       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECO57       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_SHISS       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECOLI       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECOLC       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_SHIDS       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECOHS       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECOUT       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECOK1       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_ECO24       --------PDLSQQALTEKGV-------LFNSG--------EFNGLDHEAAFN-------
SYL_KLEP7       --------PDLSEQALTEKGV-------LFNSG--------EFSGLDYEAGFN-------
SYL_CROS8       --------PDLSEQALTEKGV-------LFNSG--------EFDGLDFEAAFN-------
SYL_ENT38       SEFLGLLTAELNKPYLEKDGE-------TYNSG--------KFDGLSFEAAFN-------
SYL_YERPA       --------PDLSQEAMTEKGT-------LFNSG--------EFDGLNHEDGFN-------
SYL_YERP3       --------PDLSQEAMTEKGT-------LFNSG--------EFDGLNHEDGFN-------
SYL_YERPE       --------PDLSQEAMTEKGT-------LFNSG--------EFDGLNHEDGFN-------
SYL_YERPN       --------PDLSQEAMTEKGT-------LFNSG--------EFDGLNHEDGFN-------
SYL_YERPS       --------PDLSQEAMTEKGT-------LFNSG--------EFDGLNHEDGFN-------
SYL_YERPP       --------PDLSQEAMTEKGT-------LFNSG--------EFDGLNHEDGFN-------
SYL_YERE8       --------PDLSQEAMTEKGI-------LFNSG--------EFDGLNYEDGFN-------
SYL_SERP5       --------PDVQAEAMTEKGT-------LFNSG--------EFDGLDHQDGFN-------
SYL_PECAS       --------PDLSAQAMTEKGS-------LFNSG--------EFDGLDFEAGFN-------
SYL_SODGM       --------PDLSAQAMTEKGV-------LFNSG--------EFDGLDFQAGFN-------
SYL_PHOLL       --------PNVHEAPVTDKNI-------LFNSG--------EFSGLNHEAGFN-------
SYL_MANSM       --------IDLTKAAFTEHGK-------LVNSA--------EFDGLDFEAAFN-------
SYL_ACTSZ       --------IDLSKAAFTEHGK-------LVNSA--------EFDGLDFDAAFN-------
SYL_HAES1       --------WDFSKQAYTEHGI-------TINSA--------EFDGLDFEATFN-------
SYL_HISS2       --------WDFSKQAYTEHGI-------TINSA--------EFDGLDFEATFN-------
SYL_PASMU       --------LLEHELPYCEHGI-------LFNSG--------EFNGLDFDAAFN-------
SYL_HAEIG       --------IDLTKQAFVEHGK-------LVNSA--------EFDGKDFDGAFN-------
SYL_HAEIN       --------IDLTKQAFVEHGK-------LVNSD--------EFDGKNFDGAFN-------
SYL_HAEI8       --------IDLTKQAFVEHGK-------LVNSA--------EFDGKDFDGAFN-------
SYL_HAEIE       --------IDLTKQAFTEHGK-------LVNSA--------EFDGKDFDGAFN-------
SYL_ACTP2       --------WDFSKAAYTEHGK-------LINSA--------EFDDLNFEQAFN-------
SYL_HAEDU       --------WDFSQAAFTEHGK-------LINSA--------EFDGLDFNHAFN-------
SYL_SHESA       -------ELDISEAAYTEKGV-------LFNSG--------EFDGLDFDGAFN-------
SYL_SHESM       -------ELDISEAAYTEKGV-------LFNSG--------EFDGLDFDGAFN-------
SYL_SHESR       -------ELDISEAAYTEKGV-------LFNSG--------EFDGLDFDGAFN-------
SYL_SHEON       -------DLDISEAAYTEKGI-------LFNSG--------EFDGLDFDGAFN-------
SYL_SHEB9       -------DVDISEAAYTEKGV-------LFNSG--------EFDGLDFEAGFN-------
SYL_SHEB5       -------DVDISEAAYTEKGV-------LFNSG--------EFDGLDFEAGFN-------
SYL_SHEB8       -------DVDISEAAYTEKGV-------LFNSG--------EFDGLDFEAGFN-------
SYL_SHESW       -------EVDISEAAYTEKGI-------LFNSG--------EFDGLDFDAAFN-------
SYL_SHEPC       -------DVDISEAAYTEKGI-------LFNSG--------EFDGLDFEAGFN-------
SYL_SHEAM       -------EVDISEAAYTEKGV-------LFNSA--------EFDGLDFDGAFN-------
SYL_SHEHH       -------EVDISEEAYTEKGV-------LFNSA--------EFDGLDFQAAFD-------
SYL_SHEPA       -------EVDISEEAYTEKGV-------LFNSA--------EFDGLDFQAAFD-------
SYL_SHELP       -------ELDISEEAYTEKGI-------LFNSGDSFP----ELDGLDFQAAFD-------
SYL_SHESH       -------DLDISEEAYTEKGV-------LFNSGDSFP----ELDGLDFQDAFD-------
SYL_SHEDO       -------EVDISKEAYTEKGV-------LFNSGTAFP----ELDGLEFQAAFD-------
SYL_SHEFN       -------EVDVSKEAYTEKGV-------VFNSGDAFP----ELDGLDFQAAFE-------
SYL_VIBPA       -------ELDISEAAYTEKGV-------LFDSG--------EFDGLEFQAAFD-------
SYL_VIBCB       -------ELDTSEAAYTEKGV-------LFDSG--------EFDGLEFQAAFD-------
SYL_VIBVU       -------ELDISEAAYTEKGV-------LFDSG--------EFDGLEFQAAFD-------
SYL_VIBVY       -------ELDISEAAYTEKGV-------LFDSG--------EFDGLEFQAAFD-------
SYL_VIBCH       -------ELDVSEAAYTEKGV-------LFASG--------EFDGLDFQAAFN-------
SYL_VIBC3       -------ELDVSEAAYTEKGV-------LFASG--------EFDGLDFQAAFN-------
SYL_ALIF1       -------DLDVSEAAYTEKGV-------LFDSG--------EFDGLAFQEAFD-------
SYL_PHOPR       -------ELNVSEEAYTEKGV-------LFDSG--------EFDGLAFQDAFD-------
SYL_AERS4       -------V-DVSDAAYTEKGV-------LFASG--------EFDGLDFQGAFD-------
SYL_AERHH       -------LPNVIDAAYTDKGV-------LFNSG--------EFDGLEFQPAFD-------
SYL_MARHV       -------DIDIQEQAFTEKGV-------LVSSG--------KYSGLTSEEAFE-------
SYL_HAHCH       -------EVDIQEKAITEKGI-------LVNSG--------EFTGMTSQEAFD-------
SYL_SACD2       -------DIDLTKEAFVDKGV-------LVNSG--------EYDGLNFNAAFE-------
SYL_MARMS       -------VIDLEKAAFTEKGV-------LCNSG--------EFDGLAFKEAFD-------
SYL_ALCBS       -------PIDLALEAFTGKGT-------LIHSG--------EFDGLSSAEAFN-------
SYL_PSEAB       VEGDDDFESSVWKEWYGAKDESVL----TVNSG--------KYDNLGYQAAFD-------
SYL_PSEAE       VEGDNDFESSVWKEWYGAKDESVL----TVNSG--------KYDNLGYQAAFD-------
SYL_PSEA7       VEGENDFEPTVWKEWYGAKDESVR----TVNSG--------KYDDLGYQAAFD-------
SYL_PSEU5       SAG--DETPAPWQDAYGEH-GQL------INSG--------IYDGLDFEGAFD-------
SYL_PSEMY       EGK--DYDASTWQDWYGDK-AGLT----TINSG--------KYDGLDFSAAFD-------
SYL_PSEP1       SAG--DEVGSEWQAAYGEH-GQL------INSA--------EFDGLDFAGAFD-------
SYL_PSEPK       SAG--DEVGSEWQAAYGEH-GQL------INSA--------EFDGLDFAGAFD-------
SYL_PSEPG       SAG--DEVGSEWQAAYGEH-GQL------INSA--------EFDGLDFAGAFD-------
SYL_PSEE4       SAG--DDVGSEWLAAYGEH-GQL------INSG--------EFDGLDFQGAFD-------
SYL_PSEU2       SAG--DQTPAPWQPAYGEH-GEL------INSG--------EFTGLTFQDAFD-------
SYL_PSE14       SAG--DQTPAPWQPAYGEH-GEL------INSG--------EFTGLNFQAAFD-------
SYL_PSESM       SAG--DETPAPWQAEYNEQ-GPL------INSG--------EFTGLHFQDAFD-------
SYL_NEIMB       -VGDNAFDENQWQEWYGDKEN-GV----LVNSG--------DLDGLDFQTAFD-------
SYL_NEIMF       -VGDNAFDANRWQEWYADKEN-GV----LVNSG--------DLDGLDFQTAFD-------
SYL_NEIG1       -VGDNAFDANRWQEWYGDKEN-GV----LVNSG--------DLDGLDFQTAFD-------
SYL_NEIM0       -VGDNAFDANQWQEWYGDKEN-GV----LVNSG--------DLDGMNFQTAFD-------
SYL_NEIMA       DSRDLPFMPNKWQAWYGVKDDFMV----LINSG--------ELDGMNYQTAFD-------
SYL_CHRVO       -SGDGEYDAANWQEWYGAKDDTVK----TVNSG--------KYDGLGYQAAFD-------
SYL_THIDA       DGET--FSLDAWAEWYGDKTRGQ-----CVNSG--------KYDRLGYEAAVD-------
SYL_DECAR       DGETA-FSHEAWAEWYADKAKGK-----LVNSG--------KYDGLGYEAAVD-------
SYL_AZOSB       THDA--YENVAAPWIDAYAEHGK-----LVNSG--------KYDNLHFQDAVD-------
SYL_CUPMC       KGQA--YSTDAWLEWYGDKEHGL-----CIHSG--------KYDGLGYKAAVD-------
SYL_CUPPJ       KGQP--YSTEAWQEWYGDKENGV-----CIESG--------KYNGLGYLAAVE-------
SYL_RALSO       KGQP--FGTEAWQEWYADKERGV-----LVHSG--------KYDGLDYRQAVD-------
SYL_JANMA       PGKT--FSDVAWHEWYGDKENGR-----CINSG--------KYDGLNYQQAVD-------
SYL_HERAR       EGKT--FSEVTWHDWYADKENGR-----CINSG--------KYDGLNYQQAVN-------
SYL_BURCH       EGQT--YSLDAWQEWYGDKETAV-----CVNSG--------KYDGLRYAEAVD-------
SYL_BURCA       EGQT--YSLDAWQEWYGDKETAV-----CVNSG--------KYDGLRYAEAVD-------
SYL_BURL3       EGQQ--YSLDAWQEWYGDKETAV-----CVNSG--------KYDGLRYAEAVD-------
SYL_BURCM       EGQT--YSLDAWQEWYGDKETAV-----CVNSG--------KYDGLRYADAVD-------
SYL_BURVG       EGQT--YSLDAWQEWYGDKDAAV-----CVNSG--------KYDGLRYTEAVD-------
SYL_BURP0       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAHDAAVD-------
SYL_BURPS       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAHDAAVD-------
SYL_BURP6       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAHDAAVD-------
SYL_BURP1       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAHDAAVD-------
SYL_BURM7       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAYDAAVD-------
SYL_BURM9       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAYDAAVD-------
SYL_BURMA       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAYDAAVD-------
SYL_BURMS       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAYDAAVD-------
SYL_BURTA       EGET--YSTDAWQEWYGDKTRAV-----CVNSG--------KYDGLAYDAAVD-------
SYL_PARXL       EGKE--FSTEAWQEWYGEK-TGT-----LINSG--------KYDGLNYEQAVD-------
SYL_POLAQ       KDESPMFNGTHWQDWYAQKENVV-----CFNSG--------KFDGLSHEEAVN-------
SYL_BORBR       EGKT--YSTDAWQEWYGDKQAGR-----TVNSG--------KYDGLAYQAAVD-------
SYL_BORPA       EGKT--YSTDAWQEWYGDKQAGR-----TVNSG--------KYDGLAYQAAVD-------
SYL_BORPE       EGKT--YSTDAWQEWYGDKQAGR-----TVNSG--------KYDGLAYQAAVD-------
SYL_BORPD       EGKA--YSTDAWQEWYGDKQGGR-----TVNSG--------KYDGLPYAEAVD-------
SYL_BORA1       EGKT--YSDQAWQEWYGDKQTGR-----TINSG--------KYDGLSTAEAVD-------
SYL_METPP       DGEH--FSYDHWQDWYADKQRGV-----TINSG--------NLSGLSYPVAVD-------
SYL_ACISJ       DGET--FDFHQWQDWYGDKERGV-----TINSG--------NFSGLSYQDAVA-------
SYL_ACIAC       DGET--FDYHRWQDWYGDKQNGV-----TINSD--------NFSGLSYQEAVS-------
SYL_RHOFT       DGEQ--FDYDQWQDWYADKQRGV-----AINSG--------SFSGMSFKQAVE-------
SYL_VEREI       DGEH--FDYRRWQDWYGDKQRGV-----TINSD--------SFSGLHHKEAVQ-------
SYL_POLNA       KGQA--YSLDAWADWYGDKQHGI-----AINSG--------KYDGLAFKAAVD-------
SYL_POLSJ       KGQA--YSLEAWADWYGDKQQGV-----AINSD--------KYDGLGLKACVD-------
SYL_METCA       TVGAYETVDTKGGWIDAYAEHGR-----CTNSG--------KYDGLAFQQAFD-------
SYL_DICNV       EKDLPAFNADSWQEWYGDKEEMH-----VIASD--------DCNGLNYDQAFE-------
SYL_PSYCK       --YFDDVEEGNENCAY-TERNTL------VNSG--------EFDGMDFEQAFE-------
SYL_PSYA2       --YFDDIEEGNDNRAY-TERNTL------VNSG--------EFDGMDFEQAFA-------
SYL_PSYWF       ----------DHEGAY-TERGTL------VNSG--------EFDGLDFDGSFE-------
SYL_ACIAD       --DDAEYSVTAWQEWYGSKEGTL------VNSG--------EFDGLEFQAAFD-------
SYL_NITEU       ------ENGELSVPLVQAFTEYGV----TFNSD--------RFSDLTSPEAID-------
SYL_NITEC       ------EDGELPAPLAQAFTGYGV----TFDSG--------EFSSLKSMDAVD-------
SYL_NITMU       ------VDSGLTVPLAQAYVEHGI----TFDSG--------EFSGLAFQPAVD-------
SYL_METFK       ------AHGELELPLQAAYTEHGI----LFDSG--------DFNGLDFSQASD-------
SYL_HYDCU       ------KAGEEADVSEAAFTEKGV----LVNSG--------QFDGLKSKQALH-------
SYL_XYLFA       NQDESTWEPDVWRDWYADKTREFE----LINSA--------EFDGLDYQDAFE-------
SYL_XYLFT       NQDESTWEPDVWRDWYADKTREFE----LINSA--------EFDGLDYQGAFE-------
SYL_XANC8       NDDEQAWDATQWRDWYTDKSRELE----LINSA--------EFDGLDYHGAFE-------
SYL_XANCP       NDDEQAWDATQWRDWYTDKSRELE----LINSA--------EFDGLDYHGAFE-------
SYL_XANCB       NDDEQAWDATQWRDWYTDKSRELE----LINSA--------EFDGLDYHGAFE-------
SYL_XANC5       NEEEQTWDATHWRDWYTDKSRELE----LINSA--------EFDGLDFGGAFE-------
SYL_XANAC       NEEEQTWDATHWRDWYTDKSRELE----LINSA--------EFDGLDFGGAFE-------
SYL_XANOR       NDDEQRWDATEWRDWYTDKSRELE----LINSA--------EFDGLDFGGAFE-------
SYL_XANOM       NDDEQRWDATEWRDWYTDKSRELE----LINSA--------EFDGLDFGGAFE-------
SYL_NITOC       ----DQASCNLEQSAFVEKGL-------LINSG--------DFTGLDFDQAFA-------
SYL_ALKEH       -----EERADVSEGAFTDDGV-------LADSG--------EFSGLPSAEARQ-------
SYL_HALHL       -----GTELDIAAGAFSDYGV-------LADSG--------PFSGMPSDRAFA-------
SYL_CHRSD       -----GNTPDLSQGAHTEHGK-------LINSG--------EFDGLEFDAAFD-------
SYL_BUCAI       --------PDHQEPKLYTSFLDIK--GTLFNSQ--------EFNGLNLKDGTE-------
SYL_BUCAP       --------KKYKNTQLHNLFTTEK--GILYNSG--------EFNNLNYHNATE-------
SYL_BUCCC       --------KNKK---------------LLINSD--------NFNNLNIKKARN-------
SYL_BUCBP       --------LDGTEPKIKNTAMTSM--GKLFNSN--------QYNNLNYQEGSY-------
SYL_WIGBR       --------YFEKIIDFKKYNNLKE--GILFNSN--------IFNGLNLKNGYD-------
SYL_BLOPB       --------LDAIEPNIAMQAQETTCDGILFNSG--------EFDGLSSCTASN-------
SYL_BLOFL       --------ADGELPNITNQAMIEP--GILFNSD--------NFDDLTSHTAIN-------
SYL_BAUCH       --------IDGSKPTISGIIPE----GILYNSG--------EFNGLRSLEASK-------
SYL_COXBU       ------HDWDYNQAAYTNPGK-------LINSG--------SFNDIDSKTAFN-------
SYL_COXBR       ------HDWDYNQAAYTNPGK-------LINSG--------SFNDIDSKTAFN-------
SYL_COXBN       ------HDWDYNQAAYTNPGK-------LINSG--------SFNDIDSKTAFN-------
SYL_LEGPH       ------IEHDFNQSAYTEEGI-------LINSN--------QFDNLLSSKAIQ-------
SYL_LEGPC       ------IEHDFNQSAYTEEGI-------LINSN--------QFDNLLSSKAIQ-------
SYL_LEGPA       ------IEHDFNQSAYTEEGI-------LINSN--------QFDNLLSSKAIQ-------
SYL_LEGPL       ------IEHDFNQSAYTEEGI-------LINSN--------QFDNLLSSKAIQ-------
SYL_FRATT       ------LKIDLEKQAFTEKGI-------LINSG--------EFDGLNFKNAYQ-------
SYL_FRAT1       ------LKIDLEKQAFTEKGI-------LINSG--------EFDGLNFKNAYQ-------
SYL_FRATW       ------LKIDLEKQAFTEKGI-------LINSG--------EFDGLNFKNAYQ-------
SYL_FRATF       ------LKIDLEKQAFTEKGI-------LINSG--------EFDGLNFKNAYQ-------
SYL_FRATH       ------LKIDLEKQAFTEKGI-------LINSG--------EFDGLNFKNAYQ-------
SYL_FRATO       ------LKIDLEKQAFTEKGI-------LINSG--------EFDGLNFKNAYQ-------
SYL_FRATN       ------LKIDLEKQAFTEKGI-------LINSG--------EFDGLNFKNAYQ-------
SYL_FRAP2       ------SKLDLDKEAFTEKGI-------LINSG--------EFDGLNFKSAYQ-------
SYL_RUTMC       ---------SIDKNAMTDKGV-------LFNSG--------EFNGLNFDQAFN-------
SYL_VESOH       ---------SIDKGPIINKGK-------LFNSE--------EFSGMDFNQAYE-------
SYL_RICRS       -----KADMDVQKTAYTEDGIL-------INSD--------FLNGLTSNEAKQ-------
SYL_RICRO       -----KADMDVQKTAYTEDGIL-------INSD--------FLNGLTSNEAKQ-------
SYL_RICCN       -----KADMDVQKTAYTEDGIL-------INSD--------FLNGLTSNEAKQ-------
SYL_RICM5       -----KADMDVQKTAYTEDGIL-------VNSD--------FLNGLTSNEAKQ-------
SYL_RICFE       -----ETDIDVQKTAYTEDGIL-------VNSD--------FLNGLTSNEAKQ-------
SYL_RICAH       -----ETDIDVQKTPYTEDGIL-------VNSN--------FLNGLTSNEAKQ-------
SYL_RICCK       -----EADIDVHKIAYTEDGIL-------INSD--------FLNGLTNNEAKQ-------
SYL_RICBR       -----EADTDVQKAAYTEDGII-------INSG--------FLNGLSTNEAKQ-------
SYL_RICPR       -----ETG-------NIQEGIL-------INSD--------WLNGLTSSEAKQ-------
SYL_RICTY       -----GTD-------NTQEEVL-------INSD--------WLNGLTSSEAKQ-------
SYL_ORITB       -----ERNIDVLKEAYVGDGIM-------INSF--------HLNGLTTTEARQ-------
SYL_WOLPM       -QCQATQMT---KEAYTGDGTM-------FNSE--------FLNGLMVSEAKE-------
SYL_WOLTR       -QCQATRMADGLNEEYTNNSIM-------FNSE--------FLNGLTVSEARK-------
SYL_EHRRW       --------VDLEQEAYVGSGIM-------GCSG--------FLDGMTVDDAKK-------
SYL_EHRRG       --------VDLEREAYVGSGIM-------GCSG--------FLDGMTVDDAKK-------
SYL_EHRCJ       --------IDLGKEAYVGSGTM-------KNSD--------FLDGMTVDEAKE-------
SYL_EHRCR       --------VNLDKEAYVGSGIM-------KHSD--------FLDGMTVDEAKK-------
SYL_ANAMM       ------VQYDLQKEAYSGDGTY-------RNSE--------FLNGLRVDAARN-------
SYL_NEOSM       --------TNTALPYCLEEGVM-------CNSN--------FLDGMQVIEARK-------
SYL2_RHIL3      -----AASFSVGDTAYDGDGVM-------INSR--------FLDGKTTEEAFN-------
SYL_RHIEC       -----AASFSVGDTAYDGEGVM-------INSR--------FLDGKTTEEAFN-------
SYL_RHIME       -----PQTFTIGDEAYDGDGVM-------INSR--------FLDGLSAEEAFE-------
SYL_SINMW       -----PQTFTIGDEAYVGDGVM-------INSR--------FLDGLSTEEAFE-------
SYL_AGRFC       -----AASFTVEDTAFTDDGVM-------INSS--------FLNGMKTTDAFE-------
SYL_BRUAB       -----AASFSIGETAYTDDGVM-------INSR--------FLDGMTPEAAFN-------
SYL_BRUA2       -----AASFSIGETAYTDDGVM-------INSR--------FLDGMTPEAAFN-------
SYL_BRUSI       -----AASFSIGETAYTDDGVM-------INSR--------FLDGMTPEAAFN-------
SYL_BRUO2       -----AASFSIGETAYTDDGVM-------INSR--------FLDGMTPEAAFN-------
SYL_BRUME       -----AASFSIGETAYTDDGVM-------INSR--------FLDGMTPEAAFN-------
SYL_BRUSU       -----AASFSIGETAYTDDGVM-------INSR--------FLDGMTPEAAFN-------
SYL_BRUC2       -----AASFSIGETAYTDDGVM-------INSR--------FLDGMTPAAAFN-------
SYL_OCHA4       -----AAGFSIGETAYTDDGVM-------INSR--------FLDGMTPEAAFN-------
SYL_CHESB       -----AATFEITAEPYVDDGVM-------LNSR--------FLDGMSNKEAFE-------
SYL_RHILO       -----AKSFQITEEAYVDDGVM-------INSR--------FLDGMKPDRAFD-------
SYL_BART1       -----VEDFVLAEMPYTGDGVM-------INSS--------FLDGLTPQQAFE-------
SYL_BARHE       -----REDFAITETPYLGDGVM-------INSS--------FLDGLTPQQAFE-------
SYL_BARQU       -----AEDFVIAETPYTGDGVM-------INSD--------FLDGLTPQEAFE-------
SYL_BARBK       -----EQDFTLSDTAYTGDGVM-------INSD--------FLNGLTPKDAFE-------
SYL_RHOP2       -----PLSFVITDEAYDGDGRL-------INSR--------FLDGMSIADAKE-------
SYL_RHOPS       -----PSSFVITDEAYDGDGRL-------INSR--------FLDGMSIAEAKE-------
SYL_RHOPA       -----PASFVITDTAYDGEGRM-------INSR--------FLDGKTIAEAKE-------
SYL_RHOP5       -----PASFVITDVAYDGDGRL-------INSR--------FLDGLSIDQAKE-------
SYL_NITHX       -----PKTLVITDTAYDGDGRM-------INSR--------FLDGMTAEAAKK-------
SYL_NITWN       -----PASFVITDTAYDGDGRM-------INSR--------FLDGMSADAAKE-------
SYL_BRASB       -----PASFVITDTAFDGDGRL-------INSR--------FLDGMTIAQAKD-------
SYL_BRASO       -----PASFVITDTAYDGDGRM-------INSR--------FLDGMTIAQAKD-------
SYL_BRADU       -----PKSFVITDTAYDGDGRM-------INSR--------FLDGMTIEQAKD-------
SYL_RHOPB       -----PATFVVTDIAYDGDGRL-------INSNNGFI----ALDGMSIADAKE-------
SYL_AZOC5       -----PAVFAVGSEAYDGEGTL-------YNSQ--------FLDGLSIADAKE-------
SYL_PARL1       ----ASGLAETGTDAYTGDGVA-------INSD--------FLNGLDVQSAKR-------
SYL_CAUVC       -----PATFTVGKEAYVGPGK---------IFNSK------FLDGLDV---EA-------
SYL_CAUSK       -----AATFQVGKEAYVGPGA---------IFNSE------FLDGLDV---EA-------
SYL_MARMM       -----ADTHVIEDEAYTGPGT---------SYNSR------FLDGLST---AD-------
SYL_HYPNA       -----AAAFEVGIEAYTGPGH---------IYKSG------FLDGLSI---DD-------
SYL_RUEST       --------GEL-TEAYVPTKAE-------KVRYVR------GFAGDELQTGEE-------
SYL_RUEPO       --------KPIATEAFVPLKTE-------KVKWID------HFAGLDVATGQE-------
SYL_ROSDO       -----EVLSE----AFVPAKTE-------KVFYNR------GFAGAEFQTGLE-------
SYL_JANSC       -----HVLPEDGGAAYVPPKPD-------PVRYIR------GFAGEEIQSGND-------
SYL_DINSH       --------TPVGDTAFVPPKTE-------PVRWVE------HFAGLDIATGQE-------
SYL_RHOS1       -----DTEETALAEAFVPMKSE-------RVHYIR------GFAGAEVQTGEE-------
SYL_RHOS4       -----GCEETALAEAFVPMKSE-------RVHYIR------GFAGAEVQTGEE-------
SYL_RHOS5       -----GTEEAPLTEAFVPMKSE-------RVAYVR------GFAGAEIQTGEE-------
SYL_PARDP       -----QADALVAKAPFVPLKSE-------TVTYVR------GFAGAADQTGEA-------
SYL_ZYMMO       --------EAIGDKADTRAGIM-------VNSS--------FLDGLSSEEAKK-------
SYL_SPHWW       --------APIGDEAYVGPGRI-------VNSA--------FLDGLSVEEAKA-------
SYL_NOVAD       --------KPFAGEAEAGDGVL-------VNSG--------FLDGMNVADAKA-------
SYL_SPHAL       --------HFTGSEAYTGPGKL-------VNSH--------FLDGMSIDEAKA-------
SYL_GRABC       --------FTIGRKAYDGDGIL-------FNSG--------PFDGLTPDAARR-------
SYL_GLUOX       --------FVLGKKAVSGDATL-------FNSG--------FLDGLDPAAART-------
SYL_ACICJ       --------LAVGDVAFTGDGVI-------VNSG--------FLDGLDVAAAKS-------
SYL_MAGSA       ----LAA--IAKGEAYTGDGVA-------VNSQ--------FLDGLAVDEAKA-------
SYL_RHORT       ----FAKDLEASDTAFSEDGVA-------IASG--------FLDGLPVSEAKA-------
SYL_MAGMM       ----QTLHAEQLSEAYTGPGRL-------VNSG--------LFTGMDNEQAKQ-------
SYL_CAMJ8       ---------QENLPYTQKSGK-------LIHSQ--------EFDNLDCNEARL-------
SYL_CAMJJ       ---------QENLPYTQKSGK-------LIHSQ--------EFDNLDCNEARL-------
SYL_CAMJR       ---------QENLPYTQKSGK-------LIHSQ--------EFDNLDCNEARL-------
SYL_CAMJE       ---------QENLPYMQKLGK-------LINSQ--------EFDNLDCNEARL-------
SYL_CAMJD       ---------QENLPYTQKLGK-------LIHSQ--------EFDNLDCNEARL-------
SYL_CAMC1       -----GE--SEGSKAYSEYGV-------AINSE--------LINGLSSEDAKS-------
SYL_CAMC5       -----GK--FDTSKANAEYGI-------SINSP--------LINGLETKQAKQ-------
SYL_CAMFF       ---------SDTLPYCEKSGV-------YINSE--------LINGLAYEEARE-------
SYL_CAMHC       -----G---ENVKLPYIESGI-------LVDSA--------EFSGLENEDAKM-------
SYL_ARCB4       -----II--ENQTEAYTAEGR-------LIESE--------NFTGVTNIEAKK-------
SYL_NITSB       -----GE--LDTTKAYTEPGI-------LFDSG--------EFSGFESSEAKQ-------
SYL_WOLSU       -----GAAPSLDEAAYTESGT-------LINSG--------IFDGLESESAKE-------
SYL_HELHP       -----GEEPTQEICAAYEEGF-------LINSG--------EFSGMSSSQAKE-------
SYL_HELPY       ----------PQNLPHTKEEV-------LKNSG--------EWSDLSSSVARE-------
SYL_HELPH       ----------LQNLPHTKEEV-------LKNSG--------EWSDLSSSVARE-------
SYL_HELPJ       ----------PQNLPHTKEEI-------LKNSG--------EWSDLSSSVARE-------
SYL_HELAH       ----------PQNLPHTKEET-------LKNSG--------EWSDLPSSVARE-------
SYL_THEMA       ---DLDPEK--MEEAYEGEGIM-------VNSG--------PFDGTPSSEGIE-------
SYL_THEP1       ---DLDPEK--MEEAYEGEGIM-------VNSG--------PFDGTPSSEGIE-------
SYL_THEM4       ---SIDVEK--MEKAYEEEGIM-------VNSG--------PFNGMRSTLALE-------
SYL_FERNB       ---EWNIN----ERPYEEEGIM-------INSG--------PFDGLESSKGIE-------
SYL_PSELT       -----DIPK---NRAYDGPGIM-------VNSG--------PLNGTVVPEGIE-------
SYL_CALS8       ----VDIQN--LQSAYEGEGVL-------INSG--------EFNGLKNTEAMK-------
SYL_HUNT2       ---ELDASR--MTEAFVEVGYL-------VNSA--------EFDGVRSDEAIG-------
SYL_DESHY       ---PVEEKDTPLQAAFVEEGMM-------VNSG--------EYDGLKNVEAWE-------
SYL_SYNWW       ---PLDGNL--LQESYPGDGHM-------VNSG--------NFDGLTVEEGQK-------
SYL_CARHZ       ---GQELKAEELTEAYTGEGIL-------VNSG--------EFTGLANKEAIR-------
SYL_PELTS       ---GVELDPAAMEAAYEEEGFL-------VNSG--------PFSGMPNKEAIR-------
SYL_MOOTA       ---SSELPAGELAAAYVEDGIM-------VNSG--------PFNGLPNREGIQ-------
SYL_DESRM       ---DKEIRVEDMKEAYTADGIM-------VHSG--------PFDGSPNRQGIK-------
SYL_SYMTH       ---EGTLRAEEMTAAYVEPGIM-------VNSG--------PFDGTPNLEGIP-------
SYL_DESVH       ----EALDPATMSAAWTEAGAL-------VNSG--------AFDGLANEDAKQ-------
SYL_DESVV       ----ETLDPATMSAAWTEAGAL-------VNSG--------NFDGLANEDAKQ-------
SYL_DESAG       ----AELTPATMETAYTGQGTM-------VGSG--------QFSGLPNEEGKT-------
SYL_LAWIP       ----LQINEHTIVEPWTGLGTL-------IHSG--------QFTGLTNKEAKE-------
SYL_GEOMG       ---TLDPAA--MATAYTEVGTM-------VNSG--------TFDGLRSDEAKE-------
SYL_GEOSL       ---TLDPAA--MTAAYTEVGTM-------VNSG--------PFNGMKSDEAKE-------
SYL_GEOUR       ---ALDPQT--MAEAFTAEGIM-------VNSG--------RFDGLKSGAAKE-------
SYL_PELPD       ---TLDPAT--MEAAYTEPGIM-------VNSG--------TFDGMGSEEAKQ-------
SYL_PELCD       ---TLDPAT--MTEAWTAPGVL-------VNSA--------PFDGLDNESAKE-------
SYL_SYNAS       ---TLDPET--MTEAYVEEGIL-------VNSG--------PFNGMENLKALD-------
SYL_SYNFM       ---AAAPAAQELSAAFEDDGVL-------VDSG--------AYSGMASAEART-------
SYL_DESPS       ---AVNPAD--MEEALTNHGLL-------INSG--------DFTGMASQEAQA-------
SYL_FUSNN       -------SDEKVQLPYIEEGVM-------INSG--------EFNGLSSKDALV-------
SYL_TRIV2       TEEVTQVVQIEYNQAYTEPGI-------LINSG--------AFTGMTSTDAK--------
SYL_NOSS1       TEEVTQVVQIEYNQAYTEPGI-------LINSG--------AFTGMTSTDAK--------
SYL_ACAM1       --------ETPLEAAYTEPGL-------MVNSG--------EFDGKVSTEGK--------
SYL_TRIEI       --------DHKLTEAYTDVGV-------MVNSG--------PFNGEKSTVAK--------
SYL_SYNY3       --------DVNLTVAYTEAGV-------MVNSA--------QFTGMASPKAK--------
SYL_SYNE7       --------AEPWPAPFTEAGV-------MVNSG--------QFDGLSSTEAK--------
SYL_SYNP6       --------AEPWPAPFTEAGV-------MVNSG--------QFDGLSSTEAK--------
SYL_THEEB       --------STRLRAAYTEPGK-------LINSG--------QFDGMDSTAAK--------
SYL_SYNJB       TDRASGTESSELQAAWTGEGV-------MINSG--------PLDGIPVGKGPG-------
SYL_SYNJA       ----GVTSAEDLQAAWTGEGV-------LINSG--------PLNGIPVGKGPG-------
SYL_GLOVI       --------TEPLRAAYTEVGV-------LVNSG--------PFNGLDSPTGK--------
SYL_SYNS3       --------HVNDGEAWAGPGT-------LIHSA--------GFSGLSNDEAK--------
SYL_SYNPW       --------HLSDGEAWTGPGI-------LLNSG--------RFDGQSSEEAR--------
SYL_PROMM       --------HHNDGQAWTGAGV-------LVNSG--------AFDGLSTEEAK--------
SYL_PROM3       --------HHNDGQAWTGAGV-------LVNSG--------AFDGLSTEEGK--------
SYL_SYNSC       --------AIAAGQAWTDAGT-------LVNSG--------SFDGTASSEAK--------
SYL_SYNS9       --------AIDAGKAWTEAGT-------LINSG--------VFDGQPSNQGK--------
SYL_SYNPX       --------AIAAGEAWTDPGV-------LIHSG--------DFDGLNSIEAK--------
SYL_SYNR3       --------SGEPSEAFTGLGE-------LVGSA--------DFDGLQGEEAK--------
SYL_PROMT       ------EDESYLNAEFVDKGI-------MINSD--------KFNGIESDIAK--------
SYL_PROM1       ------EDESYLNAEFVDKGV-------MINSD--------KFNGIESDIAK--------
SYL_PROMA       ------ASDLEASSAYVKEGI-------MINSG--------EFNGINSKEAG--------
SYL_PROM0       ------EQNKELDEAYVENGY-------LINSN--------QYDGVANTIAK--------
SYL_PROM9       ------EKTKELDEAYVENGY-------LINSN--------HFNGIANTIAK--------
SYL_PROMS       ------EQSNELDNAYVENGY-------LINSN--------HYNGLANTIAK--------
SYL_PROM2       ------EKTNELDKAYVENGY-------LMNSD--------QYNFMENTIAK--------
SYL_PROMP       ------KITSQLTNAFTDNGF-------LINSN--------NFDGLNNSDAK--------
SYL_PROM5       ------KSTFKLKNAFTDNGF-------LINSN--------NFNGLCNNDAK--------
SYL_SOLUE       ------PAGEPVALPYGEYGILE-------NSG--------EWSGLASAEARR-------
SYL_DEIRA       ---------DQPSEPYSGEGQ-------IVNSG--------EFDGMPGGKASI-------
SYL_DEIGD       ---------DTTQAPYVGEGV-------IVNSG--------EFDGLPGGKASI-------
SYL_RUBXD       ----------PLERAYVGEGQ-------MVNSG--------PFDGTPSAEGR--------
SYL_CLOPE       ------------NLPFCEHGI-------LVNSG--------EFDGLTTDEAK--------
SYL_CLOPS       ------------NLPFCEHGI-------LVNSG--------EFDGLTTDEAK--------
SYL_CLOP1       ------------NLPFCEHGI-------LVNSG--------EFDGLTTDEAK--------
SYL_CLOB8       ------------DLPYCEYGV-------LVNSG--------KFDGLTTDEAK--------
SYL_CLOB1       ------------SLPYTEYGG-------MVNSG--------EFDGLLGNEAK--------
SYL_CLOBH       ------------SLPYTEYGG-------MVNSG--------EFDGLLGNEAK--------
SYL_CLOBL       ------------SLPYTEYGK-------MVNSG--------EFDGLFGNKAK--------
SYL_CLONN       ------------SLPFTEYGS-------LVNSG--------EFDGLYGEEAK--------
SYL_CLOAB       ------------ELPFTGYGP-------LVNSG--------EFDGLKGNKAK--------
SYL_CLOK5       ------------SLPYVEYGK-------MINSD--------KFNGLYTPEGK--------
SYL_CLOTE       ------------TLPYTEDGI-------MINSE--------EFNGLESSKGR--------
SYL_CALS4       ------------SLPFVEYGI-------LVNSE--------EFTGMTSEEAR--------
SYL_ROSCS       ---------ATMTEAWPGDGV-------MVNSG--------PINGLPVGKGEGQSV----
SYL_ROSS1       ---------DTMTEAWPGDGV-------MVNSG--------PINGIPVGKGEGQSV----
SYL_THEFY       -------DPAETGIATPGEGT-------LINSGP--------LNGLSKSEAIP-------
SYL_ACIC1       -------DPAVTGVATEGDGV-------HINSGL--------IDGTDKAEGIA-------
SYL_ARTS2       -------DPAVTGKATAGEGT-------LINSGV--------LDGLPKAEAIP-------
SYL_PAEAT       -------DPAETGVATAGEGT-------LKNSGE--------LDGLSKSEGIP-------
SYL_RENSM       -------NPAETGTAAIGDGV-------LVNSGE--------LDGLAKAEAIP-------
SYL_CLAMS       PDLEEV-LPGRTGVALPGEGR-------LINSGS--------LNGLSKQPAIK-------
SYL_CLAM3       PDLEEV-LPGRTGVALPGEGR-------LINSGS--------LNGLSKQPAIK-------
SYL_LEIXX       PESAPLESPAETGQALTGEGR-------LINSGP--------FDGLSKSNAIR-------
SYL_KINRD       ----PLPDPAESGTATAGDGV-------LVNSGA--------LDGLGKQAGIA-------
SYL_NOCSJ       ----------FDGEAYHGEGP-------AINSPAPGADAPLDINGLPVDEAKR-------
SYL_TROW8       ----------------------------LISSGK--------YSGQSVTQARE-------
SYL_TROWT       ----------------------------LISSGK--------YSGQSVTQARE-------
SYL_MYCPA       -------GGDISEGAYAGDGVLVNSGY---------------LDGLDVAAAKEAITARLE
SYL_MYCA1       -------GGDISEGAYAGDGLLVNSGY---------------LDGLDVAAAKEAITARLE
SYL_MYCLE       -------GSDISEAAYVGDGVLVNSGY---------------LDGMDVATAQEAITARLE
SYL_MYCTA       -------GGNISESAYTGDGILVNSDY---------------LNGMSVPAAKRAIVDRLE
SYL_MYCBO       -------GGNISESAYTGDGILVNSDY---------------LNGMSVPAAKRAIVDRLE
SYL_MYCTU       -------GGNISESAYTGDGILVNSDY---------------LNGMSVPAAKRAIVDRLE
SYL_MYCBP       -------GGNISESAYTGDGILVNSDY---------------LNGMSVPAAKRAIVDRLE
SYL_MYCUA       -------GGDISQAAYTGDGVLVNSGF---------------LDGMSVGEAKQAITARLE
SYL_MYCSS       -------GGDISEAAYAGDGLLVNSDY---------------LDGLDVAAAKAAITDRLV
SYL_MYCSK       -------GGDISEAAYAGDGLLVNSDY---------------LDGLDVAAAKAAITDRLV
SYL_MYCSJ       -------GGDISEAAYAGDGLLVNSDY---------------LDGLDVAAAKAAITDRLV
SYL_MYCS2       -------GGDISEAAYAGDGTMVNSGF---------------LDGMDVASAKEAIIARLE
SYL_MYCVP       PGEDTGAGGDVSQAAYTGDGVMVNSGF---------------LDGMDVSAAKEAMTERLS
SYL_MYCGI       ------AGGDVTVEAYSGDGTMVNSGF---------------LDGMDVATAKQAMTERLV
SYL_NOCFA       -------GGDITAAAHTGEGELVNSDY---------------LNGLSVEEAKATVIGRLE
SYL_RHOJR       -------GGDLTKDAYTGDGTIVNSDF---------------LNGMSVADAKKAITERLE
SYL_SACEN       ------PSEGFEGGAYSGEGPRINSANPDVGL---------DLNGMHLDEAKKTIIEWLE
SYL_CORGB       -------GGNIEEAAFTESGEAVNSAN-DNGL---------DINGLAKDEAVAKTIEWLE
SYL_CORGL       -------GGNIEEAAFTESGEAVNSAN-DNGL---------DINGLAKDEAIAKTIEWLE
SYL_COREF       -------GGNIAEAAYTASGESINSAN-DQGL---------DINGLAMVDAVARTIEWLE
SYL_CORDI       -------GGNIAEAAYTESGAAVNSAN-DQGL---------DINGLDKQEAIAQVIEWLV
SYL_CORJK       AGAGE-QGGAELTEAFTEDGPHINSNN-SDGL---------ELNGLGKAEAIDKAIEWLE
SYL_STRCO       TDGRGTDTSTWDEAFASYDAKIVNSSGTD--V---------SLDGLGVVEAKERVTEWLE
SYL_STRAW       SDDRGTDPSTWDDAFASYDAKIVNSSSGE--I---------SLDGLGVVEAKARITEWLE
SYL_SALAI       AEG-------FDGKAYTGEGPAINSAAPERGL---------NLDGLGVAEAKARTTAWLE
SYL_BIFAA       ESGDDLANYEGKAPFVSHDGIVINSSIDATKAKGD----SLSLDGLRVDEAIDKVNAWLE
SYL_BIFLO       DSGDDLANYEGKAPFVSHDGIVINSSVEATEAKGD----ALSLNGLRVDDAIAKVNAWLE
SYL_FRACC       DADWYAAHGVVPATPSAQWPEAFSGAGEYRPGPAS----APVLVGLSKSEAIKATVHWLE
SYL_FRAAA       DEQWYAEHRVTPGAPPSAWPEAFGGEGAYLPGPAG----TPVLAGLTKPDAIKTTVRWLE
                                                                            

SYL_GEOKA       ----KMIAWLEEHG-----KGRKKVSYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_GEOTN       ----KMIAWLEENG-----KGQKKVSYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACCZ       ----KMIEWLEVTS-----AGNQKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACAH       ----KMIEWLEVTS-----AGNQKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACAN       ----KMIEWLEVTS-----AGNQKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACHK       ----KMIEWLEVTS-----AGNQKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACC1       ----KMIEWLEVTS-----AGNQKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACCR       ----KMIEWLEATS-----AGNQKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACCN       ----KMIEWLEVTG-----AGNQKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_BACSU       ----KVIAWLEETK-----NGEKKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACVZ       ----KMIAWLEETK-----NGEKKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACLD       ----KMIQWLEENG-----KGEKKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_BACP2       ----KVIAWLEEHQ-----KGEKKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_BACHD       ----KMIQWLEAEK-----KGTKKVTYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_BACSK       ----KMIVWLEENG-----AGQRKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_OCEIH       ----KMIDWLEANG-----SGEKKITYRLRDWLFARQRYWGEPIPIIHWED---------
SYL_STAES       ----KAIELLESKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STAEQ       ----KAIELLESKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STAAW       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAS       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAN       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAA1       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAM       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAA9       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAA2       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAA3       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAC       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAA8       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAT       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAE       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAB       ----KAIQLLEQKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAAR       ----KAIQLLEKKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAHJ       ----KAIELLVAKG-----AGEKKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STAS1       ----KAIELLENKN-----AGTRKVNYKLRDWLFSRQRYWGEPIPVIHWED---------
SYL_LISMF       ----AAIDWLEKEG-----IGSRKITYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_LISMO       ----AAIDWLEKEG-----IGSRKITYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_LISIN       ----AAIDWLEKEG-----IGSRKITYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_LISW6       ----AAIDWLEKEG-----IGSRKITYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_ENTFA       ----KMNEWLEENH-----VGKKEVSYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_STRTD       ----KIVAWLEEKG-----FGQEKITYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRT2       ----KIVAWLEEKG-----FGQEKITYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRT1       ----KIVAWLEEKG-----FGQEKITYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRP2       ----KIVACLEEKG-----CGQEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRR6       ----KIVACLEEKG-----CGQEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRPN       ----KIVAWLEEKG-----CGQEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRSV       ----KMVAWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRGC       ----KMVAWLEKEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRS2       ----KMVAWLEENG-----VGQEKISYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRSY       ----KMVAWLEENG-----VGQEKISYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRPD       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRPG       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRP6       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRPM       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRPF       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRPB       ----KMVEWLEAEG-----VGNENVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRPC       ----KMVEWLEAEG-----VGNENVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRP3       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRP1       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRP8       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRA3       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRA5       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRA1       ----KMVEWLEAEG-----VGNEKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_STRMU       ----KMVTWLETEG-----VGNKKVTYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_LACLM       ----KAIEFLEEKK-----IGKKKITYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_LACLA       ----KAIEFLEEKK-----IGKKKITYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_LACLS       ----KAIEFLEEKK-----IGKKKITYRLRDWLFSRQRYWGEPIPIIHWED---------
SYL_LACSS       ----KMIPWLVEHK-----VGHEQISYKLRDWLFSRQRYWGEPIPIIHWED---------
SYL_LACDA       ----KMVDWLTEKG-----VGEKKVNYKMRDWNFSRQRYWGEPIPVIHWED---------
SYL_LACDB       ----KMVDWLTEKG-----VGEKKVNYKMRDWNFSRQRYWGEPIPVIHWED---------
SYL_LACP3       ----RMIKWLEDKG-----IGSAKINYKLRDWVFSRQRYWGEPIPVIHWED---------
SYL_LACPL       ----KMIDWLGEHH-----AGEKKVNYRLRDWIFSRQRYWGEPIPVIHWED---------
SYL_LACBA       ----AAIDWLTEHD-----AGHKQVNFRLRDWIFSRQRYWGEPIPVIHWEN---------
SYL_PEDPA       ----TMISWLEEHG-----VGHKKVNYRLRDWVFSRQRYWGEPIPVIHWED---------
SYL_LACS1       ----AINNWLEENG-----VGEKKVNYRLRDWLFSRQRYWGEPIPVIHWED---------
SYL_LACRD       ----KMIDWLEEHD-----AGHKKVNYRLRDWIFSRQRYWGEPIPVIHWDD---------
SYL_LEUMM       ----KAISWLEEHN-----AGHQQINYRLRDWIFSRQRYWGEPIPVIHWED---------
SYL_OENOB       ----KIIDWLEEHD-----AGHKQVNYKLRDWIFSRQRYWGEPIPVIHWED---------
SYL_SALRD       ----AITEWLDEEE-----KGERTVNYQLQDWLFSRQRYWGEPFPIVFTED---------
SYL1_RHIL3      ----AIVAWLQANG-----TGWPKVMYRLRDWLFSRQRYWGEPIPVLHLAD---------
SYL_RHOBA       ----ALTAELAKQG-----LACEAVNYKLRDWLFSRQRFWGEPFPVLHEIDSEGNAT---
SYL_PELLD       ----RMASWLELKK-----CGERKVNYRLRDWIFSRQRYWGEPIPVKHYED---------
SYL_CHLPM       ----LMASWLEKKK-----AGKRKVNYRLRDWIFSRQRYWGEPIPIKHYPD---------
SYL_CHLCH       ----RMATWLESKK-----VGKRKVNYKLRDWIFSRQRYWGEPIPIKHYED---------
SYL_CHLTE       ----RMAAWLESKG-----KGKRKVNYKLRDWVFSRQRYWGEPIPIKHYED---------
SYL_CHLPD       ----IMAHWLETKG-----LGERKVTYKLRDWIFSRQRYWGEPIPVKHYED---------
SYL_LEPBL       ----KIISWAESKR-----IGKKKTQFKLRDWLFARQRYWGEPIPLVHYPS---------
SYL_LEPBJ       ----KIISWAESKR-----IGKKKTQFKLRDWLFARQRYWGEPIPLVHYPS---------
SYL_LEPIC       ----KIISWAESKK-----IGRKKIQFKLRDWLFARQRYWGEPIPLVHYPS---------
SYL_LEPIN       ----KIISWAESKK-----IGRKKIQFKLRDWLFARQRYWGEPIPLVHYPS---------
SYL_BACTN       ----KTKQYVKEHN-----LGRVKVNYRLRDAIFSRQRYWGEPFPVYYK-D---------
SYL_BACV8       ----ATKEYVKAHN-----LGRVKVNYRLRDAIFSRQRYWGEPFPVYYK-N---------
SYL_BACFR       ----KTKEYIKATG-----LGRVKVNFRLRDAIFSRQRYWGEPFPVYYK-D---------
SYL_BACFN       ----KTKEYIKATG-----LGRVKVNFRLRDAIFSRQRYWGEPFPVYYK-D---------
SYL_PARD8       ----ATKKYVKDHD-----LGRVKINYRLRDAIFSRQRYWGEPFPVYYDAD---------
SYL_PORGI       ----QTKEYIREKH-----LGCVKVNYRLRDAIFSRQRYWGEPFPIYYK-E---------
SYL_FLAPJ       ----KAIAELETLN-----QGKGKTNYRLRDAVFSRQRYWGEPFPVYYV-N---------
SYL_FLAJ1       ----KAIYKLEEIG-----QGKGKTNYRLRDAVFSRQRYWGEPFPVYYV-N---------
SYL_GRAFK       ----KVILELEKTG-----QGYGKTNYRLRDAVFSRQRYWGEPFPVYYV-N---------
SYL_CYTH3       ----EAIKFIEEKK-----IGFAKINFKMRDSIFGRQRYWGEPIPVSYK-N---------
SYL_BDEBA       ----KMLKHLEENK-----LGVREVQYKLRDWLFSRQRYWGEPFPIVHF-A---------
SYL_SORC5       ----AVIARLEALG-----RGKREVNYKLRDWVFSRQRYWGEPIPIYFPVELADPQGDPR
SYL_TREDE       ----KITEHLENLG-----IAKRAVNYKLRDWIFSRQRYWGEPIPLVHCPS---------
SYL_TREPA       ----RIVAHLEMRG-----AGARRVTYRLRDWVFSRQRYWGEPIPLVHCPS---------
SYL_BORAP       ----KVIKWLTKNK-----KGKETVTYKLRDWVFSRQRYWGEPIPILFDKL---------
SYL_BORBP       ----KVIEWLIKNK-----KGKEKVTYKLRDWIFSRQRYWGEPIPILFDKL---------
SYL_BORBU       ----KVIKWLTKNK-----KGKEKVAYKLRDWIFSRQRYWGEPIPILFDKL---------
SYL_CHLTR       ----YVINFLEENH-----LGAAKIAYKLRDWLFSRQRYWGEPIPIIHFED---------
SYL_CHLTA       ----YVINFLEENH-----LGAAKIAYKLRDWLFSRQRYWGEPIPIIHFED---------
SYL_CHLMU       ----YVINFLEKNN-----LGSAKVAYKLRDWLFSRQRYWGEPIPVIHFED---------
SYL_CHLFF       ----YVIAYLQKKN-----LGESKVAYKLRDWLFSRQRYWGEPIPIIHFED---------
SYL_CHLCV       ----YVIAYLQKKN-----LGEAKVAYKLRDWLFSRQRYWGEPIPIIHFED---------
SYL_CHLAB       ----YVIAYLQKRN-----LGEAKVMYKLHDWLFSRQRYWGEPIPIIHFED---------
SYL_CHLPN       ----YVINYLEMRS-----LGRAKTMYRLRDWLFSRQRYWGEPIPIIHFED---------
SYL_PARUW       ----IVINWLEINH-----KGKSATTYKLRDWLFSRQRYWGEPFPLLKFED---------
SYL_ALKOO       ----KISSWLEEKG-----LGKRKVNYKLRDWVFSRQRYWGEPIPLVHCDC---------
SYL_UREP2       ----VLNDYLIKNH-----LGKKVANYKLRNWIFSRQRYWGEPFPVLFDEN---------
SYL_UREPA       ----VLNDYLIKNH-----LGKKVANYKLRNWIFSRQRYWGEPFPVLFDEN---------
SYL_MYCPU       ----KLNQYVEKNN-----LGQVETFYKLRDWIFSRQRYWGEPFPVAFDDE---------
SYL_MYCPE       ----KIVEYLEKNK-----IGKKQVNYKLKDWLFSRQRYWGEPFPVLFDEK---------
SYL_MYCGA       ----KTIAYLREHN-----LGDQKINYKLRDWIFSRQRYWGEPFPVLFDEE---------
SYL_MYCGE       ----AITNELISQN-----KAKLTTVYKLRDWIFSRQRYWGEPFPIIFDEN---------
SYL_MYCPN       ----QITQMLVERQ-----KAKKTTVYKLRDWIFSRQRYWGEPFPILFDEN---------
SYL_MYCCT       ----VIHDYIEKNN-----LGKKKTNYKLRDWLFSRQRFYGEPFPVLYDKD---------
SYL_MYCMS       ----VIHDYVDKNN-----LGKRKINYKLRDWLFSRQRFYGEPFPVLYDKD---------
SYL_MESFL       ----TMTKIAIEQG-----WGREQTNYKLRDWLFSRQRFYGEPFPVLYGPN---------
SYL_ACHLI       ----KITKHLEDRK-----KGYKHYTYKLRDWVFSRQRYWGEPFPVIYDED---------
SYL_PSEA6       ----AIAAKLEALG-----AGSKKVNYRLRDWGVSRQRYWGSPIPMLNLEN---------
SYL_COLP3       ----AISDKLISEN-----KGKTTTNYRLRDWGVSRQRYWGTPIPMINLAN---------
SYL_IDILO       ----AIATELKEKG-----IGERKVNYRLRDWGVSRQRYWGTPIPMLNLEN---------
SYL_PSEHT       ----AIADKLEALG-----VGERKVNFRLRDWGVSRQRYWGSPIPMLSDED---------
SYL_PSYIN       ----AVETKLVAEN-----KGKRQVNFRLRDWGVSRQRYWGTPIPMLNLED---------
SYL_SALCH       ----AIADKLAEKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SALTI       ----AIADKLAEKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SALTY       ----AIADKLAEKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SALPB       ----AIADKLAEKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SALPA       ----AIADKLAEKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMITQED---------
SYL_CITK8       ----AIADKLAAKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SALAR       ----AIADKLAAKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SHIFL       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SHIF8       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SHIBS       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECOL6       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECOL5       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECO57       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SHISS       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECOLI       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECOLC       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SHIDS       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECOHS       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECOUT       ----AIADKLTEMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECOK1       ----AIADKLTEMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ECO24       ----AIADKLTAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_KLEP7       ----AIADKLAAMG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_CROS8       ----AIADKLAAKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_ENT38       ----SIAAALITKG-----VGERKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_YERPA       ----AIADKLVALG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_YERP3       ----AIADKLVALG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_YERPE       ----AIADKLVALG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_YERPN       ----AIADKLVALG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_YERPS       ----AIADKLVALG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_YERPP       ----AIADKLVALG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_YERE8       ----AVADKLVALG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SERP5       ----AIADKLVAKG-----VGQRKVNYRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_PECAS       ----AIADKLVEKG-----IGERKVNYRLRDWGVSRQRYWGAPIPMMTLED---------
SYL_SODGM       ----AIADALVAQG-----VGERKVNYRLRDWGVSRQRYWGAPIPMMTLED---------
SYL_PHOLL       ----AIANKLVEMG-----VGKRKVNYRLRDWGVSRQRYWGAPIPMATLEN---------
SYL_MANSM       ----GIADKLEKMG-----VGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_ACTSZ       ----GIADKLERMG-----AGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_HAES1       ----GIADKLEKIG-----VGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_HISS2       ----GIADKLEKIG-----VGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_PASMU       ----AIADKLEALG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_HAEIG       ----GIADKLEKLG-----VGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_HAEIN       ----GIADKLEKLG-----VGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_HAEI8       ----GIADKLEKLG-----VGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_HAEIE       ----GIADKLEKLG-----VGKRQVNYRLRDWGVSRQRYWGAPIPMLTLEN---------
SYL_ACTP2       ----AIADKLESMK-----VGKRQVNFRLRDWGVSRQRYWGAPIPMMTTED---------
SYL_HAEDU       ----AIADKLESLG-----VGKRQVNFRLRDWGVSRQRYWGAPIPMMTTEQ---------
SYL_SHESA       ----AIADKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHESM       ----AIADKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHESR       ----AIADKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEON       ----VIANKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEB9       ----AIANKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEB5       ----AIANKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEB8       ----AIANKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHESW       ----AIANKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEPC       ----AIANKLVAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEAM       ----AIADKLAAEG-----KGKRQVNFRLRDWGVSRQRYWGAPIPMVTLED---------
SYL_SHEHH       ----AIDAKLTAEG-----KGKRQVNFRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEPA       ----AIDAKLTAEG-----KGKRQVNFRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHELP       ----AIDAKLSSEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHESH       ----AIDAKLSSEG-----KGKRQVNFRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEDO       ----AIDARLTAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_SHEFN       ----AIDARLTAEG-----KGKRQVNYRLRDWGVSRQRYWGAPIPMVTLAD---------
SYL_VIBPA       ----AIAAKLEAEG-----KGTKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_VIBCB       ----AIAAKLEAEG-----KGTKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_VIBVU       ----AIAAKLEAEG-----KGTKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_VIBVY       ----AIAAKLEAEG-----KGTKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_VIBCH       ----AIAAKLEAEG-----KGKKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_VIBC3       ----AIAAKLEAEG-----KGKKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_ALIF1       ----AIAAKLEAEG-----KGKKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_PHOPR       ----AIAAKLEAEG-----KGKKTVNFRLRDWGVSRQRYWGAPIPMVTTED---------
SYL_AERS4       ----AIANKLEALG-----HGKRTVNFRLRDWGVSRQRYWGAPIPMLTLAD---------
SYL_AERHH       ----AIASKLESLG-----CGKRTVNFRLRDWGVSRQRYWGAPIPMLTLAD---------
SYL_MARHV       ----EIADYLEAQG-----IGKRTVNYRLRDWGVSRQRYWGAPIPMMTLED---------
SYL_HAHCH       ----AVAEKLTAMG-----IGEKKINYRLRDWGVSRQRYWGAPIPMMTQED---------
SYL_SACD2       ----AISQTLQAAN-----KGKVTTNFRLRDWGVSRQRYWGSPIPIFNLPD---------
SYL_MARMS       ----AIAAWMVERN-----LGEVKVNYRLRDWGVSRQRYWGTPIPTINLKD---------
SYL_ALCBS       ----AIANWLSERS-----LGEKKVNYRLRDWGVSRQRYWGTPIPMVETED---------
SYL_PSEAB       ----AIGADLEAKG-----LGQARTQFRLRDWGISRQRYWGCPIPIIHCEA---------
SYL_PSEAE       ----AIGADLEAKG-----LGQARTQFRLRDWGISRQRYWGCPIPIIHCEA---------
SYL_PSEA7       ----AIGADLEAKG-----LGQARTQFRLRDWGISRQRYWGCPIPIIHCDA---------
SYL_PSEU5       ----AIEVALQKKG-----LGQARTQFRLRDWGISRQRYWGCPIPIIHCDS---------
SYL_PSEMY       ----AIVGDLEASA-----HGARKTQFRLRDWGISRQRYWGCPIPIIHCDS---------
SYL_PSEP1       ----AIEAALIRKE-----LGKSRTQFRLRDWGISRQRYWGCPIPIIHCPS---------
SYL_PSEPK       ----AIEAALIRKE-----LGKSRTQFRLRDWGISRQRYWGCPIPIIHCPS---------
SYL_PSEPG       ----AIEAALIRKE-----LGKSRTQFRLRDWGISRQRYWGCPIPIIHCPS---------
SYL_PSEE4       ----AIEAALIRKD-----LGKSRTQFRLRDWGISRQRYWGCPIPIIHCPS---------
SYL_PSEU2       ----AIEAALVKKS-----LGQSRTQFRLRDWGISRQRYWGCPIPIVHCDT---------
SYL_PSE14       ----AIEAALVKKS-----LGQSRTQFRLRDWGISRQRYWGCPIPIVHCDT---------
SYL_PSESM       ----AIEAALVKKA-----LGQSRTQFRLRDWGISRQRYWGCPIPIVHCDT---------
SYL_NEIMB       ----AVAAKLQSQG-----AGEPKTQYRLRDWGISRQRYWGCPIPIVHCEQ---------
SYL_NEIMF       ----AVAAKLQSQG-----AGEPKTQYRLRDWGISRQRYWGCPIPIVHCEQ---------
SYL_NEIG1       ----AVAAKLQSQG-----AGEPKTQYRLRDWGISRQRYWGCPIPIVHCEK---------
SYL_NEIM0       ----AIAAKLQSQG-----AGEPKTQYRLRDWGISRQRYWGCPIPIVHCEQ---------
SYL_NEIMA       ----AVAAKLQAIG-----AGEPKTQYRLRDWGISRQRYWGCPIPIVHCEQ---------
SYL_CHRVO       ----AIIGDLQAKS-----LGQKKTQYRLRDWGISRQRYWGCPIPIIHCPS---------
SYL_THIDA       ----AIAADLAAKG-----LGEKKTQFRLRDWGISRQRYWGCPIPIIHCET---------
SYL_DECAR       ----AIAADLAAKN-----LGDKKVQFRLRDWGISRQRYWGCPIPIIHCKT---------
SYL_AZOSB       ----AIAADLAAKG-----LGNKRVQYRLRDWGISRQRYWGCPIPMVRCDD---------
SYL_CUPMC       ----AIAADLAAKG-----LGEKKVTWRLRDWGISRQRYWGTPIPLIHC-----------
SYL_CUPPJ       ----AIAADLGAMG-----LGEKKITWRLRDWGISRQRYWGTPIPLIHC-----------
SYL_RALSO       ----AVAADLAAQG-----LGEKKTTWRLRDWGISRQRYWGTPIPLIHC-----------
SYL_JANMA       ----AIAADLAELG-----LGEKKITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_HERAR       ----TIAADLEELG-----LGEKKITYRLRDWGISRQRYWGTPIPMINC-----------
SYL_BURCH       ----AVAADLKAGG-----FGDKQVTWRLRDWGVSRQRYWGTPIPIIHC-----------
SYL_BURCA       ----AVAADLKAGG-----FGDKQVTWRLRDWGVSRQRYWGTPIPIIHC-----------
SYL_BURL3       ----AVAADLNAGG-----FGDKQVTWRLRDWGVSRQRYWGTPIPIIHC-----------
SYL_BURCM       ----AVAADLKAGG-----YGDKQVTWRLRDWGVSRQRYWGTPIPIIHC-----------
SYL_BURVG       ----AVAADLKAGG-----FGDKQVTWRLRDWGVSRQRYWGTPIPIIHC-----------
SYL_BURP0       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURPS       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURP6       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURP1       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURM7       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURM9       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURMA       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURMS       ----AIAAELKAGG-----LGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_BURTA       ----AIAADLKAGG-----FGDKQITYRLRDWGISRQRYWGTPIPIIHC-----------
SYL_PARXL       ----RIAADLKELG-----LGDKQITWRLRDWGVSRQRYWGTPIPIIHC-----------
SYL_POLAQ       ----TVASDLEKMG-----IGELKTTYRLRDWGISRQRYWGTPIPIIHCGDEG-------
SYL_BORBR       ----TIAADLAAQG-----LGEKQTTWRLRDWGISRQRYWGTPIPIIHCAD---------
SYL_BORPA       ----TIAADLAAQG-----LGEKQTTWRLRDWGISRQRYWGTPIPIIHCAD---------
SYL_BORPE       ----AIAADLAAQG-----VGEKQTTWRLRDWGISRQRYWGTPIPIIHCAD---------
SYL_BORPD       ----AIAADLAAQG-----LGEKQTTWRLRDWGISRQRYWGTPIPIIHCAD---------
SYL_BORA1       ----AIAADLNALG-----LGEKQTTYRLRDWGISRQRYWGTPIPIIHCQD---------
SYL_METPP       ----AVAAALAAQG-----LGDKKTTWRLRDWGISRQRYWGTPIPIIHCTGSGPGSD---
SYL_ACISJ       ----AVAHALAEKG-----LGELKTTWRLRDWGISRQRYWGTPIPIIHCES---------
SYL_ACIAC       ----AVAHALQEKG-----LGEKKTTWRLRDWGVSRQRYWGTPIPIIHCDE---------
SYL_RHOFT       ----AVAHKLAALG-----LGEKKTTWRLRDWGVSRQRYWGTPIPIIHCPE---------
SYL_VEREI       ----AVAHVLEQKG-----LGEKKTTWRLRDWGVSRQRYWGTPIPIIHCDQ---------
SYL_POLNA       ----AIAADLAALG-----LGEKKTTWRLRDWGVSRQRYWGTPIPIIHCDE---------
SYL_POLSJ       ----AVAADLAAKG-----LGEKKTTWRLRDWGVSRQRYWGTPIPIIHCDE---------
SYL_METCA       ----AIAADLEAKG-----LGQKRTQFRLRDWGISRQRYWGCPIPIIHCLS---------
SYL_DICNV       ----KLSEKLAALN-----LGEPKTQYRLRDWGISRQRYWGCPIPIIHHD----------
SYL_PSYCK       ----AMLAKLEPQE-----LAKKKIQYRLRDWGVSRQRYWGCPIPMVNCEH---------
SYL_PSYA2       ----AMLAKLEPQS-----LAKKKIQYRLRDWGVSRQRYWGCPIPMVNCEH---------
SYL_PSYWF       ----AMLAKLEPQK-----LAARKIQYRLRDWGVSRQRYWGCPIPMINCEY---------
SYL_ACIAD       ----AFLAKLEPQG-----LANSKVQFRLRDWGVSRQRYWGCPIPMINCDS---------
SYL_NITEU       ----AIAVELGQKA-----LGEKRVRYRLRDWGISRQRYWGCPIPLIHCDS---------
SYL_NITEC       ----AIATKLKLEE-----QGEKRVRYRLRDWGISRQRYWGCPIPLVHCDQ---------
SYL_NITMU       ----AIAVALQQKG-----LGEKRVHYRLRDWGISRQRYWGCPIPLIYCDA---------
SYL_METFK       ----AIAAALAAKN-----LGKRRTQYRLRDWGISRQRYWGCPIPIVHCPS---------
SYL_HYDCU       ----EMAKVLGELG-----LGEKQTNYRLRDWGISRQRYWGCPIPVIYCPA---------
SYL_XYLFA       ----VLAERFERQG-----RGQRRVNYRLRDWGVSRQRYWGCPIPVIYCPT---------
SYL_XYLFT       ----VLAERFERQG-----RGQRRVNYRLRDWGVSRQRYWGCPIPVIYCPT---------
SYL_XANC8       ----ALAERFERKG-----QGQRRINYRLRDWGVSRQRYWGCPIPVIYCAK---------
SYL_XANCP       ----ALAERFERKG-----QGQRRINYRLRDWGVSRQRYWGCPIPVIYCAK---------
SYL_XANCB       ----ALAERFERKG-----QGQRRINYRLRDWGVSRQRYWGCPIPVIYCAK---------
SYL_XANC5       ----ALAERFERKG-----QGQRRVNYRLRDWGVSRQRYWGCPIPVIYCAK---------
SYL_XANAC       ----ALAERFERKG-----QGQRRVNYRLRDWGVSRQRYWGCPIPVIYCAK---------
SYL_XANOR       ----ALAERFERKG-----QGQRRVNYRLRDWGVSRQRYWGCPIPVIYCPK---------
SYL_XANOM       ----ALAERFERKG-----QGQRRVNYRLRDWGVSRQRYWGCPIPVIYCPK---------
SYL_NITOC       ----AIAEHLERGG-----KGQRRVNYRLRDWGVSRQRYWGAPIPIVHCLH---------
SYL_ALKEH       ----AIGEKLEGLG-----KGERTVNYRLRDWGISRQRYWGAPIPMIQCPA---------
SYL_HALHL       ----AIAERLEAEG-----RGQRRVQYRLRDWGVSRQRYWGAPIPMIHCAD---------
SYL_CHRSD       ----AIAARLEANG-----QGTVKTNFRLRDWGVARQRYWGAPIPVKYGPE---------
SYL_BUCAI       ----KIKKILYKKK-----ILKEKINYKLQDWCISRQRYWGTPIPMAKFKN---------
SYL_BUCAP       ----KIKKTLLKKK-----IIKEKINYKLQDWCISRQRYWGTPIPMATKKN---------
SYL_BUCCC       ----KISNFLINKK-----IAKKYIYYKIQDWCISRQRYWGTPIPIVIDNK---------
SYL_BUCBP       ----RIIQDLENNH-----IGKKITYYRLRDWSISRQRYWGAPIPMAVLEN---------
SYL_WIGBR       ----RISKFLISNK-----IGKRSTHYKLRDWCISRQRYWGAPIPVLITKE---------
SYL_BLOPB       ----AIVKSLIARG-----VAQYKVNYRLKDWGISRQRYWGVPIPMVTLSN---------
SYL_BLOFL       ----YISKKLIDLK-----IAKTKIFYHLQDWGVSRQRYWGVPIPMIKLKN---------
SYL_BAUCH       ----IITDILVARG-----IGETKVNYRLRDWVISRQRYWGTPIPMMTLED---------
SYL_COXBU       ----VIADYLKNNG-----AGSRQTHYRLRDWGISRQRYWGTPIPIIYCKT---------
SYL_COXBR       ----VIADYLKNNG-----AGSRQTHYRLRDWGISRQRYWGTPIPIIYCKT---------
SYL_COXBN       ----VIADYLKNNG-----AGSRQTHYRLRDWGISRQRYWGTPIPIIYCKT---------
SYL_LEGPH       ----VITNFLEEND-----AGKATINYRLRDWGVSRQRYWGTPIPMIICEQ---------
SYL_LEGPC       ----VITNFLEEND-----AGKATINYRLRDWGVSRQRYWGTPIPMIICEQ---------
SYL_LEGPA       ----VITNFLEEND-----AGKATINYRLRDWGVSRQRYWGTPIPMIICEQ---------
SYL_LEGPL       ----VITNFLEEND-----AGKATINYRLRDWGVSRQRYWGTPIPMIICEQ---------
SYL_FRATT       ----AIKKYLTEQN-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCDD---------
SYL_FRAT1       ----AIKKYLTEQN-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCDD---------
SYL_FRATW       ----AIKKYLTEQN-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCDD---------
SYL_FRATF       ----AIKKYLTKQN-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCDD---------
SYL_FRATH       ----AIKKYLTKQN-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCDD---------
SYL_FRATO       ----AIKKYLTKQN-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCDD---------
SYL_FRATN       ----AIKKYLTEQN-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCDD---------
SYL_FRAP2       ----AIKKYLFDND-----KGYETTNFRIHDWGISRQRYWGCPIPMIHCND---------
SYL_RUTMC       ----EIAKTLTDKN-----LGRKKTNYRLQDWGISRQRYWGCPIPIINCQN---------
SYL_VESOH       ----SIAKTLIEKN-----LGNKKINYRLRDWGISRQRYWGCPIPIVNCKY---------
SYL_RICRS       ----EVIREFEKLG-----IGKRSVNYRLKDWGISRQRFWGCPIPMIHCEI---------
SYL_RICRO       ----EVIREFEKLG-----IGKRSVNYRLKDWGISRQRFWGCPIPMIHCEI---------
SYL_RICCN       ----EVIGEFEKLG-----IGKRSVNYRLKDWGISRQRFWGCPIPMIHCEI---------
SYL_RICM5       ----EVIGEFEKLG-----IGKRSVNYRLKDWGISRQRFWGCPIPIIHCET---------
SYL_RICFE       ----KVIDEFEKLG-----IGKRSVYYRLKDWGISRQRFWGCPIPMIHCEA---------
SYL_RICAH       ----KVIEEFEKLE-----IGKCTINYRLKDWGISRQRFWGCPIPMIHCEA---------
SYL_RICCK       ----KVIKEIEKLQ-----IGKRSINYRLKDWGISRQRFWGCPIPMIYCKV---------
SYL_RICBR       ----RVIEEFEKLG-----IGKRTINYRLKDWGISRQRFWGCPIPIIHCDS---------
SYL_RICPR       ----KVIEKFEKLG-----IGKRSVNYRLKDWSISRQRFWGCPIPMIHCKT---------
SYL_RICTY       ----KVISKFETLG-----IGKRSVNYRLKDWGISRQRFWGCPIPIIYCET---------
SYL_ORITB       ----KVINELQHKN-----IGQQVTNYKLKDWGISRQRFWGCPIPIIHCKS---------
SYL_WOLPM       ----AIVKKFEEKK-----IGKKTINYRLHDWGVSRQRYWGCPIPIIYCKD---------
SYL_WOLTR       ----VIVEKLEEKG-----IGKKTINYRLHDWGVSRQRYWGCPIPVIYCKN---------
SYL_EHRRW       ----SMIEKLISLG-----ICKKQVYYRLHDWGISRQRYWGCPIPIIYCKK---------
SYL_EHRRG       ----SMIEKLISLG-----ICKKQVYYRLHDWGISRQRYWGCPIPIIYCKK---------
SYL_EHRCJ       ----AMIAKLQLLG-----IGDKMTYYRIHDWGISRQRYWGCPIPIIYCEK---------
SYL_EHRCR       ----AIVAKLTFLG-----VCKEITYYRMHDWGISRQRYWGCPIPIIYCKK---------
SYL_ANAMM       ----AMIQKLESMG-----GCRRVTNYRLHDWGISRQRYWGCPIPVVHCEK---------
SYL_NEOSM       ----FIIEKISSIG-----IGEAKNSYRLRDWGISRQRYWGCPIPVVYCEK---------
SYL2_RHIL3      ----IVADRLSAASLGNAPQGERKVNFRLRDWGISRQRYWGCPIPVIHCDD---------
SYL_RHIEC       ----IVADRLSAASLGNAPQGQRMINFRLRDWGISRQRYWGCPIPVIHCDA---------
SYL_RHIME       ----TVASRLENDLLNGTPRAERKVNFRLRDWGISRQRYWGCPIPVIHCDD---------
SYL_SINMW       ----TIATRLEKDLLNGTPRAERKVNFRLRDWGISRQRYWGCPIPVIHCDD---------
SYL_AGRFC       ----AVVQKLSAQSLGNAPQAERKVNFRLRDWGISRQRYWGCPIPVIHCEV---------
SYL_BRUAB       ----EVASRLEKTDLVGRPQAVRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_BRUA2       ----EVASRLEKTDLVGRPQAVRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_BRUSI       ----EVASRLEKTDLVGRPQAVRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_BRUO2       ----EVASRLEKTDLVGRPQAVRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_BRUME       ----EVASRLEKTDLVGRPQAVRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_BRUSU       ----EVASRLEKTDLVGRPQAVRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_BRUC2       ----EVASRLEKTDLVGRPQAVRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_OCHA4       ----EVANRLEQTSLGNSPQASRKVQFRLRDWGISRQRYWGCPIPMIHCES---------
SYL_CHESB       ----EVASRLEKETLDGKPVAKRKVNFRLRDWGVSRQRYWGCPIPMIHCDT---------
SYL_RHILO       ----EVAKLLEQKTIGNRPMAERKVNFRLRDWGISRQRYWGCPIPMIHCED---------
SYL_BART1       ----EVAKRLEQQVLHGQPQGKKTVQFRLRDWGISRQRYWGCPIPMIHCTS---------
SYL_BARHE       ----EAAKRLEGQMLNGKPQAEKTVQFRLRDWGISRQRYWGCPIPMIHCTS---------
SYL_BARQU       ----AAAERLEGQMLNGQPQGKRTVQFRLRDWGISRQRYWGCPIPIIHCAA---------
SYL_BARBK       ----VVAQHLEKQVLNGQPQGQKTVQFRLRDWGVSRQRYWGCPIPMIHCAA---------
SYL_RHOP2       ----EVAKRLETATLGNAPVGERKVNFRLRDWGISRQRYWGCPIPVIHCEV---------
SYL_RHOPS       ----DVAKRLETATLGNAPVGERKVNFRLRDWGISRQRYWGCPIPVIHCEV---------
SYL_RHOPA       ----EVAKRLETEQLAGAPVGARKVNFRLRDWGISRQRYWGCPIPIIHCPT---------
SYL_RHOP5       ----EVAKRLETATRDGAPIGERKVNFRLRDWGISRQRYWGCPIPVIHCPK---------
SYL_NITHX       ----EVAKRLESEMRGNMPVGERKVNFRLRDWGISRQRYWGCPIPVIHCPK---------
SYL_NITWN       ----EVAKRLEGETRGNEPVAERKVNFRLRDWGISRQRYWGCPIPVIHCPN---------
SYL_BRASB       ----EVAKRLEAEQRGGAAVGERQVNFRLRDWGISRQRYWGCPIPVIHCPT---------
SYL_BRASO       ----EVAKRLESEQRGGSPIGERQVNFRLRDWGISRQRYWGCPIPVIHCAT---------
SYL_BRADU       ----EVAKRLESELRGNAPVGERQVNFRLRDWGISRQRYWGCPIPVIHCPT---------
SYL_RHOPB       ----AVAKRLEAIALGNRPVAQRQVNFRLRDWGISRQRYWGCPIPIIHCEV---------
SYL_AZOC5       ----QVARRLERFRVGEQPQGTRKVNFRLRDWGISRQRYWGCPIPIIHCDS---------
SYL_PARL1       ----AAIDRLEAKGI-----GEGTVNYRLRDWGISRQRYWGCPIPVIHCAS---------
SYL_CAUVC       ----AKAEAIARIEAAN--QGQGATVYRLRDWGVSRQRYWGCPIPVIHCEA---------
SYL_CAUSK       ----AKTEAVNRIEAMD--QGQGATVYRLRDWGVSRQRYWGCPIPVIHCEA---------
SYL_MARMM       ----ALERAITELEARK--LGKGATSYRLRDWLVSRQRYWGCPIPVIHCAD---------
SYL_HYPNA       ----AKRAAIAKIEAAG--QGEGKVNYRLRDWGVSRQRYWGCPIPVVHCED---------
SYL_RUEST       ----GVNTAVDKAEAEG--WGQGVTKFRLRDWGLSRQRYWGCPIPVVHCPD---------
SYL_RUEPO       ----AIDTTIDWMEAKG--LGTGVTKFRLRDWGLSRQRYWGCPIPVVHCDA---------
SYL_ROSDO       ----AIDAAIDFCESNG--IGQGVTKYRLRDWGLSRQRYWGCPIPVVHCDD---------
SYL_JANSC       ----AIDAAVTFCEAEG--VGQGVTKFRLRDWGLSRQRYWGCPIPVVHCDA---------
SYL_DINSH       ----AIEATIDFAEAAG--WGRGVEQFRLRDWGLSRQRYWGCPIPVVHCDK---------
SYL_RHOS1       ----GVAAAIDFCESQG--VGRGVTNYRLRDWGISRQRYWGCPIPVIHCET---------
SYL_RHOS4       ----GVAAAIAFCESQG--VGRGVTNYRLRDWGISRQRYWGCPIPVIHCET---------
SYL_RHOS5       ----AVAAAIDFCESKG--VGRGVTNYRLRDWGISRQRYWGCPIPVIHCET---------
SYL_PARDP       ----AVDAAIRHAEVAG--YGEGVTKFRLRDWGISRQRYWGCPIPVVHCDA---------
SYL_ZYMMO       ----TVIARAE-----KEGWGKGTTVFRLRDWGVSRQRYWGTPIPIIHCDS---------
SYL_SPHWW       ----AVIARAE-----AGGWGQGTTVWRLRDWGVSRQRYWGTPIPIIHCEG---------
SYL_NOVAD       ----AVIVRAE-----SEGWGEGKTVWRLRDWGVSRQRYWGTPIPFIHCEV---------
SYL_SPHAL       ----AVITRAE-----HEGWGKGTTVWRLRDWGVSRQRYWGTPIPFIHCAA---------
SYL_GRABC       ----EAITRLE-----AMGWGQGVTNWRLRDWGVSRQRYWGCPIPIIHCDQ---------
SYL_GLUOX       ----KVIERLE-----GLGAGKGVVNWRLRDWGISRQRYWGCPIPIIHCDT---------
SYL_ACICJ       ----RAIAELE-----SRGAGKGVVNWRLRDWGVSRQRAWGCPIPMIHCEV---------
SYL_MAGSA       ----EAIRRIEEMG-----RGERTINYRLRDWGVSRQRYWGCPIPVIHCEA---------
SYL_RHORT       ----RAIAHIAELG-----AGEGVVQFRLRDWGVSRQRYWGCPIPIIHCDD---------
SYL_MAGMM       ----RVAEYFEAQG-----IGKGTINYRLRDWGISRQRYWGNPIPMVHCAA---------
SYL_CAMJ8       ----KIISQFEAKN-----IGKRVVNFKIRDWGVSRQRYWGAPIPMIKCQS---------
SYL_CAMJJ       ----KIISQFEAKN-----IGKRVVNFKIRDWGVSRQRYWGAPIPMIKCQS---------
SYL_CAMJR       ----KIISQFEAKN-----IGKRVVNFKIRDWGVSRQRYWGAPIPMIKCQI---------
SYL_CAMJE       ----KIISQFEAKN-----IGKRVVNFKIRDWGVSRQRYWGAPIPMIKCQS---------
SYL_CAMJD       ----KIISQFEAKN-----IGKRVVNFKIRDWGVSRQRYWGAPIPMIKCQS---------
SYL_CAMC1       ----FIIEKFEKDG-----LGKRITNYKLRDWGISRQRYWGAPIPVVHCKC---------
SYL_CAMC5       ----AIIEKFEKDG-----LGKRITNYKLRDWGISRQRYWGAPIPIVHCPN---------
SYL_CAMFF       ----KIISKFEKEG-----WGNRVTNYKLRDWGISRQRYWGAPIPMIHCKK---------
SYL_CAMHC       ----KIIEKFEKEK-----IGKRVTNYKLRDWGISRQRYWGAPIPMIKCPK---------
SYL_ARCB4       ----AIIYHFEQNS-----FGIKKVNYKLRDWGVSRQRYWGAPIPFIHCEK---------
SYL_NITSB       ----KIIEYFEENG-----IGKRSVNYKLKDWLVSRQRYWGTPIPLIKCPK---------
SYL_WOLSU       ----KIIRYFEEHS-----LGRGVINYRLRDWGISRQRYWGTPIPLIHCPS---------
SYL_HELHP       ----RIIAHFENAS-----IGKGITNYRLRDWGVSRQRYWGAPIPMVHCQS---------
SYL_HELPY       ----QIIAYFEKEN-----LGKRVINYRLQDWGVSRQRYWGAPIPMIHCNH---------
SYL_HELPH       ----QIIAYFEKEN-----LGKRVINYRLQDWGVSRQRYWGAPIPMIHCKH---------
SYL_HELPJ       ----KIIAYFEKEN-----LGKRVINYRLQDWGVSRQRYWGAPIPMIHCKH---------
SYL_HELAH       ----KIIAYFEKEN-----LGKRVINYRLQDWGVSRQRYWGAPIPMIHCKN---------
SYL_THEMA       ----KVINWLEEKG-----IGKRSVQYKLRDWLISRQRYWGAPIPIIYCEK---------
SYL_THEP1       ----KVINWLEEKG-----IGKRSVQYKLRDWLISRQRYWGAPIPIIYCEK---------
SYL_THEM4       ----KIIEYLEEKG-----IGKRSVQYKLRDWLISRQRYWGAPIPIVYCEK---------
SYL_FERNB       ----EVTKYIEEKG-----FGKKSVQYKLRDWLISRQRYWGAPIPIVYCEK---------
SYL_PSELT       ----RVIQWLEERG-----IAKRSVQYKLRDWLISRQRYWGAPIPIVYCEK---------
SYL_CALS8       ----KITEYLEKNG-----YGKACVTYKLRDWLISRQRYWGAPIPIVYCDD---------
SYL_HUNT2       ----KIIDYIEQKG-----YGKRKINYRLRDWLISRQRYWGAPIPIIYCDD---------
SYL_DESHY       ----KMCDKAEHDG-----FGERKVNFRLRDWLISRQRYWGAPIPMIYCDH---------
SYL_SYNWW       ----AVIKFMEEKG-----IGQGTVNYRLRDWLISRQRYWGAPIPIVYCPE---------
SYL_CARHZ       ----IITQEAEKRG-----FGKYRVNYRLRDWLISRQRYWGAPIPVLYCEK---------
SYL_PELTS       ----AITRHLEEKG-----RGRFRVTYRLRDWLISRQRYWGAPIPIIYCDR---------
SYL_MOOTA       ----KVTEYLESIG-----RGRARVNYRLRDWLISRQRYWGAPIPMIYCDQ---------
SYL_DESRM       ----KVIKYAEEKG-----IGKGIVNYRLRDWLISRQRYWGTPIPIVYCEK---------
SYL_SYMTH       ----KVIAYAEEQG-----FGQKTVSYRLRDWLISRQRAWGAPIPIVYCDK---------
SYL_DESVH       ----RIADDLETTG-----NGRRTINYRLRDWNISRQRYWGAPIPVIYCDA---------
SYL_DESVV       ----RIADDLETTG-----NGRRTINYRLRDWNISRQRYWGAPIPVIYCDA---------
SYL_DESAG       ----KIAEWLEANG-----KGKRTVNYRLRDWNISRQRYWGAPIPVVYCEK---------
SYL_LAWIP       ----KITQYLEKIG-----KATRVVSWRLRDWNISRQRYWGTPIPIIYCKN---------
SYL_GEOMG       ----KIADYLAKEG-----IGTKTVNFRLRDWGISRQRYWGNPIPVIYCDI---------
SYL_GEOSL       ----KIADYLEQEG-----VGTKTVNYRLRDWGISRQRYWGNPIPVINCDI---------
SYL_GEOUR       ----QIADYLEKEG-----IGKKTVNYRLRDWGISRQRYWGNPIPMIYCDL---------
SYL_PELPD       ----AIADHLQEMG-----GGTKTVTYRLRDWGISRQRYWGNPIPVIYCDC---------
SYL_PELCD       ----KIAAHLEEQG-----VGRKTVNYRLRDWGVSRQRYWGTPIPIIYCPA---------
SYL_SYNAS       ----AIADHLIALG-----RGKRTIQYRLRDWGISRQRYWGAPIPMIMCPK---------
SYL_SYNFM       ----AITADLAGKG-----LGEQTVQYRLRDWGISRQRYWGAPIPIVYCDK---------
SYL_DESPS       ----KIIAYAEEKG-----FGSPLTTYRLRDWGISRQRYWGAPIPIIHCDS---------
SYL_FUSNN       ----KIAEYVEEKG-----YGKRTYKYRLKDWGISRQRYWGTPIPALYCEK---------
SYL_TRIV2       -------QAIVKYATEK-GFGKERIQYRLRDWLISRQRYWGAPIPVIHCPN---------
SYL_NOSS1       -------QAIVKYATEK-GFGKERIQYRLRDWLISRQRYWGAPIPVIHCPN---------
SYL_ACAM1       -------QAIIAKAETK-GWGKARVQYRLRDWLISRQRYWGVPIPVIHCPN---------
SYL_TRIEI       -------KAIIELAEDE-GYGKGRVQYRLRDWLISRQRYWGAPIPIIHCPK---------
SYL_SYNY3       -------QAIIKFAEDN-DYGRAKVQYRLRDWLISRQRYWGCPIPIIHCDD---------
SYL_SYNE7       -------AKIIAFAEEQ-GWGQAHVQYRLRDWLISRQRYWGCPIPIVHCPD---------
SYL_SYNP6       -------AKIIAFAEEQ-GWGQAHVQYRLRDWLISRQRYWGCPIPIVHCPD---------
SYL_THEEB       -------VAITEYATAQ-GWGREHVQYRLRDWLISRQRYWGVPIPIIHCPQ---------
SYL_SYNJB       ----QSVERAIAWLEAQ-GLGEKQINYRLRDWLISRQRYWGCPIPVIHCPH---------
SYL_SYNJA       ----QSVERAIAWLEEQ-GLGERQVNYRLRDWLISRQRYWGCPIPIIHCPH---------
SYL_GLOVI       -------LKIVEYAEQQ-GWGKGRVQYRLRDWLISRQRYWGCPIPMVYCPE---------
SYL_SYNS3       -------TAITNHGAEN-GWARAKRQYRLRDWLISRQRYWGCPIPIIHCDD---------
SYL_SYNPW       -------QEITAHGQEL-GWARPKRQYRLRDWLISRQRYWGCPIPVIHCDH---------
SYL_PROMM       -------VAITTHGASE-GWAQSKVQYRLRDWLISRQRYWGCPIPIIHCAS---------
SYL_PROM3       -------VAITTHGASK-GWAQSKVQYRLRDWLISRQRYWGCPIPIIHCAS---------
SYL_SYNSC       -------GAITGHGAEQ-GWARSKVTYRLRDWLISRQRYWGCPIPVIHCDN---------
SYL_SYNS9       -------GSITSHGETA-GWATSKVTYRLRDWLISRQRYWGCPIPVIHCPT---------
SYL_SYNPX       -------ERITRHGEQQ-GWAVAKVTYRLRDWLISRQRYWGCPIPIIHCPS---------
SYL_SYNR3       -------TAIIQAAEQR-GVGAAKITFRLRDWLISRQRYWGCPIPVIHCDD---------
SYL_PROMT       -------TQILEFGSNS-NWAKPKITYKLRDWLISRQRYWGCPIPIINCKK---------
SYL_PROM1       -------TKILEFGSNS-NWAKPKITYKLRDWLISRQRYWGCPIPIINCKK---------
SYL_PROMA       -------FMITKLGVKQ-GWAKNKVTYKLRDWLISRQRMWGCPIPIIYCPD---------
SYL_PROM0       -------LKISEEGVNN-RWAENKTQYRLRDWLISRQRYWGCPIPIVNCKK---------
SYL_PROM9       -------LKISEEGVNN-GWAENKIQYRLRDWLISRQRYWGCPIPIVNCKK---------
SYL_PROMS       -------LKIAEEGVNN-GWAENKIQYRLRDWLISRQRYWGCPIPIVNCKK---------
SYL_PROM2       -------LKISEEGVDN-GWAENKIQYRLRDWLISRQRYWGCPIPIVNCKK---------
SYL_PROMP       -------KHISEHGERN-GWAENKIQFRLRDWLISRQRYWGCPIPIIKCTN---------
SYL_PROM5       -------KQILEQGKIN-GWAEEEIHYRLRDWLISRQRYWGCPIPIIKCNN---------
SYL_SOLUE       ----QMSAYAEQHG-----FGKSAITFRIKDWGISRQRYWGTPIPVIHCPS---------
SYL_DEIRA       ---AAIIARLEERG-----VAKAKTTYRLRDWLFARQRYWGTPIPFVHCEK---------
SYL_DEIGD       ---APIIARLEALG-----VAKPKTTYRLRDWLVSRQRYWGTPIPIVYCPD---------
SYL_RUBXD       ---EKVTGWLRERG-----VGRPAVNYRLRDWLISRQRYWGTPIPIVYCER---------
SYL_CLOPE       ---EKIVEKLSSMG-----LGEKKVNFRLRDWLVSRQRYWGAPIPVVYCEE---------
SYL_CLOPS       ---EKIVEKLASMG-----LGEKKVNFRLRDWLVSRQRYWGAPIPVVYCEE---------
SYL_CLOP1       ---EKIVEKLASMG-----LGEKKVNFRLRDWLVSRQRYWGAPIPVVYCEE---------
SYL_CLOB8       ---KKIVEELEKDE-----LGAMKKNFRLRDWLVSRQRYWGAPIPVIYCDD---------
SYL_CLOB1       ---EAVISKLESMN-----LGRKKINYRLRDWLVSRQRYWGAPIPIIYCEK---------
SYL_CLOBH       ---EAVISKLESMN-----LGRKKINYRLRDWLVSRQRYWGAPIPIIYCEK---------
SYL_CLOBL       ---EAVISKLESMN-----LGRKKINYRLRDWLVSRQRYWGAPIPIIYCEK---------
SYL_CLONN       ---EAIVKKLQEQK-----LGNWKVNYRLRDWLVSRQRYWGAPIPVVYCDK---------
SYL_CLOAB       ---EAIVSKLSEND-----LGRWKVNYRLRDWLVSRQRYWGAPIPVVYCEK---------
SYL_CLOK5       ---EAVTKELENIG-----LGSGKTNYRLRDWLVSRQRYWGTPIPIIYCKK---------
SYL_CLOTE       ---SAVVEKLEKEN-----LGVKKINYRLRDWLVSRQRYWGAPIPIVYCDK---------
SYL_CALS4       ---VKIVEKLKAEG-----KAEFKVNYRMRDWLVSRQRYWGAPIPIIHCER---------
SYL_ROSCS       ---KATIAWLEANG-----KGKGTVTYRLRDWLISRQRYWGTPIPMLHLPD---------
SYL_ROSS1       ---KAAIAWLEAQG-----KGKGTVTYRLRDWLISRQRYWGTPIPMLHLPD---------
SYL_THEFY       ----RIIEILTERG-----TGKAAVNYRLRDWLVSRQRFWGTPIPIIHCPEC--------
SYL_ACIC1       ----RITRYLEDIG-----KGRAGVTYRLRDWLVSRQRFWGAPIPIVHCPGC--------
SYL_ARTS2       ----TAIDMLEKQG-----TGEKFVNFRLRDWLLSRQRFWGTPIPIIHCPAC--------
SYL_PAEAT       ----AAIEILEKLG-----TGEKFVNFRLRDWLLSRQRFWGTPIPIIHCGEC--------
SYL_RENSM       ----AAISLLSKIG-----TGEATTNYRLRDWLLSRQRFWGAPVPIIHCAEC--------
SYL_CLAMS       ----RVIEQLEAEG-----RGRAAKNYRLRDWLISRQRFWGTPIPIVYDAEG--------
SYL_CLAM3       ----RVIEQLEAEG-----RGRAAKNYRLRDWLISRQRFWGTPIPIVYDAEG--------
SYL_LEIXX       ----RVTEALQGSG-----LGAPAKNFRLRDWLISRQRYWGTPIPIVHCEAC--------
SYL_KINRD       ----KAIEDLTAAG-----KGRAAKNYRLRDWLISRQRYWGTPIPVVHTEN---------
SYL_NOCSJ       ----ATIEFLEQQG-----TGAGAVNFRLRDWLLSRQRYWGVPIPIIHCDAC--------
SYL_TROW8       ----NITRDLCAKS-----LGRREISYRLRDWLISRQRYWGTPIPILYDSNG--------
SYL_TROWT       ----NITRDLCAKS-----LGRREISYRLRDWLISRQRYWGTPIPILYDSNG--------
SYL_MYCPA       AEG----------------RGCARVEYKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCA1       AEG----------------RGCARVEFKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCLE       SEG----------------RGHARIEFKLRDWLFARQRYWGEPFPIIYDSD---------
SYL_MYCTA       SAG----------------RGRARIEFKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCBO       SAG----------------RGRARIEFKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCTU       SAG----------------RGRARIEFKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCBP       SAG----------------RGRARIEFKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCUA       SDG----------------YGQARIEFKLRDWLFARQRYWGEPFPIVYDAD---------
SYL_MYCSS       ADG----------------RGRARVEYKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCSK       ADG----------------RGRARVEYKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCSJ       ADG----------------RGRARVEYKLRDWLFARQRYWGEPFPIVYDSD---------
SYL_MYCS2       ADG----------------RGKRRVEYKLRDWLFARQRYWGEPFPIVYDAD---------
SYL_MYCVP       ADG----------------RGRERVEYKLRDWLFARQRYWGEPFPIVYDAD---------
SYL_MYCGI       ADG----------------RGRARVEYKLRDWLFARQRYWGEPFPVVYDSE---------
SYL_NOCFA       ADG----------------HGTGTIQYKLRDWLFARQRYWGEPFPIVYDED---------
SYL_RHOJR       ADG----------------TGKGTIQYKLRDWLFARQRYWGEPFPIVYDAE---------
SYL_SACEN       SHK----------------HGSGTVQYKLRDWLFARQRYWGEPFPVVYDSD---------
SYL_CORGB       EKE----------------LGRGTIQYKLRDWLFARQRYWGEPFPIVYDEN---------
SYL_CORGL       EKE----------------LGRGTIQYKLRDWLFARQRYWGEPFPIVYDEN---------
SYL_COREF       EKQ----------------LGRGTIQYKLRDWLFARQRYWGEPFPVVYDED---------
SYL_CORDI       DKQ----------------KGSEKIQYKLRDWLFARQRYWGEPFPVVYDEN---------
SYL_CORJK       SKG----------------VGSGKIQYKLRDWLFARQRYWGEPFPIVYDED---------
SYL_STRCO       RAG----------------AGAGTVNFRLRDWLFSRQRYWGEPFPIVYDED---------
SYL_STRAW       RKG----------------LGEGTVNFRLRDWLFSRQRYWGEPFPIVYDED---------
SYL_SALAI       ASG----------------HGSGAVTYRLRDWLFSRQRYWGEPFPIVYDET---------
SYL_BIFAA       SAG----------------VGKGTVSYRLRDWLFSRQRYWGEPFPIVYGED---------
SYL_BIFLO       SAG----------------VGKGTVSYRLRDWLFSRQRYWGEPFPIVYGED---------
SYL_FRACC       EIG----------------AGRSARSYRLRDWLFSRQRYWGEPFPIVFDVD---------
SYL_FRAAA       DGG----------------HGRLARSYRLRDWLFSRQRYWGEPFPIVFDDD---------
                                          :::::  ..*** :* *.*               

SYL_GEOKA       ---------GTMTPVPEEELPLVLP-KTDE--IRPSGTGESP-----LANIEE-WVNVVD
SYL_GEOTN       ---------GTMTTVPEEELPLVLP-KTDE--IKPSGTGESP-----LANIEE-WVNVVD
SYL_BACCZ       ---------GTMTAVKEEELPLVLP-KTEN--IRPSGTGESP-----LANIDE-WVNVVD
SYL_BACAH       ---------GTMTAVKEEELPLVLP-KTEN--IRPSGTGESP-----LANIDE-WVNVVD
SYL_BACAN       ---------GTMTAVKEEELPLVLP-KTEN--IRPSGTGESP-----LANIDE-WVNVVD
SYL_BACHK       ---------GTMTAVKEEELPLVLP-KTEN--IRPSGTGESP-----LANIDE-WVNVVD
SYL_BACC1       ---------GTMTAVKEEELPLVLP-KTDN--IRPSGTGESP-----LANIDE-WVNVVD
SYL_BACCR       ---------GTMTAVKEEELPLVLP-KTEN--IRPSGTGESP-----LANIDE-WVNVVD
SYL_BACCN       ---------GTMTAVKEEELPLVLP-KTDN--IRPSGTGESP-----LANIDE-WVNVVD
SYL_BACSU       ---------GTSTAVPEEELPLILP-KTDE--IKPSGTGESP-----LANIKE-WVEVTD
SYL_BACVZ       ---------GTSTAVPAEELPLILP-KTDE--IKPSGTGESP-----LANIKE-WVEVTD
SYL_BACLD       ---------GTSTPVPEEELPLILP-KTSE--IKPSGTGESP-----LANIKE-WVEVTD
SYL_BACP2       ---------GTSSAVSEEDLPLILP-KTTE--IKPSGTGESP-----LANIKD-WVEVVD
SYL_BACHD       ---------GTMSTVPEDELPLELP-KMSE--IKPSGTGESP-----LANATD-WLEVVD
SYL_BACSK       ---------GSMSALDESELPLVLP-DLEE--IKPSGTGESP-----LANAKD-WLEVVD
SYL_OCEIH       ---------GTMTAVPDEDLPLTLP-QVAE--IKPSGTGESP-----LANNTD-WVNVVD
SYL_STAES       ---------GSMTTVPEDELPLLLP-ETDE--IKPSGTGESP-----LANIDA-FVNVID
SYL_STAEQ       ---------GSMTTVPEDELPLLLP-ETDE--IKPSGTGESP-----LANIDA-FVNVID
SYL_STAAW       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAS       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAN       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAA1       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAM       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAA9       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAA2       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAA3       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAC       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAA8       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAT       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAE       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAB       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAAR       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDS-FVNVVD
SYL_STAHJ       ---------GTMTTVPEEELPLLLP-ETDE--IKPSGTGESP-----LANIDE-FVNVID
SYL_STAS1       ---------GSMTTVPEDELPLLLP-ETDE--IKPSGTGESP-----LANIDE-FVNVVD
SYL_LISMF       ---------GETTLVPEDELPLLLP-KATE--IKPSGTGESP-----LANLHD-WVNVTD
SYL_LISMO       ---------GETTLVPEEELPLLLP-KATE--IKPSGTGESP-----LANLHD-WVNVTD
SYL_LISIN       ---------GETTLVPEDELPLLLP-KATE--IKPSGTGESP-----LANLHD-WVNVTD
SYL_LISW6       ---------GETTLVPEEELPLLLP-KATE--IKPSGTGESP-----LANLHD-WVNVTD
SYL_ENTFA       ---------GTTTTVPESELPLRLP-VTSD--IRPSGTGESP-----LANIDE-WVNVVD
SYL_STRTD       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRT2       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRT1       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRP2       ---------GTSTAVPETELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRR6       ---------GTSTAVPETELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRPN       ---------GTSTAVPETELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRSV       ---------GTSTAVPENELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRGC       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRS2       ---------GTSTAVPENELPLVLP-KTSD--IKPSGTGESP-----LANLTD-WLEVVR
SYL_STRSY       ---------GTSTAVPENELPLVLP-KTSD--IKPSGTGESP-----LANLTD-WLEVVR
SYL_STRPD       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRPG       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRP6       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRPM       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRPF       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRPB       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRPC       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRP3       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRP1       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRP8       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANVTD-WLEVTR
SYL_STRA3       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRA5       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRA1       ---------GTSTAVPESELPLVLP-VTKD--IRPSGTGESP-----LANLTD-WLEVTR
SYL_STRMU       ---------GTSTALPENELPLVLP-VTKD--IKPSGTGESP-----LANLTD-WLEVTR
SYL_LACLM       ---------GTSTALSEDELPLVLP-VTSD--IKPSGTGESP-----LANLTD-WLEVTR
SYL_LACLA       ---------GTSTALSEDELPLVLP-VTSD--IKPSGTGESP-----LANLTD-WLEVTR
SYL_LACLS       ---------GTSTALPENELPLVLP-VTSD--IKPSGTGESP-----LANLTD-WLEVTR
SYL_LACSS       ---------GTTSVVPEDQLPLELP-LTSD--IKPSGTGESP-----LANLTD-WLNVTD
SYL_LACDA       ---------GETTLVPEDELPLRLP-KESN--IKPSGTPESP-----LANLTD-WVNVVD
SYL_LACDB       ---------GETTLVPEDELPLRLP-KESN--IKPSGTPESP-----LANLTD-WVNVVD
SYL_LACP3       ---------GETTLVPEDELPLTLP-EEAD--IKPSGTGESP-----LANLTD-WVNVVD
SYL_LACPL       ---------GETTLVPEDELPLRLP-ATKN--LEPSGTGESP-----LANIDD-WVNVVD
SYL_LACBA       ---------GETTLVPEDELPLKLP-AAKQ--LEPSGTGESP-----LANLDD-WVNVVD
SYL_PEDPA       ---------GETTLIPEDELPLRLP-AATD--IRPSGTGESP-----LANLDD-WVNVVD
SYL_LACS1       ---------GETTLVPEDELPLYLP-KATD--IKPSGTGESP-----LANLDD-WVNVVD
SYL_LACRD       ---------GTTSLVPEDELPLELP-KTDN--IEPSGTGESP-----LANVED-WVNVYD
SYL_LEUMM       ---------GTQTLVPESELPLRLP-EMTQEQLKPSGTGESP-----LANATD-WLNVTR
SYL_OENOB       ---------GKQTLVPESELPLRLP-HLNQDQMKPSGTGESP-----LANAKS-WLEVTR
SYL_SALRD       ---------GEDKPVPEEELPVTLP-DLDV--FEPSGTPEGP-----LATIED-WRETTD
SYL1_RHIL3      ---------GSVMPLPEECLPLLPP-ELDD--YAPTPDGEPP-----LARAQA-WVETIV
SYL_RHOBA       ---------GVRRLVPDDQLPVTLP-ELAD--FKPHGRPEPP-----LAKADD-DWLIVE
SYL_PELLD       ---------GSLGT--ETDLPLRLP-EVEAY--QPTETGESP-----LANIPE-WLYGTD
SYL_CHLPM       ---------GTLKP--ETSLPLMLP-EVEAY--QPTETGESP-----LANIPE-WLNGTD
SYL_CHLCH       ---------GTIRP--ETNLPLELP-AVEAY--HPTSTGESP-----LANITE-WLIGND
SYL_CHLTE       ---------GTMRP--ETNLPLTLP-EVEAY--QPTSTGESP-----LANIES-WLYGED
SYL_CHLPD       ---------GSIRT--ESNLPLQLP-EVEAY--QPSETGESP-----LATMHD-WLYGAD
SYL_LEPBL       ---------GITKPIPESELPLELPPNLEEF--KPSGTGESP-----LALAKE-WLQYKD
SYL_LEPBJ       ---------GITKPIPESELPLELPPNLEEF--KPSGTGESP-----LALAKE-WLQYKD
SYL_LEPIC       ---------GVTKPIPESELPLVLP-NLEEF--KPSGTGESP-----LALAKD-WLQYKD
SYL_LEPIN       ---------GVTKPIPESELPLVLP-NLEEF--KPSGTGESP-----LALAKD-WLQYKD
SYL_BACTN       ---------GMPYMIDEDCLPLELP-EVDKF--LPTETGEPP-----LGHAKE-WAWDTV
SYL_BACV8       ---------GMPYMIDSSKLPLELP-EVAKF--LPTETGEPP-----LGHATK-WAWDVE
SYL_BACFR       ---------GMPYMIDESCLPLELP-EVAKF--LPTETGEPP-----LGHATK-WAWDTV
SYL_BACFN       ---------GMPYMIDESCLPLELP-EVAKF--LPTETGEPP-----LGHATK-WAWDTV
SYL_PARD8       ---------SMPQMLPEECLPLLLP-EVDKF--LPTETGEPP-----LGHAVK-WAWDTV
SYL_PORGI       ---------GMPHALDEDRLPLRLP-EVDKF--LPTESGEPP-----LGRATG-WHTAEG
SYL_FLAPJ       ---------GLPQMIDAKHLPIALP-EVEKY--LPTEDGLPP-----LGNSAK-WAWNTI
SYL_FLAJ1       ---------GLPKMIDTQHLPIILP-EVEKY--LPTEDGLPP-----LGNAAV-WAWDIK
SYL_GRAFK       ---------GLPKMIDEKYLPLKLP-EVEKY--LPTETGEPP-----LGNATD-WAWDSK
SYL_CYTH3       ---------DIPYVLNESELPLALP-AIDEY--KPTETGEPP-----LARNKA-FADK--
SYL_BDEBA       ---------DGSKGVPVNELPVILP-EVADY--EPADTGEAP-----LARNAD-WVKYMD
SYL_SORC5       KGAAHTIRYDQPIAVDEASLPIELPPLADF---RPGDDPAGP-----LARAVD-WRFFQR
SYL_TREDE       ---------CGIVPLNEHDLPLTLPQVESYA---PTGTGESP-----LAAIDS-WVNTKC
SYL_TREPA       ---------CGVVPLPESALPLLLPETADFT---PTEDGQGP-----LARART-WLRVPC
SYL_BORAP       ---------GNAIPLEKNDLPLKLPETANYK---PSGTGESP-----LSRIKN-WVNVKD
SYL_BORBP       ---------GNAVPLEKNDLPLKLPKTANYK---PSRTGESP-----LSRIKD-WVNLKD
SYL_BORBU       ---------GNAIPLEENDLPLKLPEIANYK---PSGTGESP-----LSRIKD-WVNVKD
SYL_CHLTR       ---------GSCRPLRDYELPLLPPEIQDYR---PEGVGQGP-----LAKVRE-WVQVFD
SYL_CHLTA       ---------GSCRPLRDYELPLLPPEIQDYR---PEGVGQGP-----LAKVRE-WVQVFD
SYL_CHLMU       ---------GSCRPLKDDELPLLPPEIQDYR---PEGVGQGP-----LAKVKE-WVNVFD
SYL_CHLFF       ---------GTCRPLEDDELPLLPPEIQDYR---PEGFGQGP-----LAKVKE-WVDIHD
SYL_CHLCV       ---------GTCRPLEDDELPLLPPEIQDYR---PEGFGQGP-----LAKVKE-WVDIHD
SYL_CHLAB       ---------GTCRPLEDDELPLLPPEIQDYR---PKGFGQGP-----LAKVKE-WVDIHD
SYL_CHLPN       ---------GTHRPLEDDELPLLPPNIDDYR---PEGFGQGP-----LAKAQD-WVHIYD
SYL_PARUW       ---------GSVRLLDEDELPLCPPAITNYK---PTGDGKGP-----LTQIKE-WVEIID
SYL_ALKOO       ---------CGWVPVPESQLPVLLPEVESYE---PTDNGESP-----LANLRD-WVETTC
SYL_UREP2       ---------NQIKII--EDLPVLLPNLNEFK---PSKTGESP-----LANAQE-WLYVEI
SYL_UREPA       ---------NQIKII--EDLPVLLPNLNEFK---PSKTGESP-----LANAQE-WLYVEI
SYL_MYCPU       ---------NNVYLI--DGL-VELPFMENIK---PSKNGQSP-----LFNNKK-WLYFEK
SYL_MYCPE       ---------GNIIVEKN--LPLLLPETNDIK---PSGTGESP-----LANLTE-WVNVKI
SYL_MYCGA       ---------DNIYLLKDSELPVELPQLSDFS---PNKDGLPP-----LANADDQWLHPII
SYL_MYCGE       ---------NTPHLV--EQLPVELPLLENYK---PDGSGNSP-----LMRNQA-WVNIVK
SYL_MYCPN       ---------NQPHLV--KELPVTLPALANYQ---PDGSTNPP-----LWRNQE-WAKVKQ
SYL_MYCCT       ---------NNIILVEDDDLPITLPKTDYIK---PTNTGESP-----LANVKN-WVNVKI
SYL_MYCMS       ---------NNIVLIEDNNLPITLPITDYIK---PTNTGESP-----LANVKN-WVNVKI
SYL_MESFL       ---------QEITLIED--LPVELPRIKNIK---PSGTGESP-----LANVEE-WVNVEI
SYL_ACHLI       ---------GQIHLVPDDELPLELPYLEFIK---PSGTGESP-----LANARD-WLYVDI
SYL_PSEA6       ---------GESVPVPSDQLPVELPED-----VQMNGVISP------IKADPDWAK---T
SYL_COLP3       ---------GESVPVPTNELPVVLPED-----VVMNGTTSP------IKADPEWAK---T
SYL_IDILO       ---------GESVPVPEDQLPVKLPED-----VVMDGVNSP------IKSDPEWRK---T
SYL_PSEHT       ---------GNELAATDDMLPVRLPED-----VVMNGVTSP------IKADPNWAK---T
SYL_PSYIN       ---------GSVVPVPENELPVILPED-----VQMNGIVSP------IKADPDWAK---T
SYL_SALCH       ---------GTVLPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SALTI       ---------GTVLPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SALTY       ---------GTVLPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SALPB       ---------GTVLPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SALPA       ---------GTVLPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_CITK8       ---------GTVLPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SALAR       ---------GTVIPTPEDQLPVILPED-----VVMDGITSP------IKADPAWAK---T
SYL_SHIFL       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SHIF8       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SHIBS       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECOL6       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECOL5       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECO57       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPQWAK---T
SYL_SHISS       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECOLI       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECOLC       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SHIDS       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECOHS       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECOUT       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECOK1       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ECO24       ---------GTVMPTPDDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_KLEP7       ---------GTVLPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_CROS8       ---------GTVMPTPADQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_ENT38       ---------GTVLPTPEDQLPVILPED-----VVMDGISSP------IKADPEWAK---T
SYL_YERPA       ---------GTVVPTPEDQLPVILPED-----VVMDGISSP------IKADPEWAK---T
SYL_YERP3       ---------GTVVPTPEDQLPVILPED-----VVMDGISSP------IKADPEWAK---T
SYL_YERPE       ---------GTVVPTPEDQLPVILPED-----VVMDGISSP------IKADPEWAK---T
SYL_YERPN       ---------GTVVPTPEDQLPVILPED-----VVMDGISSP------IKADPEWAK---T
SYL_YERPS       ---------GTVVPTPEDQLPVILPED-----VVMDGISSP------IKADPEWAK---T
SYL_YERPP       ---------GTVVPTPEDQLPVILPED-----VVMDGISSP------IKADPEWAK---T
SYL_YERE8       ---------GTVVPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_SERP5       ---------GTVMPTPEDQLPVILPED-----VVMDGITSP------IKADPEWAK---T
SYL_PECAS       ---------GTVIPTPEDQLPVILPED-----VVMDGITSP------LKSNPEWAK---T
SYL_SODGM       ---------GTVVPTPEDQLPVVLPED-----VVMDGISSP------LKADPDWAK---T
SYL_PHOLL       ---------GTVVPVPADQLPVILPED-----VKMDGITSP------IKADPEWAK---T
SYL_MANSM       ---------GDVVPAPLQDLPIVLPED-----VVMDGVKSP------IKADPDWAK---T
SYL_ACTSZ       ---------GDVVPAPLQDLPIVLPED-----VVMDGVKSP------IKADPDWAK---T
SYL_HAES1       ---------GDVVVAPLQDLPIVLPED-----VVMDGVKSP------IKADPEWAK---T
SYL_HISS2       ---------GDVVVAPLQDLPIVLPED-----VVMDGVKSP------IKADPEWAK---T
SYL_PASMU       ---------GEVVPAPLQDLPIELPED-----VVMDGVKSP------IKADPEWAK---T
SYL_HAEIG       ---------GDVVPAPMEDLPIILPED-----VVMDGVKSP------IKADPNWAK---T
SYL_HAEIN       ---------GDVVPAPMEDLPIILPED-----VVMDGVKSP------INADPNWAK---T
SYL_HAEI8       ---------GDVVPAPMEDLPIILPED-----VVMDGVKNP------IKADPNWAK---T
SYL_HAEIE       ---------GDVVPAPMEDLPIILPED-----VVMDGVKSP------IKADLNWAK---T
SYL_ACTP2       ---------GEVVTVPMQDLPVILPED-----VVMNGVQSP------IKADPEWAK---T
SYL_HAEDU       ---------GEVVTVPLKDLPVILPEN-----VVMDGVQSP------IKSDPEWAK---T
SYL_SHESA       ---------GTVIPTPEDQLPVILPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHESM       ---------GTVIPTPEDQLPVILPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHESR       ---------GTVIPTPEDQLPVILPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHEON       ---------GTVIPTPEDQLPVILPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHEB9       ---------GTVIPTPADQLPVLLPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHEB5       ---------GTVIPTPADQLPVLLPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHEB8       ---------GTVIPTPADQLPVLLPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHESW       ---------GTVIPTPEDQLPVLLPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHEPC       ---------GTVIPTPADQLPVLLPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHEAM       ---------GTVMPTPEDQLPVILPED-----VVMDGVQSP------IKADKEWAK---T
SYL_SHEHH       ---------GTVIPTPEDQLPVILPED-----VVMDGIQSP------IKSDKEWAK---T
SYL_SHEPA       ---------GTVMPTPEDQLPVILPED-----VVMDGIQSP------IKSDKEWAK---T
SYL_SHELP       ---------GTVMPTPEDQLPVILPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHESH       ---------GTVVPTPEDQLPVILPED-----VVMDGIQSP------IKADKEWAK---T
SYL_SHEDO       ---------GTVMPTPEDQLPVILPED-----VVMDGIQSP------IKADKAWAE---T
SYL_SHEFN       ---------GTVVPTPEDQLPVILPED-----VVMDGIQSP------IKADKAWAE---T
SYL_VIBPA       ---------GEVHPVPADQLPVILPED-----VVMDGVTSP------IKADKEWAK---T
SYL_VIBCB       ---------GEVHPVPADQLPVILPED-----VVMDGVTSP------IKADKEWAK---T
SYL_VIBVU       ---------GQVHPVPADQLPVILPED-----VVMDGVTSP------IKADKEWAK---T
SYL_VIBVY       ---------GQVHPVPADQLPVILPED-----VVMDGVTSP------IKADKEWAK---T
SYL_VIBCH       ---------GQVHPVPADQLPVILPED-----VVMDGVTSP------IKADKEWAK---T
SYL_VIBC3       ---------GQVHPVPADQLPVILPED-----VVMDGVTSP------IKADKEWAK---T
SYL_ALIF1       ---------GEVHPVPADQLPVILPED-----VVMDGVTSP------IKADKEWAK---T
SYL_PHOPR       ---------GEVHPVPADQLPVILPEN-----VVMDGVTSP------IKADKEWAK---T
SYL_AERS4       ---------GTVVPTPEDQLPVLLPED-----VVMDGIQSP------IKADAEWAK---T
SYL_AERHH       ---------GTVVPTPEDQLPVLLPED-----VVMDGIQSP------IKADAEWAK---T
SYL_MARHV       ---------GTEMPVPDDQLPVRLPED-----VEMDGVQSP------IKADPEWCK---T
SYL_HAHCH       ---------GTEVPVPLADLPVRLPED-----VEMDGVKSP------IKADPNWSK---R
SYL_SACD2       ---------GGVIPVPADRLPVLLPED-----VQMDGVQSP------IKADKEWCK---A
SYL_MARMS       ---------GSVVPVPQDQLPVELPTD-----VIMDGVNSP------IKNNPDFSS---I
SYL_ALCBS       ---------GTLHPTPEDQLPVALPTD-----VEMDGVTSP------IKADPEWAK---T
SYL_PSEAB       ---------CGDVPVPADQLPVVLPED-----VVPDGSGSP------LAKMPEFYE-CSC
SYL_PSEAE       ---------CGDVPVPADQLPVVLPED-----VVPDGSGSP------LAKMPEFYE-CNC
SYL_PSEA7       ---------CGDVPVPAEQLPVVLPED-----VVPDGAGSP------LAKMPEFYE-CSC
SYL_PSEU5       ---------CGDVPVPEDQLPVVLPED-----VVPDGAGSP------LARMPEFYE-CTC
SYL_PSEMY       ---------CGDVPVPEDQLPVVLPED-----VVPDGAGSP------LAKMPEFYE-CTC
SYL_PSEP1       ---------CGDVPVPEDQLPVTLPEN-----VVPDGAGSP------LARMPEFYE-CSC
SYL_PSEPK       ---------CGDVPVPEDQLPVTLPEN-----VVPDGAGSP------LARMPEFYE-CSC
SYL_PSEPG       ---------CGDVPVPEDQLPVTLPEN-----VVPDGAGSP------LARMPEFYE-CTC
SYL_PSEE4       ---------CGDVPVPEDQLPVTLPEN-----VVPDGAGSP------LARMPEFYE-CTC
SYL_PSEU2       ---------CGDVPVPEDQLPVVLPED-----VVPDGAGSP------LARMPEFYE-CSC
SYL_PSE14       ---------CGDVPVPEDQLPVVLPED-----VVPDGAGSP------LARMPEFYE-CSC
SYL_PSESM       ---------CGDVPVPEDQLPVILPED-----VVPDGAGSP------LARMPQFYE-CSC
SYL_NEIMB       ---------CGDVPVPADQLPVVLPEN-----VVPDGMGSP------LAKMPEFYE-TAC
SYL_NEIMF       ---------CGDVPVPADQLPVVLPEN-----VVPDGMGSP------LAKMPEFYE-TAC
SYL_NEIG1       ---------CGDVPVPADQLPVVLPEN-----VVPDGMGSP------LAKMPEFYE-TSC
SYL_NEIM0       ---------CGDVPVPADQLPVVLPEN-----VVPDGMGSP------LAKMPEFYE-TAC
SYL_NEIMA       ---------CGDVPVPADQLPVVLPEN-----VVPDGMGSP------LAKMPEFYE-TTC
SYL_CHRVO       ---------CGDVPVPEKDLPVTLPEN-----VIPDGAGSP------LAKMPEFYE-TSC
SYL_THIDA       ---------CGDVPVPAEQLPVVLPED-----VVPDGSGNP------LNKRADFVN-CTC
SYL_DECAR       ---------CGDVPVPDDQLPVVLPEN-----VEITGAGSP------LAKMPEFYE-CQC
SYL_AZOSB       ---------CGDVPVPDEQLPVVLPEN-----VEITGRGSP------LAKMPEFYQ-CSC
SYL_CUPMC       -------DSCGVVPVPEKDLPVVLPED-----LVPDGTGNP------LAKDPRFLE-CTC
SYL_CUPPJ       -------DSCGVVPVPEQDLPVVLPED-----LVPDGTGNP------LNKDPRFLQ-CSC
SYL_RALSO       -------DSCGVVPVPEQDLPVRLPED-----LVPDGSGNP------LAKDARFLE-CTC
SYL_JANMA       -------KDCGDVPVPEKDLPVVLPED-----CVPDGSGNP------LNKHEKFLH-VDC
SYL_HERAR       -------ADCGAVPVPEKDLPVVLPED-----CVPDGSGNP------LNKHEAFLK-CDC
SYL_BURCH       -------PSCGDVPVPEQDLPVVLPED-----LVPDGSGNP------LAKSEAFLN-CTC
SYL_BURCA       -------PSCGDVPVPEQDLPVVLPED-----LVPDGSGNP------LAKSEAFLN-CTC
SYL_BURL3       -------PSCGDVPVPEQDLPVVLPED-----LVPDGSGNP------LAKSEAFLN-CAC
SYL_BURCM       -------PSCGDVPVPEQDLPVVLPED-----LVPDGSGNP------LAKSEAFLN-CSC
SYL_BURVG       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSEAFLN-CTC
SYL_BURP0       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURPS       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURP6       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURP1       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURM7       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURM9       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURMA       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURMS       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CTC
SYL_BURTA       -------PSCGDVPVPEQDLPVVLPED-----LVPDGTGNP------LAKSDAFLN-CAC
SYL_PARXL       -------PTCGDVPVPEKDLPVVLPED-----LVPDGTGNP------LARSEAFVN-CTC
SYL_POLAQ       ------NPGCGAVPVPEADLPVVLPED-----CVPDGSGNP------LNKRADFLN-VKC
SYL_BORBR       ---------CGPVPVPEQDLPVVLPDD-----LIPDGSGNP------LAKNEAFLS-CSC
SYL_BORPA       ---------CGPVPVPEQDLPVVLPDD-----LIPDGSGNP------LAKNEAFLS-CSC
SYL_BORPE       ---------CGPVPVPEQDLPVVLPDD-----LIPDGSGNP------LAKNEAFLS-CSC
SYL_BORPD       ---------CGPVPVPEQDLPVVLPDD-----LIPDGSGNP------LAKNEAFLS-CSC
SYL_BORA1       ---------CGPVPVPEQDLPVVLPDD-----LIPDGSGNP------LAKNEAFLS-CSC
SYL_METPP       ------NPGCGDVPVPEQDLPVLLPED-----LIPDGSGNP------LNKSAAFLN-VAC
SYL_ACISJ       ---------CGAVPVPEKDLPVVLPQD-----LVPDGSGNP------LAKCEAFLK-VDC
SYL_ACIAC       ---------HGAVPVPEKDLPVVLPQD-----CIPDGSGNP------LHKHEGFHAGVKC
SYL_RHOFT       ---------HGAVPVPEKDLPVVLPQD-----CVPDGSGNP------LHKHEGFHAGVVC
SYL_VEREI       ---------HGAVPVPEKDLPVVLPQD-----CIPDGTGNP------LHSHQGFHAGVTC
SYL_POLNA       ---------HGAVPVPEKDLPVVLPMD-----CIPDGSGNP------LHKHEGFHAGVVC
SYL_POLSJ       ---------HGAVPVPEKDLPVVLPQD-----CVPDGSGNP------LHRHEGFHAGVVC
SYL_METCA       ---------CGDVPVPAEQLPVVLPED-----VTID-VGSP------LKKMPEWYS-TTC
SYL_DICNV       -----------DGEALADTLPVVLPED-----KIPDGGGSV------LAQSPDYYE---C
SYL_PSYCK       ---------CGTVPVEEQDLPVVLPTD-----VVPDGRGNP------LKNIPEFVN-TTC
SYL_PSYA2       ---------CGTVPVEEQDLPVILPTD-----VVPDGRGNP------LKNIPEFVN-TTC
SYL_PSYWF       ---------CGNVPVDEADLPIKLPTD-----VVPDGRGNP------LKNIPEFVN-TTC
SYL_ACIAD       ---------CGQVPVPEEQLPVVLPTD-----VVPDGSGNP------LNKMPEFYE-TTC
SYL_NITEU       ---------CGVVPVADDQLPVVLPED-----LVPDGSGNP------LAKTPSFYE-CTC
SYL_NITEC       ---------CGVVPVPDDQLPVTLPED-----LVPDGSGNP------LTKTPSFYE-CTC
SYL_NITMU       ---------CGVVPVPDEQLPVVLPED-----LVPDGSGNP------LAKTPSFYE-CSC
SYL_METFK       ---------CGEVPVPAEQLPVVLPED-----VVMDGVGSP------IKKDPAFYE-TTC
SYL_HYDCU       ---------CGALPVPEKDLPVRLPED-----VVPDGSGSP------LAKLDSFKK-CEC
SYL_XYLFA       ---------CGAVPVPEDQLPVILPEN-----VAFSGTGSP------IKTDPEWRKTT-C
SYL_XYLFT       ---------CGAVPVPENQLPVILPEN-----VAFSGTGSP------IKTDPEWRKTT-C
SYL_XANC8       ---------CGAVPVPEDQLPVVLPEN-----VEFAGTGSP------IKTDPTWRQTT-C
SYL_XANCP       ---------CGAVPVPEDQLPVVLPEN-----VEFAGTGSP------IKTDPTWRQTT-C
SYL_XANCB       ---------CGAVPVPEDQLPVVLPEN-----VEFAGTGSP------IKTDPTWRQTT-C
SYL_XANC5       ---------CGAVPVPEDQLPVVLPEN-----VEFSGTGSP------IKTDPTWRQTT-C
SYL_XANAC       ---------CGAVPVPEDQLPVVLPEN-----VEFSGTGSP------IKTDPTWRQTT-C
SYL_XANOR       ---------CGAVPVPEDQLPVVLPEN-----VEFACTGSP------IKTDPTWRQTT-C
SYL_XANOM       ---------CGAVPVPEDQLPVVLPEN-----VEFACTGSP------IKTDPTWRQTT-C
SYL_NITOC       ---------CGAIPVPEEDLPVVLPER-----VRFDGIRSP------LKQLPEFYQTS-C
SYL_ALKEH       ---------CGDVPVPDEDLPVVLPED-----VDVTGGGSP------LKDLPAFYQTT-C
SYL_HALHL       ---------CGPVPVPDDQLPVTLPED-----VEISGGGSP------LKSMPAFYQTA-C
SYL_CHRSD       ---------GQTVPLTDDELPVALPME-----VEVDASGSP------LKKMPAFYDL---
SYL_BUCAI       ---------GKMIPIPENQLPVVLPKI-----RKNTNLLQQ-----AINFNSKWAE---I
SYL_BUCAP       ---------GEIIAIPEKNLPVLLPEI-----KNYSDSLQK-----PMDSSSKWAN---I
SYL_BUCCC       ---------KNIITVPKKKLPVILPKY-----IYKKKSLQ------SLSLYSLWLK---T
SYL_BUCBP       ---------KKNVPIPKQYLPIILPET-----IPFKNIKP-------LSNNILLKK---I
SYL_WIGBR       ---------NKILVVSENELPVILPKA-----KN--NNIIH-----SLNSYKDWIY---V
SYL_BLOPB       ---------GVVKPVLLDRLPVILPKN-----MSTIHRSNDGYVDNSLKMYPNWIQ---T
SYL_BLOFL       ---------GIIQPVPKSELPVILPEI-----IYTKNNEN-----NILSKNFNWTH---T
SYL_BAUCH       ---------GTVVPTPVDQLPVILPEY-----LLINSISNP------LKDDHLWMK---T
SYL_COXBU       ---------CGTVPVPENQLPVLLPED-----IIPTGHGSP------LKETASFYK-TRC
SYL_COXBR       ---------CGTVPVPENQLPVLLPED-----IIPTGHGSP------LKETASFYK-TRC
SYL_COXBN       ---------CGTVPVPENQLPVLLPED-----IIPTGHGSP------LKETASFYK-TRC
SYL_LEGPH       ---------CGIVPVPDEELPVVLPEN-----VDFTGTGSP------LTQCKEFVN-VTC
SYL_LEGPC       ---------CGIVPVPDEELPVVLPEN-----VDFTGTGSP------LTQCKEFVN-VTC
SYL_LEGPA       ---------CGIVPVPDEELPVVLPEN-----VDFTGTGSP------LTQCKEFVN-VTC
SYL_LEGPL       ---------CGIVPVPDEELPVVLPEN-----VDFTGTGSP------LTQCKEFVN-ITC
SYL_FRATT       ---------CGAVPEKEENLPVRLPTD-----VALTEAGSP------LKDIPEFIN-VAC
SYL_FRAT1       ---------CGAVPEKEENLPVRLPTD-----VALTEAGSP------LKDIPEFIN-VAC
SYL_FRATW       ---------CGAVPEKEENLPVRLPTD-----VALTEAGSP------LKDIPEFIN-VAC
SYL_FRATF       ---------CGAVPEKEENLPVRLPTD-----VALTEAGSP------LKDIPEFIN-VAC
SYL_FRATH       ---------CGAVPEKEENLPVRLPTD-----VALTEAGSP------LKDIPEFIN-VAC
SYL_FRATO       ---------CGAVPEKEENLPVRLPTD-----VALTEAGSP------LKDIPEFIN-VAC
SYL_FRATN       ---------CGAVPEKEENLPVRLPTD-----VTLTEAGSP------LKDIPEFIN-VAC
SYL_FRAP2       ---------CGLVPEKEENLPVKLPTN-----VTLTEAGSP------LKDIPEFLN-VAC
SYL_RUTMC       ---------CGIVVVPEADLPVVLPEV-----MSFDSVGSL------IKKMPEFYQ-TTC
SYL_VESOH       ---------CGSVTVKVKDLPVILPEK-----VKFYDVSSP------IKKMPNFYQ-TIC
SYL_RICRS       ---------CGIVPVPYKDLPVTLPDD-----VNFDGHGNP------LDHHPSWKH-VNC
SYL_RICRO       ---------CGIVPVPYKDLPVTLPDD-----VNFDGHGNP------LDHHPSWKH-VNC
SYL_RICCN       ---------CGIVPVPYKDLPVTLPDD-----VNFDGHGNP------LDHHPSWKH-VNC
SYL_RICM5       ---------CGIVPVPYKDLPVTLPDD-----VNFDGHGNP------LDHHPSWKH-VDC
SYL_RICFE       ---------CGIVPVPCSDLPVTLPDD-----VSFDGHGNP------LDHHPSWKH-VNC
SYL_RICAH       ---------CGIVPVPYKDLPVTLPDD-----VSFDGHGNP------LAHHPSWKH-VNC
SYL_RICCK       ---------CDIVPVPYKDLPVTLPDN-----VKFNGHGNP------LDHHPTWKH-VNC
SYL_RICBR       ---------CGLVPVPDSDLPVTLPDD-----VKFDGHGNP------LDNHPTWKH-VNC
SYL_RICPR       ---------CGVVPVPYKDLPVTLPDD-----VSFDSNYNP------LEHHSSWKY-VNC
SYL_RICTY       ---------CGIVPVPYKDLPVTLPDD-----VSFDNNYNP------LEHHPSWKH-VNC
SYL_ORITB       ---------CGAVPVPYEDLPVILPEHG----VEFTGKGNP------LDNHHSWKY-VKC
SYL_WOLPM       ---------CGTVPVPEKDLPVVLPID-----VEFTSGGNP------LDKHPTWKF-VDC
SYL_WOLTR       ---------CGTVPVPEEDLPVTLPTD-----VDFTSGGNP------LDKHPTWKF-VNC
SYL_EHRRW       ---------CGIVPVDKKDLPITLPED-----IDFTKSGNP------LDNHPTWKY-TKC
SYL_EHRRG       ---------CGIVPVDKKDLPITLPED-----IDFTKSGNP------LDNHPTWKY-TKC
SYL_EHRCJ       ---------CGTVPVSRKDLPVTLPQD-----VDFTKSGNP------LDNHPTWKY-VKC
SYL_EHRCR       ---------CGTVPVDKKDLPVTLPKD-----VDFTKYGNP------LDNHPTWKY-VKC
SYL_ANAMM       ---------CGIVPVDRQDLPISLPEE-----VDFSRGGNP------LDHHPTWKH-VQC
SYL_NEOSM       ---------CSMQPVKVEDLPVTLPEE-----VEFTVQGNP------LEHHPTWKY-TNC
SYL2_RHIL3      ---------CGVVPVPKADLPVKLPDD-----VTFDQPGNP------LDRHPTWRH-VSC
SYL_RHIEC       ---------CGVVPVPKKDLPVKLPED-----VTFDQPGNP------LDRHPTWRH-VAC
SYL_RHIME       ---------CGVVPVPKADLPVTLPPD-----VTFDKPGNP------LDRHPTWRH-VAC
SYL_SINMW       ---------CGVVPVPKTDLPVTLPPD-----VTFDKPGNP------LDRHPTWRH-VAC
SYL_AGRFC       ---------CGVVPVPKKDLPVKLPDD-----VTFDVPGNP------LDRHSTWRH-VSC
SYL_BRUAB       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_BRUA2       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_BRUSI       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_BRUO2       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_BRUME       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_BRUSU       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_BRUC2       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_OCHA4       ---------CGVNPVPRADLPVKLPDD-----VEFDRPGNP------LDRHATWRH-VKC
SYL_CHESB       ---------CGVVPVPKEELPVKLPDD-----VDFDRPGNP------LDRHPTWRH-VKC
SYL_RHILO       ---------CGVVPVPKADLPVKLPDD-----VDFDRPGNP------LDRHPTWRH-VKC
SYL_BART1       ---------CGVVPVPRADLPVVLPDD-----VTFDQPGNP------LARHEMWQD-VAC
SYL_BARHE       ---------CGVVPVPRADLPVVLPDD-----VTFEQPGNP------LVCHETWKS-VAC
SYL_BARQU       ---------CGVVPVPRADLPVELPDD-----VTFDQPGNP------LERHEKWQK-VAC
SYL_BARBK       ---------CGVVPVPRADLPVVLPED-----VTFDRPGNP------LARHETWQT-VAC
SYL_RHOP2       ---------CGVVPVPDKDLPVVLPED-----VSFDKPGNA------LDHHPTWKH-VPC
SYL_RHOPS       ---------CGVVPVPDKDLPVVLPED-----VSFDKPGNA------LDHHPTWKH-TAC
SYL_RHOPA       ---------CDVVPVPDADLPVVLPED-----VSFDKPGNA------LDHHPTWKH-VTC
SYL_RHOP5       ---------CDVVPVPDADLPVVLPED-----VSFDKPGNA------LDHHPTWKH-VTC
SYL_NITHX       ---------CDVVPVPENDLPVTLPED-----VTFDKPGNA------LDHHPTWKH-VTC
SYL_NITWN       ---------CDVVPVPEKDLPVTLPED-----VTFDRPGNA------LDHHPTWKH-VDC
SYL_BRASB       ---------CDVVPVPAKDLPVVLPDD-----VTFDKPGNA------LDHHPTWKH-VTC
SYL_BRASO       ---------CDVVPVPAGDLPVVLPDD-----VTFDKPGNA------LDHHPTWKH-VTC
SYL_BRADU       ---------CDVVPVPDADLPVKLPDD-----ATFDKPGNA------LDHHPTWKH-VTC
SYL_RHOPB       ---------CGVVPVPIKDLPVKLPDD-----IEFDRPGNP------LDRHPTWKH-VAC
SYL_AZOC5       ---------CGPVAVPREQLPVELPDD-----VTFDRPGNP------LDRAKAWRD-VPC
SYL_PARL1       ---------CGTLPVPRDQLPVVLPDD-----VNFSEPGNP------LDRHPSWKH-VDC
SYL_CAUVC       ---------CGVVPVPEDQLPVALPDD-----VTFDKPGNP------LLRHPTWRH-TTC
SYL_CAUSK       ---------CGPVGVPEDQLPVVLPDD-----VAFDKPGNP------LLRHPTWRH-TTC
SYL_MARMM       ---------CGVVPVPEDQLPVVLPED-----VTFDHPSNP------LERHPTWKN-ADC
SYL_HYPNA       ---------CGVVGVPAADLPVRLPED-----VTFDVPGNP------LDRHPDWKH-VDC
SYL_RUEST       ---------CGVVPEKKENLPIALPYDEDGKAIDFSVPGNP------LDRHPSWRN-CAC
SYL_RUEPO       ---------CGVVPEKKENLPIRLPDD-----VTFDVPGNP------LDRHPTWRD-CAC
SYL_ROSDO       ---------CGVVPEKKENLPIELPYD-----VSFDTPGNP------LNRHPTWRD-TPC
SYL_JANSC       ---------CGVVPEKKENLPIELPYD-----VTFDVPGNP------LDRHPTWRN-TPC
SYL_DINSH       ---------CGVVPERKENLPIALPYDEDGRPIDFSIPGNP------LDRHPSWRD-CAC
SYL_RHOS1       ---------CGVVPEAKENLPVRLPDD-----VSFDVPGNP------LDRHPTWRD-CTC
SYL_RHOS4       ---------CGVVPEAKENLPVRLPDD-----VSFDVPGNP------LDRHPTWRD-CTC
SYL_RHOS5       ---------CGVVPEAKENLPVRLPDD-----VTFDVPGNP------LDRHPTWRD-CTC
SYL_PARDP       ---------CGTVPEAKANLPVLLPQD-----VSFEVPGNP------LNRHPTWAA-TTC
SYL_ZYMMO       ---------CGAVPVPKDQLPVTLPDD-----INFDKPGNP------LERHPTWKN-VTC
SYL_SPHWW       ---------CGAVPVPHDQLPVVLPED-----VAFDIPGNP------LDRHPTWKH-VDC
SYL_NOVAD       ---------CGVVPVPKKHLPVTLPED-----VSFDVPGNP------LDRHPTWKH-VDC
SYL_SPHAL       ---------CGTVPVPKSQLPVTLPDD-----VDFSVPGNP------LDRHPTWKH-VAC
SYL_GRABC       ---------CGPVPVPADQLPVTLPED-----VTFDRPGNP------LDHHPSWKH-VTC
SYL_GLUOX       ---------CGPVPVPDEQLPVILPED-----VTFDRPGNP------LDHHPTWKH-VNC
SYL_ACICJ       ---------CGTVPVPEKDLPVRLPDD-----LPFDRPGNA------LDHHPSWKH-VAC
SYL_MAGSA       ---------CGTVPVPAEQLPVVLPED-----VSFDKPGNP------LDHHPTWKH-VDC
SYL_RHORT       ---------CGPVPVPEDQLPVLLPED-----VTFDKPGNP------LDHHPTWKH-VAC
SYL_MAGMM       ---------CGVVPVPVAQLPIQLPNE-----VDFSEPGNP------LERHPSWKT-CDC
SYL_CAMJ8       ---------CGIVPQKLENLPITLPED-----VQITGEGNP------LDKHPTWKN-CIC
SYL_CAMJJ       ---------CGIVPQKLENLPITLPED-----VQITGEGNP------LDKHPTWKN-CIC
SYL_CAMJR       ---------CGIVPQKLENLPITLPED-----VQITGEGNP------LDKHPTWKN-CIC
SYL_CAMJE       ---------CGIVPQKLENLPITLPED-----VQITGEGNP------LDKHPTWKN-CIC
SYL_CAMJD       ---------CGIAPQKLENLPITLPED-----VQITGEGNP------LDKHPTWKN-CIC
SYL_CAMC1       ---------CGVVPEKEENLPIALPED-----VEITGEGNP------LDKHPTWKF-TKC
SYL_CAMC5       ---------CGVVPENEQNLPIALPDD-----VVITGEGNP------LDKHPTWKY-TKC
SYL_CAMFF       ---------CGVVPENISNLPVKLPDD-----VVITGEGNP------LDKHSEFKN-CKC
SYL_CAMHC       ---------CGLVPEKIKNLPVTLPDD-----IKITGKGNP------LDKHPTWKH-CTC
SYL_ARCB4       ---------CGLVPEKIENLPVALPED-----VEITGEGNP------LDTHPTWKH-CTC
SYL_NITSB       ---------CGIVPEKKENLPVTLPED-----VEITGEGNP------LELHPTWKK-TTC
SYL_WOLSU       ---------CGIVPEDFSNLPITLPED-----VIIDGEGNP------LEKHPAWKE-CRC
SYL_HELHP       ---------CGIVPEKIENLPITLPED-----VVIDGEGNP------LDKHLVWKD-CLC
SYL_HELPY       ---------CGIVPE--TQLPVTLPED-----IVIDGEGNP------LEKHASWKF-TQC
SYL_HELPH       ---------CGIVPE--TQLPVTLPED-----IVIDGEGNP------LEKHASWKF-AQC
SYL_HELPJ       ---------CGIVPE--TQLPVTLPED-----IVIDGEGNP------LEKHASWKF-AQC
SYL_HELAH       ---------CGIVPE--TQLPVTLPED-----IVIDGEGNP------LEKHASWKF-TQC
SYL_THEMA       ---------CGVVPVPEEDLPVRLPKD-----VEFLPTGQSP-----LSFHEGFKK-TKC
SYL_THEP1       ---------CGVVPVPEEDLPVRLPKD-----VEFLPTGQSP-----LSFHEGFKR-TKC
SYL_THEM4       ---------CGIVPVPEKDLPVKLPKD-----VEFLPTGQSP-----LSLDEQFLN-TTC
SYL_FERNB       ---------CGIVPVPEKDLPVRLPEN-----VEFLPTGQSP-----LTLSEEFKH-TTC
SYL_PSELT       ---------CGMVPVPEKSLPVQLPYD-----VEFLPTGQSP-----LMLNDEFRK-TSC
SYL_CALS8       ---------CGIVPVPEEELPVLLPYN-----VEFKPTGQSP-----LAYCEEFVN-TTC
SYL_HUNT2       ---------CGAVPVPEEDLPVILPTD-----IKFSGVGESP-----LSTSETFIS-APC
SYL_DESHY       ---------CGIVPVPQDQLPVMLPDD-----VVFKAG-ENP-----LTTSESFKQ-TIC
SYL_SYNWW       ---------CGPVAVPEEELPLYLPED-----IDFKPYAESP-----LKHLERFYK-TTC
SYL_CARHZ       ---------CGIVPVPEDQLPVVLPYN-----VEFRPTGESP-----LKYVPEFLN-ATC
SYL_PELTS       ---------CGTVPVPESDLPVLLPMD-----VEFKPTGQSP-----LAECPEFVN-AAC
SYL_MOOTA       ---------CGIVPVPEEDLPVILPEG-----VEFRPTGESP-----LTYCPEFVN-TTC
SYL_DESRM       ---------CGTVPVPEDQLPVILPTD-----VAFKPTGESP-----LKGRPDFVH-TTC
SYL_SYMTH       ---------CGTVPVPEKDLPVRLPDD-----LDFTGEGGSP-----LARHEGFVN-TTC
SYL_DESVH       ---------CGVVPEKEENLPVVLPLD-----VKTHDDGRSP-----LPHTPAFYE-CTC
SYL_DESVV       ---------CGVVPEKEENLPVVLPLD-----VKTHDDGRSP-----LPHTPAFYE-CTC
SYL_DESAG       ---------CGIVPEKAENLPVRLPLD-----IKTRSDGRSP-----LGETPEFYE-CRC
SYL_LAWIP       ---------CGVVSVPKNELPVILPTN-----ITINEDGSSP-----LPQESSFID-CMC
SYL_GEOMG       ---------CGVVPVPEKDLPVVLPMD-----VEFTGEGGSP-----LKKLDSFVN-VPC
SYL_GEOSL       ---------CGVVPVPDKDLPVVLPMD-----AEFTGEGGNP-----LARVESFVN-VTC
SYL_GEOUR       ---------CGAVPVPETDLPVVLPMD-----ATFTGEGGNP-----LDKVDSFVN-TTC
SYL_PELPD       ---------CGVVPVPEKDLPVRLPMD-----VEFTGEGGSP-----LARLESFIN-VPC
SYL_PELCD       ---------CGIVPVPEEDLPVLLPMD-----VEISGEGGSP-----LARHQEFLK-VTC
SYL_SYNAS       ---------CGTVPVPEAELPVVLPRD-----VDFSGEGGSP-----LAKHPEFLN-TTC
SYL_SYNFM       ---------CGTVPVPEKDLPVVLPTD-----VALLPNGASP-----LPAHAPFLN-TDC
SYL_DESPS       ---------CGIVPVPIDQLPVELPED-----KD-KSSVCAP-----LHQRPDFIN-TTC
SYL_FUSNN       ---------CGEVLEKDENLPVLLPDD-----IEFSGNGNP------LETSNKFKE-ATC
SYL_TRIV2       ---------CGIVPVPDKDLPVILPEEVEFT----GRGGSP------LAQLESWVN-VPC
SYL_NOSS1       ---------CGIVPVPDKDLPVILPEEVEFT----GRGGSP------LAQLESWVN-VPC
SYL_ACAM1       ---------CGAVPVPEADLPVELPEDVEFS----AQGGSP------LAKLESWVN-VAC
SYL_TRIEI       ---------CGAVPVPDEDLPVKLPESVEFS----GRGPSP------LAKLEDWVN-VSC
SYL_SYNY3       ---------CGAVPVPTKDLPVELPDNVEFS----GRGPSP------LAKLEDWIN-VPC
SYL_SYNE7       ---------CGPVAA--ADLPVQLPDSVQFS----GRGPSP------LAQLEDWVT-TTC
SYL_SYNP6       ---------CGPVAA--ADLPVQLPDSVQFS----GRGPSP------LAQLEDWVT-TTC
SYL_THEEB       ---------CGPVPVPRSELPVLLPEEVEFT----GRGPSP------LAKLAAWRD-VPC
SYL_SYNJB       ---------CGIVPVPEKDLPVLLPEDVELT----GRGGSP------LAQLEDWVK-VKC
SYL_SYNJA       ---------CGIVPVPEEDLPVLLPEDVELT----GRGGSP------LAQLEDWVK-VKC
SYL_GLOVI       ---------CGVVPVPDEQLPVALPGDVEFS----GRGPSP------LAKLEGWIC-VDC
SYL_SYNS3       ---------CGAVPVPRDQLPVELPTGIDLK----GAGGSP------LARAEDWVS-VTC
SYL_SYNPW       ---------CGAVPVPADQLPVTLPKDVDLQ----GKGGSP------LASLQSWVN-VKC
SYL_PROMM       ---------CGIVPVPQEDLPVTLPRDIDLS----GKGGSP------IAQEQAWVE-VKC
SYL_PROM3       ---------CGIVPVPQEDLPVTLPRDIDLS----GKGGSP------LAQEQDWVE-VKC
SYL_SYNSC       ---------CGAVPVPREDLPVELPRGIDLS----GKGGSP------LSQQSDWVN-VAC
SYL_SYNS9       ---------CGVVPVPRDDLPVELPRGIDLS----GKGGSP------LSQQSDWVN-VSC
SYL_SYNPX       ---------CGAVPVPREDLPVVLPRGIDLS----GKGGSP------LEQQQDWVN-VPC
SYL_SYNR3       ---------CGVVPVPESDLPVELPRDVDLS----GSGGSP------LERATEWKQ-VRC
SYL_PROMT       ---------CGQVRVPDNDLPVVLPIDIKLT----GKGKSP------LTTKTEWIN-TCC
SYL_PROM1       ---------CGQVRVPDDDLPVVLPIDIKLT----GKGKSP------LTTKTEWIN-TCC
SYL_PROMA       ---------CGSVPVKREELPVKLT-NPSVI----GKSQE---------NKNNIPI-MKC
SYL_PROM0       ---------CGSVPLNQSELPVALPKDIDIS----ANKINA------LGDNKNWVN-TTC
SYL_PROM9       ---------CGSVPLNQSELPVALPKDIDIS----ANKINA------LGDNYNWIN-TTC
SYL_PROMS       ---------CGAVPLNQSDLPVSLPKDIEIS----ANKINA------LGNNNDWIN-TTC
SYL_PROM2       ---------CGSVPLKQSELPVALPKDIDIS----ANKINA------LGDNNHWIN-TTC
SYL_PROMP       ---------CGSVPVNKKDIPVRLPNEIKIS----SNKINS------LGSNQSWIN-TTC
SYL_PROM5       ---------CGSIPVNKKNLPVKLPKEIEIS----SNKINS------LGSYKDWVK-TTC
SYL_SOLUE       ---------CGVVPVPDDQLPVVLPDR-----IEITGAGRSP-----LENVPEFVN-VAC
SYL_DEIRA       ---------CGMQPVPEDQLPVKLPEN-----VAFTPTGQSP-----LKLDEEWKT-TTC
SYL_DEIGD       ---------HGAQPVPADQLPVKLPEN-----VEFMPTGQSP-----LKLDREWMR-ATC
SYL_RUBXD       ---------CGTVPVPEEDLPVLLPED-----AEFMPTGESP-----LKFNDEFRK-TEC
SYL_CLOPE       ---------CGIVPVPESQLPVELPYD-----VEFAPDGKSP-----LAKSEAFVN-TTC
SYL_CLOPS       ---------CGIVPVPESQLPVELPYD-----VEFAPDGKSP-----LAKSEAFVN-TTC
SYL_CLOP1       ---------CGIVPVPESQLPVELPYD-----VEFAPDGKSP-----LAKSEAFVN-TTC
SYL_CLOB8       ---------CGIVPVPEKDLPVKLPYN-----VEFTPDGKSP-----LGKCEDFVN-TTC
SYL_CLOB1       ---------CGTVEVPIEQLPVELPYN-----VEFSPDGKSP-----LGKCDDFIN-TTC
SYL_CLOBH       ---------CGTVEVPIEQLPVELPYN-----VEFSPDGKSP-----LGKCDDFIN-TTC
SYL_CLOBL       ---------CGTVEVPIEQLPVELPYN-----VEFSPDGKSP-----LGKCDDFIN-TTC
SYL_CLONN       ---------CGTVAVPEEQLPVELPYN-----IEFTPDGKSP-----LSKSEEFLH-TTC
SYL_CLOAB       ---------CGIVPVPEKDLPVELPYN-----VEFNPTGKSP-----LTTSEEFMN-TTC
SYL_CLOK5       ---------CGTVPVPESDLPVELPYN-----VQFSPDGKSP-----LLKSEEFMN-TTC
SYL_CLOTE       ---------CGTVAVPEEQLPVKLPYD-----VEFTPDGKSP-----LSKCDSFVN-TTC
SYL_CALS4       ---------CGIVPVPEEDLPVLLPYD-----VEFEPTGESP-----LKKHAGFMN-VTC
SYL_ROSCS       ---------GTIKPVPEDQLPVVLPEV-----QDYLPKGKSP-----LAAAESWVN-TID
SYL_ROSS1       ---------GTIKPVPEDQLPVLLPEV-----QDYLPKGKSP-----LAAAEHWVN-TID
SYL_THEFY       ----------GEVPVPDEELPVRLP-DLRGA--ALAPKGVS------PLAAATDWVNVSC
SYL_ACIC1       ----------GEVAVPDQDLPVLLP-DLRGA--DLAPKGIS------PLAGAADWVQTTC
SYL_ARTS2       ----------GEVPVPDDQLPVTLPADLRGE--DLSPKGTS------PLAAAEAWVNVEC
SYL_PAEAT       ----------GEVPVPDDQLPVRLPDDLRGE--ALSPKGTS------PLAAAVEWVNVEC
SYL_RENSM       ----------GEVPVPDDQLPVRLPENLRGE--QLAPKGTS------PLASVADWVNVDC
SYL_CLAMS       ----------SEIRVPEDQLPVRLP-DTEGL--DLTPKGKS------PLAAATAWSNVPS
SYL_CLAM3       ----------NEIRVPEDQLPVRLP-DTEGL--DLAPKGKS------PLAAATEWTNVPS
SYL_LEIXX       ----------GEVPVPESELPVLLP-PAEGL--DLQPKGRS------PLGAASDWVNVSC
SYL_KINRD       ----------GEVPVPEDQLPVLLP-PSEGL--NLTPKGTS------PLGAAEDWVNVPS
SYL_NOCSJ       ----------GEVAVPYDQLPLELP-ELRGA--DLKPKGVS------PLAAAEEWVNVAC
SYL_TROW8       ----------SEIPVEEDDLPVLLP-DSEGI--DLTPSGLS------PLGGIHDWVNLH-
SYL_TROWT       ----------SEIPVEEDDLPVLLP-DSEGI--DLTPSGLS------PLGGIHDWVNLH-
SYL_MYCPA       ---------GRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSPPLAKATDWVHVELD
SYL_MYCA1       ---------GRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSPPLAKATDWVHVELD
SYL_MYCLE       ---------GRPHALDEAALPVELPDVPYYSPVLFDPDDADSEPSPPLAKATEWVHVELD
SYL_MYCTA       ---------GRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSPPLAKATEWVHVDLD
SYL_MYCBO       ---------GRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSPPLAKATEWVHVDLD
SYL_MYCTU       ---------GRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSPPLAKATEWVHVDLD
SYL_MYCBP       ---------GRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSPPLAKATEWVHVDLD
SYL_MYCUA       ---------GRPHALDESALPVELPDVPDYSPVLFDPDDANSEPSPPLGKATEWLHVELD
SYL_MYCSS       ---------GRPHPLPESALPVELPDVPDYSPVLFDPDDADSEPNPPLNKATDWVHVELD
SYL_MYCSK       ---------GRPHPLPESALPVELPDVPDYSPVLFDPDDADSEPNPPLNKATDWVHVELD
SYL_MYCSJ       ---------GRPHPLPESALPVELPDVPDYSPVLFDPDDADSEPNPPLNKATDWVHVELD
SYL_MYCS2       ---------GRAHPLPESALPVELPDVPDYSPVLFDPDDADSEPSPPLNKATEWVHVELD
SYL_MYCVP       ---------DRAHGLPEELLPVELPDVPDYSPVLFDPDDADSEPSPPLAKATEWVNVELD
SYL_MYCGI       ---------GRAHGLPEGMLPVELPDVPDYSPVSFDPDDAGSEPSPPLGKVTDWVNVDLD
SYL_NOCFA       ---------GAPHALPESMLPVRLPELDDFAPVTFDPDDADSEPSPPLAKATDWVHVELD
SYL_RHOJR       ---------GNAHALPESSLPVELPEVEDYAPVSFDPDDASSEPSPPLAKAVDWVNVELD
SYL_SACEN       ---------GIPLGLPESELPVVLPEVADYSPRTFDPEDADSRPEPPLAKATEWANVELD
SYL_CORGB       ---------GQAHALPDSMLPVELPEVEDYKPVSFDPEDADSEPSPPLAKAREWVEVELD
SYL_CORGL       ---------GQAHALPDSMLPVELPEVEDYKPVSFDPEDADSEPSPPLAKAREWVEVELD
SYL_COREF       ---------GVAYALPESMLPVELPEVEDYKPVSFDPEDADSEPSPPLAKAREWVEVELD
SYL_CORDI       ---------GLAHALPESMLPVELPEVEDYKPVSFDPDDADSEPHPPLAKATEWTQVELD
SYL_CORJK       ---------GTAHGLPEDMLPVELPEVEDYKPVSFDPDDKDSAPQPPLAKAKDWVEVTLD
SYL_STRCO       ---------GIAHPLPDSMLPLELPEVEDYSPRTFDPDDADTKPETPLSRNEDWVHVTLD
SYL_STRAW       ---------GIAHALPESMLPLELPEVEDYSPRTFDPDDANTSPETPLSRNEDWVNVTLD
SYL_SALAI       ---------GAAIALPEDMLPVELPEVDDFSPRTFDPADAGSNPETPLSRRRDWVEVELD
SYL_BIFAA       ---------GTPHLLPDEQLPINLPDVPDYSPKTFDPEDAESDPEAPLSRNEDWVKVELD
SYL_BIFLO       ---------GTPHLLPDSALPINLPDVPDYEPRTFDPMDAESNPEAPLSRNEDWVKVELD
SYL_FRACC       ---------GLPHAVPDELLPIELPEMTDFRPTAMAEDDA-SDPVPPLARVADWVTVTLD
SYL_FRAAA       ---------GLPYAVPDELLPVELPEMTDFRPTAMAEDDE-SDPVPPLARVADWASVTLD
                                   : :  .                                   

SYL_GEOKA       P----------------------------------KTGKKGRRETNTMPQWAGSCWYYLR
SYL_GEOTN       P----------------------------------KTGKKGRRETNTMPQWAGSCWYYLR
SYL_BACCZ       P----------------------------------ETGKKGRRETNTMPQWAGSCWYYLR
SYL_BACAH       P----------------------------------ETGKKGRRETNTMPQWAGSCWYYLR
SYL_BACAN       P----------------------------------ETGKKGRRETNTMPQWAGSCWYYLR
SYL_BACHK       P----------------------------------ETGKKGRRETNTMPQWAGSCWYYLR
SYL_BACC1       P----------------------------------ETGKKGRRETNTMPQWAGSCWYYLR
SYL_BACCR       P----------------------------------ETGKKGRRETNTMPQWAGSCWYYLR
SYL_BACCN       P----------------------------------ETGKKGRRETNTMPQWAGSCWYYLR
SYL_BACSU       P----------------------------------ETGKKGRRETNTMPQWAGSCWYFLR
SYL_BACVZ       P----------------------------------ETGKKGRRETNTMPQWAGSCWYFLR
SYL_BACLD       P----------------------------------ETGKKGRRETNTMPQWAGSCWYFLR
SYL_BACP2       P----------------------------------VTGKKGRRETNTMPQWAGSCWYFLR
SYL_BACHD       P----------------------------------VTGKKGRRETNTMPQWAGSCWYYLR
SYL_BACSK       P----------------------------------KTGMRGRRETNTMPQWAGSCWYYLR
SYL_OCEIH       P----------------------------------ETGLKGRRETNTMPQWAGSCWYFLR
SYL_STAES       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAEQ       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAW       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAS       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAN       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAA1       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAM       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAA9       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAA2       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAA3       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAC       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAA8       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAT       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAE       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAB       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAAR       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAHJ       E----------------------------------KTGMKGRRETNTMPQWAGSCWYYLR
SYL_STAS1       E----------------------------------ATGMKGRRETNTMPQWAGSCWYYLR
SYL_LISMF       -----------------------------------KNGRKGRRETNTMPQWAGSSWYFLR
SYL_LISMO       -----------------------------------ENGRKGRRETNTMPQWAGSSWYFLR
SYL_LISIN       -----------------------------------ENGRKGRRETNTMPQWAGSSWYFLR
SYL_LISW6       -----------------------------------ESGRKGRRETNTMPQWAGSSWYFLR
SYL_ENTFA       P----------------------------------ETGMKGKRETNTMPQWAGSSWYYLR
SYL_STRTD       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRT2       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRT1       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRP2       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRR6       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRPN       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRSV       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRGC       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRS2       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRSY       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRPD       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRPG       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRP6       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRPM       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRPF       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRPB       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRPC       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRP3       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRP1       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRP8       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRA3       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRA5       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRA1       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_STRMU       -----------------------------------EDGVKGRRETNTMPQWAGSSWYFLR
SYL_LACLM       -----------------------------------ADGLKGRRETNTMPQWAGSSWYYLR
SYL_LACLA       -----------------------------------ADGLKGRRETNTMPQWAGSSWYYLR
SYL_LACLS       -----------------------------------EDGVKGRRETNTMPQWAGSSWYYLR
SYL_LACSS       -----------------------------------ENGRKGRRETNTMPQWAGSSWYYLR
SYL_LACDA       -----------------------------------ENGRKGKRETNTMPQWAGSSWYFLR
SYL_LACDB       -----------------------------------ENGRKGKRETNTMPQWAGSSWYFLR
SYL_LACP3       -----------------------------------KNGRKGKRETNTMPQWAGSSWYFLR
SYL_LACPL       -----------------------------------ENGRKGKRETNTMPQWAGSSWYFLR
SYL_LACBA       -----------------------------------ENGRKGKRETNTMPQWAGSSWYFLR
SYL_PEDPA       -----------------------------------ENGRKGRRETNTMPQWAGSSWYFLR
SYL_LACS1       -----------------------------------ENGRKGRRETNTMPQWAGSSWYFLR
SYL_LACRD       -----------------------------------ENGRHGLRETNTMPQWAGSSWYWLR
SYL_LEUMM       -----------------------------------KDGVKGRRETNTMPQWAGSSWYFLR
SYL_OENOB       -----------------------------------QDGVKGRRETNTMPQWAGSSWYFLR
SYL_SALRD       P----------------------------------ETGEPAQRETNTMPQWAGSCWYYLR
SYL1_RHIL3      P----------------------------------GTDIPARRETNTMPQWAGSCWYYLR
SYL_RHOBA       -----------------------------------LDGKRYRRETNTMPQWAGSCWYYLR
SYL_PELLD       ------------------------------------GKGAFRRETNTMPQWAGSCWYYLR
SYL_CHLPM       ------------------------------------ENGPFRRETNTMPQWAGSCWYYLR
SYL_CHLCH       ------------------------------------EHGAFRRETNTMPQWAGSCWYYLR
SYL_CHLTE       ------------------------------------EHGKFRRETNTMPQWAGSCWYYLR
SYL_CHLPD       ------------------------------------EFGSFRRETNTMPQWAGSCWYYLR
SYL_LEPBL       PE----------------------------------TGEIGTRETNTMPQWAGSCWYYLR
SYL_LEPBJ       PE----------------------------------TGEIGTRETNTMPQWAGSCWYYLR
SYL_LEPIC       PS----------------------------------TGEIGTRETNTMPQWAGSCWYYLR
SYL_LEPIN       PS----------------------------------TGEIGTRETNTMPQWAGSCWYYLR
SYL_BACTN       NKCTVENEKI-------------------------DNVTIFPLELNTMPGFAGSSAYYLR
SYL_BACV8       KGEVVENNLI-------------------------DNVTIFPLELNTMPGFAGSSAYYLR
SYL_BACFR       NKCVTDNENI-------------------------DNRTIFPLELNTMPGFAGSSAYYLR
SYL_BACFN       NKCVTDNENI-------------------------DNITIFPLELNTMPGFAGSSAYYLR
SYL_PARD8       NQKVTEVSKI-------------------------DNQTIFPLELCTMPGFAGSSAYYLR
SYL_PORGI       ----------------------------------------YPYELSTMPGFAGSSAYYLR
SYL_FLAPJ       TNEVDFNENI-------------------------NNTTIYPLELNTMPGWAGSSWYWMR
SYL_FLAJ1       ENKVVNTDLV-------------------------DNVSIFPLELNTMPGWAGSSWYWMR
SYL_GRAFK       NNKVVSNKVLKQSRKLSGQHDEPNSNVTPSAVEGSDDNGIYPLELNTMPGWAGSSWYLFR
SYL_CYTH3       -----------------------------------------GYELSTMPGWAGSSWYFMR
SYL_BDEBA       GDKEG------------------------------------RRETDTMPGAAGSSWYFLR
SYL_SORC5       ------------------------------------DGKWYARETNTMPQWAGSCWYYLR
SYL_TREDE       P----------------------------------KCGKEAKRETNTMPQWAGSCWYYLR
SYL_TREPA       P----------------------------------QCASDAVRETNTMPQWAGSCWYYLR
SYL_BORAP       T----------------------------------DFT----RETNTMPQWAGSCWYYLR
SYL_BORBP       T----------------------------------GFT----RETNTMPQWAGSCWYYLR
SYL_BORBU       M----------------------------------GFT----RETNTMPQWAGSCWYYLR
SYL_CHLTR       T----------------------------------ETQRAGKRETHTMPQWAGSCWYYLR
SYL_CHLTA       T----------------------------------ETQRAGKRETHTMPQWAGSCWYYLR
SYL_CHLMU       S----------------------------------ETQKEGKRETHTMPQWAGSCWYYLR
SYL_CHLFF       K----------------------------------KTNRQGRRETHTMPQWAGSCWYYLR
SYL_CHLCV       T----------------------------------KTNRRGRRETHTMPQWAGSCWYYLR
SYL_CHLAB       V----------------------------------KTQRPGRRETHTMPQWAGSCWYYLR
SYL_CHLPN       E----------------------------------KTGRPGCRETYTMPQWAGSCWYYLR
SYL_PARUW       T----------------------------------KTGKKAFRDTNIMPQWAGSCWYYLR
SYL_ALKOO       P----------------------------------KCGGKAERETDTMPQWAGSSWYFLR
SYL_UREP2       D------------------------------------GKKYRRETNTMPQWAGSSWYFLA
SYL_UREPA       D------------------------------------GKKYRRETNTMPQWAGSSWYFLA
SYL_MYCPU       D------------------------------------GKKLTRETNTMPQWAGSNWYYLA
SYL_MYCPE       D------------------------------------SKLYRRETNTMPQWAGSCWYYLA
SYL_MYCGA       D------------------------------------QKKYRREINTMPQWAGSCWYYLA
SYL_MYCGE       D------------------------------------NIHYQRETNTMPQWAGSCWYYLG
SYL_MYCPN       G------------------------------------NQTFTRETSTMPQWAGSCWYYLG
SYL_MYCCT       G------------------------------------DREYKRETNTMPQSAGSSWYFIA
SYL_MYCMS       G------------------------------------DKEYKRETNTMPQSAASSWYFIA
SYL_MESFL       D------------------------------------GVKYRRETNTMPQSAGSSWYYLA
SYL_ACHLI       N------------------------------------GKKGRRDTNTMPQLAGSSWYYIG
SYL_PSEA6       E----------------------------------YNGQPALRETDTFDTFMESSWYYAR
SYL_COLP3       L----------------------------------YNGEEALRETDTFDTFMESSWYYAR
SYL_IDILO       E----------------------------------YNGQPAEHETDTFDTFMESSWYYAR
SYL_PSEHT       T----------------------------------MNGAPAFHETDTFDTFMESSWYYAR
SYL_PSYIN       T----------------------------------YNGQPATHETDTFDTFMESSWYYAR
SYL_SALCH       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SALTI       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SALTY       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SALPB       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SALPA       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_CITK8       T----------------------------------VNGQPALRETDTFDTFMESSWYYAR
SYL_SALAR       T----------------------------------VNGTPAMRETDTFDTFMESSWYYAR
SYL_SHIFL       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SHIF8       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SHIBS       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECOL6       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECOL5       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECO57       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SHISS       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECOLI       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECOLC       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_SHIDS       T----------------------------------INGMPALRETDTFDTFMESSWYYAR
SYL_ECOHS       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECOUT       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECOK1       T----------------------------------VNGMPALRETDTFDTFMESSWYYAR
SYL_ECO24       T----------------------------------VNGIPALRETDTFDTFMESSWYYAR
SYL_KLEP7       T----------------------------------VNGQPALRETDTFDTFMESSWYYAR
SYL_CROS8       T----------------------------------VNGQPALRETDTFDTFMESSWYYAR
SYL_ENT38       T----------------------------------VNGQPALRETDTFDTFMESSWYYAR
SYL_YERPA       T----------------------------------VNGIPGLRETDTFDTFMESSWYYAR
SYL_YERP3       T----------------------------------VNGIPGLRETDTFDTFMESSWYYAR
SYL_YERPE       T----------------------------------VNGIPGLRETDTFDTFMESSWYYAR
SYL_YERPN       T----------------------------------VNGIPGLRETDTFDTFMESSWYYAR
SYL_YERPS       T----------------------------------VNGIPGLRETDTFDTFMESSWYYAR
SYL_YERPP       T----------------------------------VNGIPGLRETDTFDTFMESSWYYAR
SYL_YERE8       T----------------------------------VNGVPGLRETDTFDTFMESSWYYAR
SYL_SERP5       T----------------------------------VNGQPALRETDTFDTFMESSWYYAR
SYL_PECAS       T----------------------------------VNGQPALRETDTFDTFMESSWYYAR
SYL_SODGM       T----------------------------------YNGQPALRETDTFDTFMESSWYYAR
SYL_PHOLL       T----------------------------------INGQPALRETDTFDTFMESSWYYAR
SYL_MANSM       S----------------------------------YNGQPALKETDTFDTFMESSWYYAR
SYL_ACTSZ       T----------------------------------YNGRPALKETDTFDTFMESSWYYAR
SYL_HAES1       T----------------------------------YNGQAALKETDTFDTFMESSWYYAR
SYL_HISS2       T----------------------------------YNGQVALKETDTFDTFMESSWYYAR
SYL_PASMU       T----------------------------------YNGQPALKETDTFDTFMESSWYYAR
SYL_HAEIG       T----------------------------------LNGTPALKETDTFDTFMESSWYYAR
SYL_HAEIN       T----------------------------------FNDAPALKETDTFDTFMESSWYYAR
SYL_HAEI8       T----------------------------------LNGAPALKETDTFDTFMESSWYYAR
SYL_HAEIE       T----------------------------------LNGAPALKETDTFDTFMESSWYYAR
SYL_ACTP2       T----------------------------------YNGKPALKETDTFDTFMESSWYYAR
SYL_HAEDU       T----------------------------------YEGQPALKETDTFDTFMESSWYYAR
SYL_SHESA       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHESM       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHESR       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHEON       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHEB9       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHEB5       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHEB8       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHESW       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHEPC       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHEAM       Q----------------------------------VNGQDALRETDTFDTFMESSWYYAR
SYL_SHEHH       T----------------------------------VNGQEAFRETDTFDTFMESSWYYAR
SYL_SHEPA       T----------------------------------INGQEAFRETDTFDTFMESSWYYAR
SYL_SHELP       Q----------------------------------VNGQEAFRETDTFDTFMESSWYYAR
SYL_SHESH       Q----------------------------------INGQEAFRETDTFDTFMESSWYYAR
SYL_SHEDO       T----------------------------------VDGKPAFRETDTFDTFMESSWYYAR
SYL_SHEFN       T----------------------------------VNGQPATRETDTFDTFMESSWYYAR
SYL_VIBPA       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_VIBCB       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_VIBVU       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_VIBVY       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_VIBCH       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_VIBC3       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_ALIF1       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_PHOPR       T----------------------------------FNGEPALRETDTFDTFMESSWYYAR
SYL_AERS4       T----------------------------------YNGQEAFRETDTFDTFMESSWYYAR
SYL_AERHH       T----------------------------------YNGQEAFRETDTFDTFMESSWYYAR
SYL_MARHV       E----------------------------------YNGQPATLETDTFDTFMESSWYYAR
SYL_HAHCH       S----------------------------------YNGQPATQETDTFDTFMESSWYYAR
SYL_SACD2       E----------------------------------LNGQAVEHETDTFDTFMESSWYYAR
SYL_MARMS       M----------------------------------FNGEEAERETDTFDTFMESSWYFAR
SYL_ALCBS       T----------------------------------FNGQPALRETDTFDTFMESSWYYAR
SYL_PSEAB       P----------------------------------KCGQPAKRETDTMDTFVESSWYFAR
SYL_PSEAE       P----------------------------------KCGQPAKRETDTMDTFVESSWYFAR
SYL_PSEA7       P----------------------------------KCGQPAKRETDTMDTFVESSWYFAR
SYL_PSEU5       P----------------------------------KCGAPAKRETDTMDTFVESSWYFAR
SYL_PSEMY       P----------------------------------KCGAPAKRETDTMDTFVESSWYFAR
SYL_PSEP1       P----------------------------------KCGAAAKRETDTMDTFVESSWYFAR
SYL_PSEPK       P----------------------------------KCGAAAKRETDTMDTFVESSWYFAR
SYL_PSEPG       P----------------------------------KCGTAAKRETDTMDTFVESSWYFAR
SYL_PSEE4       P----------------------------------KCGTAAKRETDTMDTFVESSWYFAR
SYL_PSEU2       P----------------------------------KCGAPAKRETDTMDTFVESSWYYAR
SYL_PSE14       P----------------------------------KCGAPAKRETDTMDTFVESSWYYAR
SYL_PSESM       P----------------------------------KCGAPAKRETDTMDTFVESSWYYAR
SYL_NEIMB       P----------------------------------CCGGAAKRETDTMDTFMESSWYFFR
SYL_NEIMF       P----------------------------------CCGGAAKRETDTMDTFMESSWYFFR
SYL_NEIG1       P----------------------------------CCGGAAKRETDTMDTFMESSWYFFR
SYL_NEIM0       P----------------------------------CCGGAAKRETDTMDTFMESSWYFFR
SYL_NEIMA       P----------------------------------CCGGAAKRETDTMDTFMESSWYFFR
SYL_CHRVO       P----------------------------------KCGGAAKRETDTMDTFVESSWYYAR
SYL_THIDA       P----------------------------------ACGAPARRETDTMDTFVESSWYYAR
SYL_DECAR       P----------------------------------KCGGDARRETDTMDTFFESSWYFLR
SYL_AZOSB       P----------------------------------KCGKPARRETDTMDTFVESSWYFLR
SYL_CUPMC       P----------------------------------SCGKPARRETDTMDTFIDSCWYYMR
SYL_CUPPJ       P----------------------------------SCGKPARRETDTMDTFIDSCWYYMR
SYL_RALSO       P----------------------------------SCGKPARRETDTMDTFIDSCWYYMR
SYL_JANMA       P----------------------------------QCGKPARRETDTMDTFVDSSWYYMR
SYL_HERAR       P----------------------------------KCGKPARRETDTMDTFVDSSWYYMR
SYL_BURCH       P----------------------------------KCGAAAKRETDTMDTFVDSSWYFSR
SYL_BURCA       P----------------------------------KCGAAAKRETDTMDTFVDSSWYFSR
SYL_BURL3       P----------------------------------KCGAAAKRETDTMDTFVDSSWYFSR
SYL_BURCM       P----------------------------------KCGAAAKRETDTMDTFVDSSWYFSR
SYL_BURVG       P----------------------------------KCGAAAKRETDTMDTFVDSSWYFSR
SYL_BURP0       P----------------------------------KCGAAAKRETDTMDTFVDSAWYFSR
SYL_BURPS       P----------------------------------KCGAAAKRETDTMDTFVDSAWYFSR
SYL_BURP6       P----------------------------------KCGAAAKRETDTMDTFVDSAWYFSR
SYL_BURP1       P----------------------------------KCGAAAKRETDTMDTFVDSAWYFSR
SYL_BURM7       P----------------------------------KCGAVAKRETDTMDTFVDSAWYFSR
SYL_BURM9       P----------------------------------KCGAVAKRETDTMDTFVDSAWYFSR
SYL_BURMA       P----------------------------------KCGAVAKRETDTMDTFVDSAWYFSR
SYL_BURMS       P----------------------------------KCGAVAKRETDTMDTFVDSAWYFSR
SYL_BURTA       P----------------------------------KCGAAAKRETDTMDTFVDSAWYFSR
SYL_PARXL       P----------------------------------TCGGAAKRETDTMDTFVDSSWYFYR
SYL_POLAQ       P----------------------------------QCGKPARRETDTMDTFVDSSWYFMR
SYL_BORBR       P----------------------------------RCGKPARRETDTMDTFVDSSWYFMR
SYL_BORPA       P----------------------------------RCGKPARRETDTMDTFVDSSWYFMR
SYL_BORPE       P----------------------------------RCGKPARRETDTMDTFVDSSWYFMR
SYL_BORPD       P----------------------------------RCGKPARRETDTMDTFVDSSWYFMR
SYL_BORA1       P----------------------------------ACGKPARRETDTMDTFVDSSWYFMR
SYL_METPP       P----------------------------------KCGAPAKRETDTMDTFVDSSWYYMR
SYL_ACISJ       P----------------------------------CCGKPARRETDTMDTFVDSSWYFMR
SYL_ACIAC       P----------------------------------VCGKAARRETDTMDTFVDSSWYFMR
SYL_RHOFT       P----------------------------------ICGVAARRETDTMDTFVDSSWYFMR
SYL_VEREI       P----------------------------------VCGKSARRETDTMDTFVDSAWYFMR
SYL_POLNA       P----------------------------------VCGKPARRETDTMDTFVDSSWYFMR
SYL_POLSJ       P----------------------------------VCGKPARRETDTMDTFVDSSWYYMR
SYL_METCA       P----------------------------------KCGGAAERETDTMDTFVESSWYYAR
SYL_DICNV       R----------------------------------FQGKAARRETDTMDTFVESSWYQFR
SYL_PSYCK       P----------------------------------KCGNPAERETDTFDTFVESSWYYAR
SYL_PSYA2       P----------------------------------KCGNPAERETDTFDTFVESSWYYAR
SYL_PSYWF       P----------------------------------KCGGPAERETDTFDTFMESSWYYAR
SYL_ACIAD       P----------------------------------SCGGHARRETDTLDTFVESSWYYAR
SYL_NITEU       P----------------------------------RCGRQARRETDTMDTFVDSSWYFIR
SYL_NITEC       P----------------------------------RCGQQAHRETDTMDTFVDSSWYFIR
SYL_NITMU       P----------------------------------RCGQSARRETDTMDTFVDSSWYYIR
SYL_METFK       P----------------------------------SCGEKATRETDTMDTFVESSWYFAR
SYL_HYDCU       P----------------------------------QCGGPANRETDTFDTFFESSWYHAR
SYL_XYLFA       P----------------------------------ECGGPAERETDTFDTFMESSWYYAR
SYL_XYLFT       P----------------------------------ECGGPAERETDTFDTFMESSWYYAR
SYL_XANC8       P----------------------------------ECGGPAERETDTFDTFMESSWYVAR
SYL_XANCP       P----------------------------------ECGGPAERETDTFDTFMESSWYVAR
SYL_XANCB       P----------------------------------ECGGPAERETDTFDTFMESSWYVAR
SYL_XANC5       P----------------------------------DCGGPAERETDTFDTFMESSWYVAR
SYL_XANAC       P----------------------------------DCGGPAERETDTFDTFMESSWYVAR
SYL_XANOR       P----------------------------------DCGGPAERETDTFDTFMESSWYVAR
SYL_XANOM       P----------------------------------DCGGPAERETDTFDTFMESSWYVAR
SYL_NITOC       P----------------------------------QCGGQAKRETDTFDTFFESSWYYAR
SYL_ALKEH       P----------------------------------QCGGEARRETDTFDTFMESSWYYAR
SYL_HALHL       P----------------------------------QCGADAERETDTFDTFMESSWYFAR
SYL_CHRSD       -------------------------------------GEGWTRETDTFDTFMESSWYYAR
SYL_BUCAI       F----------------------------------IHGKHAIREIDTFDTFMESSWYYAR
SYL_BUCAP       K----------------------------------IENQDVIRETDTFDTFMESSWYYAR
SYL_BUCCC       K----------------------------------ISGKKVTRETDTLDTFMESSWYYAR
SYL_BUCBP       Y----------------------------------IDEKIAICESDTFDTFLESSWYYAR
SYL_WIGBR       L----------------------------------NDNKLVKREVDTFDTFMESSWYLHR
SYL_BLOPB       T----------------------------------YKGQAAIRDTDTFDTFMESSWYYAR
SYL_BLOFL       T----------------------------------YKNQDVIRDTDTFDTFMESSWYYAR
SYL_BAUCH       N----------------------------------YNNNIATRETDTFDTFMESSWYYAR
SYL_COXBU       P----------------------------------VCNKPATRETDTMDTFVESSWYYAR
SYL_COXBR       P----------------------------------VCNKPATRETDTMDTFVESSWYYAR
SYL_COXBN       P----------------------------------VCNKPATRETDTMDTFVESSWYYAR
SYL_LEGPH       P----------------------------------KCGQDATRETDTFDTFVESSWYYAR
SYL_LEGPC       P----------------------------------KCGQDATRETDTFDTFVESSWYYAR
SYL_LEGPA       P----------------------------------KCGQDANRETDTFDTFVESSWYYAR
SYL_LEGPL       P----------------------------------KCGQDATRETDTFDTFVESSWYYAR
SYL_FRATT       P----------------------------------ECGKPAKRETDTFDTFFESSWYYAR
SYL_FRAT1       P----------------------------------ECGKPAKRETDTFDTFFESSWYYAR
SYL_FRATW       P----------------------------------ECGKPAKRETDTFDTFFESSWYYAR
SYL_FRATF       P----------------------------------ECGKPAKRETDTFDTFFESSWYYAR
SYL_FRATH       P----------------------------------ECGKPAKRETDTFDTFFESSWYYAR
SYL_FRATO       P----------------------------------ECGKPAKRETDTFDTFFESSWYYAR
SYL_FRATN       P----------------------------------ECGKPAKRETDTFDTFFESSWYYAR
SYL_FRAP2       P----------------------------------NCGKPATRETDTFDTFFESSWYYAR
SYL_RUTMC       P----------------------------------KCGKMAQQETDTLDTFFESSWYFAR
SYL_VESOH       P----------------------------------KCGSKAHRETDTFDTFFESSWYFAR
SYL_RICRS       P----------------------------------KCDKPAVRETDTFDTFFESSWYFMR
SYL_RICRO       P----------------------------------KCDKPAVRETDTFDTFFESSWYFMR
SYL_RICCN       P----------------------------------KCDKPAVRETDTFDTFFESSWYFTR
SYL_RICM5       P----------------------------------KCDKPAVRETDTFDTFFESSWYFTR
SYL_RICFE       P----------------------------------KCDKSAIRETDTFDTFFESSWYFTR
SYL_RICAH       P----------------------------------KCNKPAIRETDTFDTFFESSWYFTR
SYL_RICCK       P----------------------------------KCDKPAIRETDTFDTFFESSWYFTR
SYL_RICBR       P----------------------------------KCSKPAIRETDTFDTFFESSWYFTR
SYL_RICPR       P----------------------------------KCDNSAIRETDTFDTFFESSWYFTR
SYL_RICTY       P----------------------------------KCDNHAIRETDTFDTFFESSWYFTR
SYL_ORITB       P----------------------------------KCHLDAVRETDTFDTFFESSWYFAR
SYL_WOLPM       P----------------------------------KCGKQAERETDTFDTFFESSWYFAA
SYL_WOLTR       P----------------------------------KCKEQAERETDTFDTFFESSWYFAA
SYL_EHRRW       P----------------------------------SCGADAKRETDTFDTFFESSWYFAA
SYL_EHRRG       P----------------------------------SCGADAKRETDTFDTFFESSWYFAA
SYL_EHRCJ       P----------------------------------SCGMDAERETDTFDTFFESSWYFAA
SYL_EHRCR       P----------------------------------SCGMDAERETDTFDTFFESSWYFAA
SYL_ANAMM       P----------------------------------KCQSSAQRETDTFDTFFESSWYFAA
SYL_NEOSM       P----------------------------------KCGGPAVRDTDTFDTFFESSWYFAA
SYL2_RHIL3      P----------------------------------NCGKDARRETDTMDTFVDSSWYFTR
SYL_RHIEC       P----------------------------------NCGKDARRETDTMDTFVDSSWYFTR
SYL_RHIME       P----------------------------------QCGKDARRETDTMDTFVDSSWYFTR
SYL_SINMW       P----------------------------------QCGKDARRETDTMDTFVDSSWYFTR
SYL_AGRFC       P----------------------------------QCGHDARRETDTMDTFVDSSWYYTR
SYL_BRUAB       P----------------------------------KCGGDARRETDTMDTFVDSSWYYTR
SYL_BRUA2       P----------------------------------KCGGDARRETDTMDTFVDSSWYYTR
SYL_BRUSI       P----------------------------------KCGGDARRETDTMDTFVDSSWYYTR
SYL_BRUO2       P----------------------------------KCGGDARRETDTMDTFVDSSWYYTR
SYL_BRUME       P----------------------------------KCGGDARRETDTMDTFVDSSWYYTR
SYL_BRUSU       P----------------------------------KCGGDARRETDTMDTFVDSSWYYTR
SYL_BRUC2       P----------------------------------KCGGDARRETDTMDTFVDSSWYYTR
SYL_OCHA4       P----------------------------------KCGADARRETDTMDTFVDSSWYYAR
SYL_CHESB       P----------------------------------QCGADARRETDTMDTFVDSSWYFAR
SYL_RHILO       P----------------------------------QCGRDARRETDTMDTFVDSSWYFAR
SYL_BART1       P----------------------------------ICGQPAKRETDTMDTFVDSSWYYAR
SYL_BARHE       P----------------------------------VCGQFAKRETDTMDTFVDSSWYYAR
SYL_BARQU       P----------------------------------VCGQSAKRETDTMDTFVDSSWYYAR
SYL_BARBK       P----------------------------------SCGQPAKRETDTMDTFVDSSWYYAR
SYL_RHOP2       P----------------------------------QCGGKAQRETDTMDTFVDSSWYFAR
SYL_RHOPS       P----------------------------------QCGAKATRETDTMDTFVDSSWYFAR
SYL_RHOPA       P----------------------------------KCGGKAVRETDTMDTFVDSSWYFAR
SYL_RHOP5       P----------------------------------KCGGKAVRETDTMDTFVDSSWYFAR
SYL_NITHX       P----------------------------------QCGARATRETDTMDTFVDSSWYFAR
SYL_NITWN       P----------------------------------KCGGKATRETDTMDTFVDSSWYFAR
SYL_BRASB       P----------------------------------KCGGKATRETDTMDTFVDSSWYFAR
SYL_BRASO       P----------------------------------KCGGKATRETDTMDTFVDSSWYFAR
SYL_BRADU       P----------------------------------QCGGKAQRETDTMDTFVDSSWYFAR
SYL_RHOPB       P----------------------------------QCGGKARRETDTMDTFVDSSWYFSR
SYL_AZOC5       P----------------------------------KCGAPARRETDTMDTFVDSSWYFLR
SYL_PARL1       P----------------------------------KCGKPASRETDTFDTFVDSSWYFVR
SYL_CAUVC       P----------------------------------SCGGKAERETDTLDTFIDSSWYFAR
SYL_CAUSK       P----------------------------------SCGGKAERETDTLDTFVDSSWYFAR
SYL_MARMM       P----------------------------------KCGKAGRRETDTLDTFVCSSWYFLR
SYL_HYPNA       P----------------------------------KCGKPARRETDTLDTFVDSSWYYAR
SYL_RUEST       P----------------------------------NCGKPAQRETDTMDTFVDSSWYFAR
SYL_RUEPO       P----------------------------------SCGKPARRETDTMDTFVDSSWYFAR
SYL_ROSDO       P----------------------------------ACGKPAQRETDTMDTFVDSSWYFAR
SYL_JANSC       P----------------------------------SCGAPALRETDTMDTFVDSSWYFAR
SYL_DINSH       P----------------------------------ACGAPARRETDTMDTFVDSSWYFAR
SYL_RHOS1       P----------------------------------KCGAKARRETDTMDTFVDSSWYYAR
SYL_RHOS4       P----------------------------------KCGAKARRETDTMDTFVDSSWYYAR
SYL_RHOS5       P----------------------------------KCGAKARRETDTMDTFVDSSWYYAR
SYL_PARDP       P----------------------------------KCGGPARRETDTMDTFVDSSWYYAR
SYL_ZYMMO       P----------------------------------KCGKPARRETDTLDTFVDSSWYFIR
SYL_SPHWW       P----------------------------------SCGKPARRETDTLDTFVDSSWYFIR
SYL_NOVAD       P----------------------------------QCGHPARRETDTLDTFVDSSWYFLR
SYL_SPHAL       P----------------------------------ICEGAALRETDTLDTFVDSSWYFLR
SYL_GRABC       P----------------------------------SCGAAAVRETDTFDTFVDSSWYFAR
SYL_GLUOX       P----------------------------------HCGKPAVRETDTFDTFVDSSWYFAR
SYL_ACICJ       P----------------------------------QCGAAAQRETDTFDTFVDSSWYFAR
SYL_MAGSA       P----------------------------------CCGKPARRETDTFDTFFESSWYFAR
SYL_RHORT       P----------------------------------QCGKPARRETDTFDTFFESSWYFAR
SYL_MAGMM       P----------------------------------QCGQPARRETDTMDTFMESSWYFLR
SYL_CAMJ8       P----------------------------------KCGKEAQKESDTLDTFFESSWYFAR
SYL_CAMJJ       P----------------------------------KCGKEAQKESDTLDTFFESSWYFAR
SYL_CAMJR       P----------------------------------KCGKEAQKESDTLDTFFESSWYFAR
SYL_CAMJE       P----------------------------------KCGKEAQKESDTLDTFFESSWYFAR
SYL_CAMJD       P----------------------------------KCGKEAQKESDTLDTFFESSWYFAR
SYL_CAMC1       P----------------------------------KCGKDAIRETDTMDTFVESSWYFAR
SYL_CAMC5       P----------------------------------KCGHDAVRETDTMDTFVESSWYFAR
SYL_CAMFF       P----------------------------------KCGSQATRETDTMDTFFESSWYFAR
SYL_CAMHC       P----------------------------------KCGAEAERETDTLDTFFDSSWYFAR
SYL_ARCB4       P----------------------------------KCGEKATRETDTLDTFVQSSWYFLR
SYL_NITSB       P----------------------------------KCGGEAERETDTLDTFVESSWYFLR
SYL_WOLSU       P----------------------------------KCGGKATRETDTMDTFVESSWYFLR
SYL_HELHP       P----------------------------------KCGKKAQRESDTMDTFIQSSWYFLR
SYL_HELPY       P----------------------------------KCHKNALRETDTMDTFIQSSWYFLR
SYL_HELPH       P----------------------------------KCHKDALRETDTMDTFIQSSWYFLR
SYL_HELPJ       P----------------------------------KCHKDALRETDTMDTFIQSSWYFLR
SYL_HELAH       P----------------------------------KCHKDALRETDTMDTFIQSSWYFLR
SYL_THEMA       P----------------------------------VCGGEAQRETDTMDTFVDSSWYFLR
SYL_THEP1       P----------------------------------ICGGEAQRETDTMDTFVDSSWYFLR
SYL_THEM4       P----------------------------------KCGGPAKREADTMDTFVDSSWYYLR
SYL_FERNB       P----------------------------------KCGGPAHREVETMDTFVDSSWYFLR
SYL_PSELT       P----------------------------------KCGGPALRDADTMDTFVDSSWYFLR
SYL_CALS8       P----------------------------------KCGKPARRETDTMDTFICSSWYYFR
SYL_HUNT2       P----------------------------------KCGKMGRRELDTMDTFVCSSWYYLR
SYL_DESHY       P----------------------------------TCGGKARRETDTMDTFMCSSWYFLR
SYL_SYNWW       P----------------------------------SCGKEALRETDTMDTFVCSSWYFDR
SYL_CARHZ       P----------------------------------ECGGPATRETDTMDTFICSSWYYYR
SYL_PELTS       P----------------------------------SCGGPGKRETDTMDTFMCSSWYYYR
SYL_MOOTA       P----------------------------------RCGGPARRETDTMDTFVCSSWYFLR
SYL_DESRM       P----------------------------------QCGGPAQRETDTMDTFVDSSWYYLR
SYL_SYMTH       P----------------------------------QCGGPARRETDTMDTFVCSSWYFLR
SYL_DESVH       P----------------------------------VCGGKARRETDTMDTFVESSWYFAR
SYL_DESVV       P----------------------------------VCGGKARRETDTMDTFVESSWYFAR
SYL_DESAG       P----------------------------------ACGEKARRETDTMDTFVESSWYFAR
SYL_LAWIP       P----------------------------------QCGGIAKRETDTMDTFVDSSWYFAR
SYL_GEOMG       P----------------------------------QCGQMARRETDTMDTFVQSSWYFLR
SYL_GEOSL       P----------------------------------QCGAEARRETDTMDTFVQSSWYFLR
SYL_GEOUR       P----------------------------------QCGEAARRETDTMDTFVESSWYFLR
SYL_PELPD       P----------------------------------TCGKPARRETDTMDTFVQSSWYFLR
SYL_PELCD       P----------------------------------TCGGDARRETDTFDTFVESSWYFAR
SYL_SYNAS       P----------------------------------SCGGPAKRESDTMDTFVESSWYFER
SYL_SYNFM       P----------------------------------RCGGPARRETDTMDTFVESSWYFAR
SYL_DESPS       P----------------------------------KCGQPAKRETDTMDTFVESSWYFAR
SYL_FUSNN       P----------------------------------CCGGKARRDTDTMDTFVDSSWYFLR
SYL_TRIV2       P----------------------------------TCGSPAKRETDTMDTFIDSSWYFLR
SYL_NOSS1       P----------------------------------TCGTPAKRETDTMDTFIDSSWYFLR
SYL_ACAM1       P----------------------------------NCGADAKRETDTMDTFIDSSWYFLR
SYL_TRIEI       P----------------------------------SCGTPAKRETDTMDTFIDSSWYYLR
SYL_SYNY3       P----------------------------------SCGKPARRETDTMDTFIDSSWYFLR
SYL_SYNE7       P----------------------------------SCGKPARRETDTMDTFMCSSWYYLR
SYL_SYNP6       P----------------------------------SCGKPARRETDTMDTFMCSSWYYLR
SYL_THEEB       P----------------------------------KCGGPAQRETDTMDTFIDSSWYYFR
SYL_SYNJB       P----------------------------------TCGAEARRETDTMDTFICSSWYFLR
SYL_SYNJA       P----------------------------------ACGADARRETDTMDTFICSSWYFLR
SYL_GLOVI       P----------------------------------QCGAPARRETDTMDTFIDSSWYFLR
SYL_SYNS3       P----------------------------------KCGKPARRETDTMDTFMCSSWYYLR
SYL_SYNPW       P----------------------------------SCGRDARRETDTMDTFMCSSWYFLR
SYL_PROMM       P----------------------------------ICGEKAHRETDTMDTFMCSSWYYLR
SYL_PROM3       P----------------------------------ICGEKAHRETDTMDTFMCSSWYYLR
SYL_SYNSC       P----------------------------------RCGKPAKRETDTMDTFMCSSWYFLR
SYL_SYNS9       P----------------------------------CCGGAAKRETDTMDTFMCSSWYFLR
SYL_SYNPX       P----------------------------------SCGEPAKRETDTMDTFMCSSWYFLR
SYL_SYNR3       P----------------------------------KCGKPATRETDTMDTFMCSSWYYLR
SYL_PROMT       P----------------------------------KCGTEAKRETDTMDTFMCSSWYFLR
SYL_PROM1       P----------------------------------KCGTDAKRETDTMDTFMCSSWYFLR
SYL_PROMA       S----------------------------------KCNKDSILETDTMDTFMCSSWYFLR
SYL_PROM0       P----------------------------------KCGIAAKKETDTMDTFMCSSWYFLR
SYL_PROM9       P----------------------------------KCGIAAKKETDTMDTFMCSSWYFLR
SYL_PROMS       P----------------------------------KCGIGARKETDTMDTFMCSSWYFLR
SYL_PROM2       P----------------------------------KCGIAAKKETDTMDTFMCSSWYFLR
SYL_PROMP       P----------------------------------KCGNLASRETDTMDTFMCSSWYFLR
SYL_PROM5       P----------------------------------KCGNLASRETDTMDTFMCSSWYFLR
SYL_SOLUE       P----------------------------------KCGEPARRETDTMDTFVDSSWYFYR
SYL_DEIRA       P----------------------------------CCGGPAERETDTMDTFVDSSWYMYR
SYL_DEIGD       P----------------------------------VCGGPAERDTDTMDTFVDSSWYMYR
SYL_RUBXD       P----------------------------------RCGGPAERETDTMDTFVDSSWYQYR
SYL_CLOPE       P----------------------------------HCGKPAKRETDTLDTFVCSSWYYLR
SYL_CLOPS       P----------------------------------HCGKPAKRETDTLDTFVCSSWYYLR
SYL_CLOP1       P----------------------------------HCGKPAKRETDTLDTFVCSSWYYLR
SYL_CLOB8       P----------------------------------HCGKPAKREADTLDTFVCSSFYYLR
SYL_CLOB1       P----------------------------------KCGGPAKREADTLDTFVCSSWYYLR
SYL_CLOBH       P----------------------------------KCGGPAKREADTLDTFVCSSWYYLR
SYL_CLOBL       P----------------------------------KCGGPAKREADTLDTFVCSSWYYLR
SYL_CLONN       P----------------------------------KCGGHAVRETDTLDTFVCSSWYYLR
SYL_CLOAB       P----------------------------------HCGGHATRESDTLDTFVCSSWYYLR
SYL_CLOK5       P----------------------------------ICGEPAKREADTLDTFVCSSWYYLR
SYL_CLOTE       P----------------------------------TCGGPAKREVDTLDTFVCSSWYFLR
SYL_CALS4       P----------------------------------KCGGPALRDPDTLDTFVDSSWYYLR
SYL_ROSCS       P----------------------------------ETGQPARRDTDTMDTFVDSSWYFLR
SYL_ROSS1       P----------------------------------ETGQPARRDTDTMDTFVDSSWYFLR
SYL_THEFY       P----------------------------------RCGGPAKRDTDTMDTFVDSSWYFLR
SYL_ACIC1       P----------------------------------RCGGSAQRDTDTMDTFVDSSWYYLR
SYL_ARTS2       P----------------------------------NCHGPAKRDTDTMDTFVDSSWYFLR
SYL_PAEAT       P----------------------------------NCGRAAQRDTDTMDTFVDSSWYFLR
SYL_RENSM       P----------------------------------KCGGAATRDTDTIDTFVDSSWYYLR
SYL_CLAMS       P----------------------------------VDGSPATRDPDTMDTFMDSSWYWLR
SYL_CLAM3       P----------------------------------VDGSPATRDPDTMDTFMDSSWYWLR
SYL_LEIXX       F----------------------------------SCGGPAQRDTDTMDTFVDSSWYFLR
SYL_KINRD       P----------------------------------VDGSPARRDPDTMDTFVDSSWYFLR
SYL_NOCSJ       P----------------------------------ECGGAATRDSDTMDTFVDSSWYFLR
SYL_TROW8       -----------------------------------KAGSLFRRDTDTMDTFFDSSWYFLR
SYL_TROWT       -----------------------------------KAGSLFRRDTDTMDTFFDSSWYFLR
SYL_MYCPA       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCA1       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCLE       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCTA       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCBO       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCTU       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCBP       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCUA       LGDG---------------------------------LKPYSRDTNVMPQWAGSSWYELR
SYL_MYCSS       LGDG---------------------------------LQTYTRDTNVMPQWAGSSWYELR
SYL_MYCSK       LGDG---------------------------------LQTYTRDTNVMPQWAGSSWYELR
SYL_MYCSJ       LGDG---------------------------------LQTYTRDTNVMPQWAGSSWYELR
SYL_MYCS2       LGDG---------------------------------LQSYTRDTNVMPQWAGSSWYELR
SYL_MYCVP       LGDG---------------------------------RKRYTRDTNVMPQWAGSSWYELR
SYL_MYCGI       LGDG---------------------------------LKPYTRDTNVMPQWAGSSWYELR
SYL_NOCFA       LGDG---------------------------------PKKYRRDTNVMPNWAGSSWYQLR
SYL_RHOJR       LGDG---------------------------------LQTYRRDTNVMPQWAGSSWYQLR
SYL_SACEN       LGDG---------------------------------LKNYERDTNVMPQWAGSCWYQLR
SYL_CORGB       LGDG---------------------------------KKKYTRDTNVMPQWAGSSWYQLR
SYL_CORGL       LGDG---------------------------------KKKYTRDTNVMPQWAGSSWYQLR
SYL_COREF       LGDG---------------------------------VKKYTRDTNVMPQWAGSSWYQLR
SYL_CORDI       LGDG---------------------------------LKKYTRDTNVMPQWAGSSWYQLR
SYL_CORJK       LGDG---------------------------------EKTYYRDTNVMPQWAGSSWYQLR
SYL_STRCO       LGDGRG-------------------------------PRKYRRETNTMPNWAGSCWYELR
SYL_STRAW       LGDGRG-------------------------------PQKYRRETNTMPNWAGSCWYELR
SYL_SALAI       LGDG---------------------------------PKRYTRETNVMPQWAGSCWYELR
SYL_BIFAA       LGDG---------------------------------KKTYYRDTNTMPNWAGSCWYYMR
SYL_BIFLO       LGDG---------------------------------KKTYYRDTNTMPNWAGSCWYYMR
SYL_FRACC       LGDG---------------------------------PKQYRRETNTMPQWAGSCWYYLR
SYL_FRAAA       LGDG---------------------------------PKRYRRETNTMPQWAGSCWYHLR
                                                           :   :     *  *   

SYL_GEOKA       YIDPH-------------NDKQLADPEKLKKWLP-------------VDVYIGGAEHAVL
SYL_GEOTN       YIDPH-------------NDKQLADPEKLKQWLP-------------VDVYIGGAEHAVL
SYL_BACCZ       YIDPN-------------NSEALVDPEKVKQWLP-------------VDIYIGGAEHAVL
SYL_BACAH       YIDPN-------------NSEALVDPEKVKQWLP-------------VDIYIGGAEHAVL
SYL_BACAN       YIDPN-------------NSEALVDPEKVKQWLP-------------VDIYIGGAEHAVL
SYL_BACHK       YIDPN-------------NSEALVDPEKVKQWLP-------------VDIYIGGAEHAVL
SYL_BACC1       YIDPN-------------NSEALVDPEKVKQWLP-------------VDIYIGGAEHAVL
SYL_BACCR       YIDPN-------------NSEALVDPEKVKQWLP-------------VDIYIGGAEHAVL
SYL_BACCN       YIDPN-------------NNEALVDPEKAKQWLP-------------VDIYIGGAEHAVL
SYL_BACSU       YIDPH-------------NPDQLASPEKLEKWLP-------------VDMYIGGAEHAVL
SYL_BACVZ       FIDPK-------------NPDQLASPEKLDKWLP-------------VDIYIGGAEHAVL
SYL_BACLD       YIDPK-------------NPNELASPEKLKEWLP-------------VDMYIGGAEHAVL
SYL_BACP2       YIDPH-------------NSEELASPEKLKKWLP-------------VDVYIGGAEHAVL
SYL_BACHD       YIDPD-------------NERMIADPEKLKKWLP-------------VDIYIGGAEHAVL
SYL_BACSK       YIDPT-------------NDEALADPEKLKNWLP-------------VDTYIGGAEHAVL
SYL_OCEIH       YIDPN-------------NTERLADPKALEEWLP-------------IDIYIGGAEHAVL
SYL_STAES       YIDPH-------------NEKMIADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAEQ       YIDPH-------------NEKMIADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAW       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAS       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAN       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAA1       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAM       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAA9       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAA2       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAA3       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAC       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAA8       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAT       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAE       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAB       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAAR       YIDPK-------------NENMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAHJ       YIDPH-------------NSNMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_STAS1       YIDPD-------------NEQMLADPEKLKHWLP-------------VDLYIGGVEHAVL
SYL_LISMF       YIDPN-------------NSEAIADKEKLAEWLP-------------VDVYIGGAEHAVL
SYL_LISMO       YIDPK-------------NSEAIADKEKLAEWLP-------------VDVYIGGAEHAVL
SYL_LISIN       YIDPK-------------NSEAIADKEKLAEWLP-------------VDVYIGGAEHAVL
SYL_LISW6       YIDPK-------------NTEAIADKEKLIEWLP-------------VDVYIGGAEHAVL
SYL_ENTFA       FIDPH-------------NKNEIADFEKLKRWLP-------------VDIYIGGAEHAVL
SYL_STRTD       YIDPH-------------NTEKLADEDLLKQWLP-------------VDIYVGGAEHAVL
SYL_STRT2       YIDPH-------------NTEKLADEDLLKQWLP-------------VDIYVGGAEHAVL
SYL_STRT1       YIDPH-------------NTEKLADEDLLKQWLP-------------VDIYVGGAEHAVL
SYL_STRP2       YIDPH-------------NTEKLADEDLLKQWLP-------------VDIYVGGAEHAVL
SYL_STRR6       YIDPH-------------NTEKLADEDLLKQWLP-------------VDIYVGGAEHAVL
SYL_STRPN       YIDPH-------------NTEKLADEDLLKQWLP-------------VDIYVGGAEHAVL
SYL_STRSV       YIDPH-------------NNEKLADEELLKAWLP-------------VDIYIGGAEHAVL
SYL_STRGC       YIDPH-------------NNEKLADEDLLKAWLP-------------VDIYIGGAEHAVL
SYL_STRS2       YIDPH-------------NDEKLADEDLLKAWLP-------------VDIYIGGAEHAVL
SYL_STRSY       YIDPH-------------NDEKLADEDLLKAWLP-------------VDIYIGGAEHAVL
SYL_STRPD       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRPG       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRP6       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRPM       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRPF       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRPB       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRPC       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRP3       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRP1       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRP8       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRA3       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRA5       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRA1       YIDPH-------------NTEKLADEELLKQWLP-------------VDIYVGGAEHAVL
SYL_STRMU       YIDPH-------------NDQKLADEDLLKQWLP-------------VDVYVGGAEHAVL
SYL_LACLM       YIDPN-------------NSEALADPELLKEWLP-------------VDIYVGGAEHAVL
SYL_LACLA       YIDPN-------------NSEALADPELLKEWLP-------------VDIYVGGAEHAVL
SYL_LACLS       YIDPH-------------NTEALADPELLKEWLP-------------VDIYVGGAEHAVL
SYL_LACSS       YIDPK-------------NPDKLADFDKLKDWLP-------------VDMYIGGAEHAVL
SYL_LACDA       YIDPH-------------NDKALADPELLKKWMP-------------VDLYIGGAEHATL
SYL_LACDB       YIDPH-------------NDKALADPELLKKWMP-------------VDLYIGGAEHATL
SYL_LACP3       FVDPH-------------NKEALADYDKLKAWMP-------------VDLYIGGAEHAVL
SYL_LACPL       YVDPH-------------NREALADYDKLKYWSP-------------VDLYVGGAEHAVL
SYL_LACBA       YVDPT-------------NDQAIADPEKLKYWMP-------------VDLYIGGAEHAVL
SYL_PEDPA       YVDPK-------------NDQKIADEDLLKEWLP-------------VDLYVGGAEHAVL
SYL_LACS1       YIDPH-------------NNHEIADYEKLKEWLP-------------VNLYVGGAEHAVL
SYL_LACRD       YTDPH-------------NDEEFASKEALDYWSP-------------VDLYVGGAEHAVL
SYL_LEUMM       YVDPH-------------NSEALADPEKLKYWMN-------------VDLYVGGAEHAVL
SYL_OENOB       YIDPH-------------NDKVLADPEKLKYWMN-------------VDLYVGGAEHAVL
SYL_SALRD       FIDPD-------------NDEQLVDPEKEEYWMP-------------VDLYVGGSEHAVL
SYL1_RHIL3      FLDPE-------------NTSEPVGREAERYWMP-------------VDLYVGGAEHAVL
SYL_RHOBA       YIDPK-------------NSDALIDPQKEKDWMP-------------VDLYVGGAEHAVL
SYL_PELLD       FIDPR-------------NSEHLVDAEKEHYWMN-------------VDLYIGGAEHAVL
SYL_CHLPM       FIDPH-------------NSKLPVDPAKEAYWMN-------------VDLYIGGAEHAVL
SYL_CHLCH       FIDPH-------------NHAQVVDGNNERYWMN-------------VDLYIGGAEHAVL
SYL_CHLTE       FIDPQ-------------NSDALVDPSLEQYWMN-------------VDLYIGGAEHAVL
SYL_CHLPD       FIDPE-------------NNAQLIDPAKEKYWMN-------------VDLYIGGAEHAVL
SYL_LEPBL       YIDPK-------------NGKLFCDPDLEKKWMP-------------VDLYVGGAEHAVL
SYL_LEPBJ       YIDPK-------------NGKLFCDPDLEKKWMP-------------VDLYVGGAEHAVL
SYL_LEPIC       YIDPK-------------NGRFLCDPELEKKWMP-------------VNLYVGGSEHAVL
SYL_LEPIN       YIDPK-------------NGRFLCDPELEKKWMP-------------VNLYVGGSEHAVL
SYL_BACTN       YMDPH-------------NNKALVDPKVDEYWKN-------------VDLYVGGTEHATG
SYL_BACV8       YMDPH-------------NAQALVSEKADHYWQN-------------VDLYVGGTEHATG
SYL_BACFR       YMDPR-------------NHEALVSPAVDQYWKN-------------VDLYVGGTEHATG
SYL_BACFN       YMDPR-------------NHEALVSPAVDQYWKN-------------VDLYVGGTEHATG
SYL_PARD8       YMDPH-------------NDKALVAKDVDEYWRN-------------VDLYIGGTEHATG
SYL_PORGI       YMDPQ-------------NDTALVSRSANEYWRH-------------VDLYIGGTEHATG
SYL_FLAPJ       YMDPH-------------NDNEFASPEAIKYWES-------------VDLYIGGSEHATG
SYL_FLAJ1       YMDAH-------------NENEFASKEALAYWEN-------------VDLYIGGSEHATG
SYL_GRAFK       YMGAG-------------NPDRFVSEEAQKYWEN-------------VDLYIGGSEHATG
SYL_CYTH3       YMDPQ-------------NKTAVAAADKINYWGQ-------------VDLYMGGAEHATG
SYL_BDEBA       YIDPK-------------NTEAPFSPEAEKYWMP-------------VDLYVGGPEHTVG
SYL_SORC5       FLDPQ-------------NDAEPFSEAAYDAWMP-------------VDLYVGGAEHGVL
SYL_TREDE       FIDPH-------------NNEAFADKEKCDYWMP-------------VDLYVGGTEHAVL
SYL_TREPA       YMDPR-------------NKTAFCAPEKERYWAP-------------VALYVGGAEHAVL
SYL_BORAP       YLDPK-------------NSKEFANHKKIEYWMP-------------VDLYIGGAEHTVL
SYL_BORBP       YLDPK-------------NPKEFASKKKIEYWMP-------------VDLYIGGAEHTVL
SYL_BORBU       YLDPK-------------NSKEFANKKKIEYWMP-------------VDLYIGGAEHTVL
SYL_CHLTR       FCDAH-------------NSAAPWAKEKEQYWMP-------------VDLYIGGAEHAVL
SYL_CHLTA       FCDAH-------------NSAAPWAKEKEQYWMP-------------VDLYIGGAEHAVL
SYL_CHLMU       FCDAH-------------NSCAPWAEEKEQYWMP-------------VDLYIGGAEHAVL
SYL_CHLFF       FCDAL-------------NSQAPWSNEKEKYWMP-------------VDLYIGGAEHAVL
SYL_CHLCV       FCDAH-------------NSQAPWSNENERYWMP-------------VDLYIGGAEHAVL
SYL_CHLAB       FCDAH-------------NSQAPWSHENERYWMP-------------VDLYIGGAEHAVL
SYL_CHLPN       FCDAH-------------NSQLPWSKEKESYWMP-------------VDLYIGGAEHAVL
SYL_PARUW       FCDPH-------------NTEKAFSPEKEKYWLP-------------VDLYIGGVEHAVL
SYL_ALKOO       YTDPH-------------NNEELASKENLDYWMP-------------IDWYNGGMEHTTL
SYL_UREP2       YILK-------NEDGSYTPLNSEEAKKRFAKWLP-------------VDVYIGGQEHAVL
SYL_UREPA       YILK-------NEDGSYTPLNSEEAKKRFAKWLP-------------VDVYIGGQEHAVL
SYL_MYCPU       YILK-------NADGSYEKLDSEEAKKRFKKWLP-------------VDLYIGGQEHAVL
SYL_MYCPE       YLLK-------DGD-SYLPLDSKQAYEIFKRWLP-------------VDIYIGGQEHAVL
SYL_MYCGA       YLLKLTDLNQADGDQNYLALNSEKAKELFDHFMP-------------VDLYVGGQEHAVL
SYL_MYCGE       YLML-------IKNPNFWPIDSKEAKKLFDQYLP-------------VDLYVGGAEHAVL
SYL_MYCPN       YLML-------INNENFWPIDSREAKDLFERYLP-------------VDLYVGGAEHAVL
SYL_MYCCT       YILAN-------SKNNLIDLTSDEAKKRLEKWLP-------------VDLYIGGQEHAVG
SYL_MYCMS       YILAN-------SKNNLIDLTSDEAKKRLEKWLP-------------VDLYIGGQEHAVG
SYL_MESFL       YILAD-------GENEFIDIDSAEAKKRFEKWMP-------------VDLYVGGQEHAVG
SYL_ACHLI       YILK--------SNLGYIPLDSKEAKAVLDQFLP-------------VDLYVGGTEHAVG
SYL_PSEA6       YCSAQ-------------NQDAMLDPTQANYWLP-------------VDQYVGGIEHAIL
SYL_COLP3       YCSPN-------------DDTQMIDPAKANYWLP-------------VDQYIGGIEHAIL
SYL_IDILO       YCSAQ-------------TDDAMLDPEKANYWLP-------------VDQYIGGIEHAIL
SYL_PSEHT       YCSPR-------------HDEGMLDPAAANYWLP-------------VNQYIGGIEHAIL
SYL_PSYIN       YCSPQ-------------SDDAMLDPEKANYWLP-------------VDQYIGGIEHAIL
SYL_SALCH       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_SALTI       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_SALTY       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_SALPB       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_SALPA       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_CITK8       YTCPQ-------------YNEGMLDPEAANYWLP-------------VDIYIGGIEHAIM
SYL_SALAR       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_SHIFL       YTCPE-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_SHIF8       YTCPE-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_SHIBS       YTCPE-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_ECOL6       YTCPE-------------YKEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_ECOL5       YTCPE-------------YKEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_ECO57       YTCPE-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_SHISS       YTCPE-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_ECOLI       YTCPQ-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_ECOLC       YTCPQ-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_SHIDS       YTCPQ-------------YKEGMLDSEAANYWLP-------------VDIYIGGIEHAIM
SYL_ECOHS       YTCPQ-------------YKEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_ECOUT       YTCPE-------------YKEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_ECOK1       YTCPE-------------YKEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_ECO24       YTCPE-------------YKEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_KLEP7       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_CROS8       YTCPQ-------------YKEGMLDEKAANYWLP-------------VDIYIGGIEHAIM
SYL_ENT38       YTCPQ-------------YQEGMLDSKAANYWLP-------------VDIYIGGIEHAIM
SYL_YERPA       YTCPQ-------------YDDGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_YERP3       YTCPQ-------------YDDGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_YERPE       YTCPQ-------------YDDGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_YERPN       YTCPQ-------------YDDGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_YERPS       YTCPQ-------------YDDGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_YERPP       YTCPQ-------------YDDGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_YERE8       YTCPQ-------------FDKGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_SERP5       YTCPQ-------------YDKGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_PECAS       YTCPQ-------------YDQGMLDPAAANYWLP-------------VDQYVGGIEHAIM
SYL_SODGM       YTCPD-------------YDRGMLDPAAANYWLP-------------VDQYIGGIEHAIM
SYL_PHOLL       YTCPD-------------YDKGLLDPAAANYWLP-------------VDQYIGGIEHAIM
SYL_MANSM       YTSPQ-------------YHEGMLDSDEANYWLP-------------VDQYIGGIEHATM
SYL_ACTSZ       YTCPQ-------------YHEGMLDSEEANYWLP-------------VDQYIGGIEHATM
SYL_HAES1       YTSPQ-------------YQQAMLDADEANYWLP-------------VDQYIGGIEHATM
SYL_HISS2       YTSPQ-------------YQQAMLDADETNYWLP-------------VDQYIGGIEHATM
SYL_PASMU       YTSPK-------------FAEAMLDADEANYWLP-------------VDQYIGGIEHATM
SYL_HAEIG       YTCPQ-------------YQNGMLDAEEANYWLP-------------VDQYIGGIEHATM
SYL_HAEIN       YTCPQ-------------YQNGMLDAEEANYWLP-------------VDQYIGGIEHATM
SYL_HAEI8       YTCPQ-------------YQNGMLDAEEANYWLP-------------VDQYIGGIEHATM
SYL_HAEIE       YTCPQ-------------YQNGMLDAEEANYWLP-------------VDQYIGGIEHATM
SYL_ACTP2       YTCPQ-------------YHEGMLDSDEANYWLP-------------VDQYIGGIEHATM
SYL_HAEDU       YTCPQ-------------YHQGMLDADEANYWLP-------------VDQYIGGIEHATM
SYL_SHESA       YCSPQ-------------ADQ-MLDPTKANYWLP-------------VDQYIGGIEHACM
SYL_SHESM       YCSPQ-------------ADQ-MLDPTKANYWLP-------------VDQYIGGIEHACM
SYL_SHESR       YCSPQ-------------ADQ-MLDPTKANYWLP-------------VDQYIGGIEHACM
SYL_SHEON       YCSPQ-------------AEQ-MLDPTKANYWLP-------------VDQYIGGIEHACM
SYL_SHEB9       YCSPH-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEB5       YCSPH-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEB8       YCSPH-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHESW       YCSPQ-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEPC       YCSPQ-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEAM       YCSPK-------------ANE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEHH       YCSPH-------------ADQ-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEPA       YCSPH-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHELP       YCSPK-------------ADQ-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHESH       YCSPH-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEDO       YCSPH-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_SHEFN       YCSPH-------------ADE-MLDPAKANYWLP-------------VDQYIGGIEHACM
SYL_VIBPA       YCSPQ-------------ADD-ILDPEKANYWLP-------------VDQYIGGIEHACM
SYL_VIBCB       YCSPQ-------------ADD-ILAPEKANYWLP-------------VDQYIGGIEHACM
SYL_VIBVU       YCSPQ-------------ADD-ILDPEKANYWLP-------------VDQYIGGIEHACM
SYL_VIBVY       YCSPQ-------------ADD-ILDPEKANYWLP-------------VDQYIGGIEHACM
SYL_VIBCH       YCSPQ-------------ADD-ILDPEKANYWLP-------------VDQYIGGIEHACM
SYL_VIBC3       YCSPQ-------------ADD-ILDPEKANYWLP-------------VDQYIGGIEHACM
SYL_ALIF1       YCSPQ-------------ADD-ILDPEKANYWLP-------------VDQYIGGIEHACM
SYL_PHOPR       YCSPQ-------------ADD-ILDPEKANYWLP-------------VDQYVGGIEHACM
SYL_AERS4       YCSPD-------------YDKGMLDPAAANHWLP-------------VDQYIGGIEHACM
SYL_AERHH       YCSPD-------------YDKGMLDPAAANHWLP-------------VDQYIGGIEHACM
SYL_MARHV       FCSPN-------------YDKGMLDPAAANYWLP-------------VDQYIGGIEHAIL
SYL_HAHCH       FCCPN-------------LESAMLDPAAANYWLP-------------VDYYVGGIEHAIL
SYL_SACD2       YTSPN-------------ADSMLD-PDKANYWLP-------------VDQYVGGIEHAIL
SYL_MARMS       YCCPD-------------STDAML-TEEANYWLP-------------VDQYVGGVEHAIL
SYL_ALCBS       YCSPQ-------------SDTAMLDPAATNYWLP-------------VDQYIGGIEHAIL
SYL_PSEAB       YACPQ-------------FEGGMLDRKAADYWLP-------------VDQYIGGIEHAIL
SYL_PSEAE       YACPQ-------------FEGGMLDRKAADYWLP-------------VDQYIGGIEHAIL
SYL_PSEA7       YACPQ-------------FEGGMLDKKAADYWLP-------------VDQYIGGIEHAIL
SYL_PSEU5       YASPN-------------YDKGMVDPQAANHWLP-------------VDQYIGGIEHAIL
SYL_PSEMY       YASPN-------------YEGGMVDPQAANHWLP-------------VDQYIGGIEHAIL
SYL_PSEP1       YASPN-------------YDKGLVDPKAANHWLP-------------VDQYIGGIEHAIL
SYL_PSEPK       YASPN-------------YDKGLVDPKAANHWLP-------------VDQYIGGIEHAIL
SYL_PSEPG       YASPN-------------YDKGLVDPKAANHWLP-------------VDQYIGGIEHAIL
SYL_PSEE4       YASPN-------------YDKGLVDPKAANHWLP-------------VDQYIGGIEHAIL
SYL_PSEU2       YASPH-------------YEGGLVEPNAANHWLP-------------VDQYIGGIEHAIL
SYL_PSE14       YASPH-------------YEGGLVEPNAANHWLP-------------VDQYIGGIEHAIL
SYL_PSESM       YASPH-------------YEGGLVEPNAANHWLP-------------VDQYIGGIEHAIL
SYL_NEIMB       YMSPK-------------FSDGMVDPAAAKYWGA-------------VDQYIGGIEHAIL
SYL_NEIMF       YMSPK-------------FSDGMVDPAAAKYWGA-------------VDQYIGGIEHAIL
SYL_NEIG1       YMSPK-------------FSDGMVSAESAKYWGA-------------VDQYIGGIEHAIL
SYL_NEIM0       YMSPK-------------FSDGMVSAEAAKYWGA-------------VDQYIGGIEHAIL
SYL_NEIMA       YMSPK-------------FSDGMVDPAAAKYWGA-------------VDQYIGGIEHAIL
SYL_CHRVO       YASPK-------------CDTAMVDKQAADYWLQ-------------VDQYVGGIEHAIL
SYL_THIDA       YACPD-------------YADGMLDAR-ADQWLP-------------VDQYIGGIEHAIL
SYL_DECAR       YACPD-------------NTTAMVDER-VAYWCKG-----------GIDQYIGGIEHAIL
SYL_AZOSB       YASPD-------------STTAMVDER-VNYWAP-------------VDQYIGGIEHAIL
SYL_CUPMC       YTCPD-------------AG-TMVDAR-NDYWMP-------------MDQYIGGIEHAIL
SYL_CUPPJ       YTCPD-------------AA-TMVDAR-NDYWMP-------------MDQYIGGIEHAIL
SYL_RALSO       YTCPD-------------GA-TMVDGR-NDYWMP-------------MDQYIGGIEHAIL
SYL_JANMA       YCSPN-------------SSDAMVDSR-NDYWMP-------------MDQYIGGIEHAVL
SYL_HERAR       YCSPN-------------SNDAMVDSR-NDYWMP-------------MDQYIGGIEHAVL
SYL_BURCH       YTAPD-------------AE-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURCA       YTAPD-------------AE-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURL3       YTAPD-------------AE-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURCM       YTAPD-------------AD-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURVG       YTAPD-------------AD-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURP0       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURPS       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURP6       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURP1       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURM7       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURM9       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURMA       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURMS       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_BURTA       YAAPD-------------AQ-TMVDAR-TDYWMP-------------MDQYIGGIEHAIL
SYL_PARXL       YASPG-------------AK-TMVDER-TDYWAP-------------MDQYIGGIEHAIL
SYL_POLAQ       YTGPD-------------AT-SMVDGR-NEYWMP-------------MDQYIGGIEHAIL
SYL_BORBR       YTSPD-------------NDQAMVDAR-NDYWMP-------------MDQYIGGIEHAVL
SYL_BORPA       YTSPD-------------NDQAMVDAR-NDYWMP-------------MDQYIGGIEHAVL
SYL_BORPE       YTSPD-------------NDQAMVDAR-NDYWMP-------------MDQYIGGIEHAVL
SYL_BORPD       YTSPG-------------NDQAMVDAR-NDYWMP-------------MDQYIGGIEHAVL
SYL_BORA1       YTSPG-------------NDQAMVDKR-NDYWMP-------------MDQYIGGIEHAVL
SYL_METPP       YCCPD-------------SDAAMVDSR-NDYWMP-------------MDQYIGGIEHAVL
SYL_ACISJ       YCDPK-------------NRDAMVAGG-TDYWMRDQKAATG---GSGMDQYIGGIEHAIL
SYL_ACIAC       YCDPK-------------NADAMVAGG-ADYWMP-------------MDQYIGGIEHAIL
SYL_RHOFT       YCDPK-------------NEKAMVGEG-AAYWMP-------------MDQYIGGIEHAIL
SYL_VEREI       YCDPK-------------NDQAMVAEG-TDYWMRDPQQATG---GSGMDQYIGGIEHAIL
SYL_POLNA       YCDPK-------------NSEAMVAGG-ADYWMP-------------MDQYIGGIEHAIL
SYL_POLSJ       YCDPK-------------NDQQMVAGG-ADYWMP-------------MDQYIGGIEHAIL
SYL_METCA       YTCPD-------------NTEAMLDRR-ADYWLP-------------VDQYVGGIEHAIL
SYL_DICNV       YMSPH-------------YQKGMLDPEEVAYWQD-------------VDQYIGGIEHAIL
SYL_PSYCK       FASPH-------------DTTNMVNKSAANKWLP-------------VDQYIGGVEHAVM
SYL_PSYA2       FASPN-------------DTTNMVNKSAANKWLP-------------VDQYIGGVEHAVM
SYL_PSYWF       FASPN-------------DDTQMVEKAAADKWLP-------------VDQYVGGVEHAVM
SYL_ACIAD       YASPD-------------FTGGMVKPEAAQSWLP-------------VNQYIGGVEHAIL
SYL_NITEU       YACPD-------------QSAAMTDQR-ANYWLP-------------VDQYIGGIEHAIL
SYL_NITEC       YACQD-------------QQAAMTDQR-ANYWLP-------------VDQYIGGIEHAIL
SYL_NITMU       YACTD-------------QHRAMVDAR-VDYWLP-------------VDQYIGGIEHAIL
SYL_METFK       YASFD-------------AHSSMVDER-ANYWLP-------------VDQYIGGIEHAIL
SYL_HYDCU       YTSRH-------------EDNAMLDKAAADHWLP-------------VDQYIGGIEHAIL
SYL_XYLFA       YTSP--------------NAHEMLDKR-ANYWLP-------------VDQYIGGIEHAIL
SYL_XYLFT       YTSP--------------NAREMLDKR-ANYWLP-------------VDQYIGGIEHAIL
SYL_XANC8       YTSP--------------NARDMVDRR-ANYWMP-------------ADLYVGGIEHAIL
SYL_XANCP       YTSP--------------NARDMVDRR-ANYWMP-------------ADLYVGGIEHAIL
SYL_XANCB       YTSP--------------NARDMVDRR-ANYWMP-------------ADLYVGGIEHAIL
SYL_XANC5       YTSP--------------NARDMVDRR-ANYWMP-------------ADLYVGGIEHAIL
SYL_XANAC       YTSP--------------KARDMVDRR-ANYWMP-------------ADLYVGGIEHAIL
SYL_XANOR       YTSP--------------NAREMVDRR-ANYWMP-------------ADLYVGGIEHAIL
SYL_XANOM       YTSP--------------NAREMVDRR-ANYWMP-------------ADLYVGGIEHAIL
SYL_NITOC       YCCPD-------------NNATMVDER-GDYWLP-------------VDQYIGGIEHAVL
SYL_ALKEH       FACAD-------------QKGAMLDER-ADQWLP-------------VDQYIGGIEHAIL
SYL_HALHL       FACAD-------------QDGAMLDER-ADHWTP-------------VDQYIGGIEHAVL
SYL_CHRSD       FASAD-------------NMEAMLDER-ADYWLP-------------VDLYIGGIEHAIL
SYL_BUCAI       YTCPN-------------FNTGMIDSIASKYWLP-------------VDQYIGGIEHAIM
SYL_BUCAP       YTCPN-------------FNTGMIDPTASKYWLP-------------VDQYIGGIEHATM
SYL_BUCCC       YTNPK-------------YEKDIIDPKASEYWLP-------------VDQYIGGIEHAVM
SYL_BUCBP       FTCNN-------------FHKGMISQKLANYWLP-------------VDQYIGGIEHAVM
SYL_WIGBR       YTCTK-------------YTKDILDPNATNYWFP-------------VDQYIGGIEHATM
SYL_BLOPB       YTCPR-------------YNDAMLNVHAANYWLP-------------VDQYIGGIEHAIM
SYL_BLOFL       YTCPH-------------YHDGMLQSDAANYWLP-------------IDQYIGGIEHATM
SYL_BAUCH       YTCPN-------------YDQGMLDTTAANYWLP-------------IDQYIGGIEHAIM
SYL_COXBU       YSCPD-------------QDKVMLDDR-AKYWTP-------------VDQYIGGIEHAVM
SYL_COXBR       YSCPD-------------QDKVMLDDR-AKYWTP-------------VDQYIGGIEHAVM
SYL_COXBN       YSCPD-------------QDKVMLDDR-AKYWTP-------------VDQYIGGIEHAVM
SYL_LEGPH       FACKG-------------QENAMLDDR-AKYWTP-------------VDQYIGGIEHAVM
SYL_LEGPC       FACKG-------------QENAMLDDR-AKYWTP-------------VDQYIGGIEHAVM
SYL_LEGPA       FACKG-------------QENAMLDDR-AKYWTP-------------VDQYIGGIEHAVM
SYL_LEGPL       FACKG-------------QENAMLDDR-AKYWTP-------------VDQYIGGIEHAVM
SYL_FRATT       YTCP--------------TANQMLDQE-ANYWLP-------------VDKYIGGIEHAIM
SYL_FRAT1       YTCP--------------TANQMLDQE-ANYWLP-------------VDKYIGGIEHAIM
SYL_FRATW       YTCP--------------TANQMLDQE-ANYWLP-------------VDKYIGGIEHAIM
SYL_FRATF       YTCP--------------TSNQMLDQE-ANYWLP-------------VDKYIGGIEHAIM
SYL_FRATH       YTCP--------------TSNQMLDQE-ANYWLP-------------VDKYIGGIEHAIM
SYL_FRATO       YTCP--------------TSNQMLDQE-ANYWLP-------------VDKYIGGIEHAIM
SYL_FRATN       YTCP--------------TANQMLDQE-ANYWLP-------------VDKYIGGIEHAIM
SYL_FRAP2       YTCP--------------TADKMLSEE-ANYWLP-------------VDKYIGGIEHAIM
SYL_RUTMC       YTCKD-------------NNDKMLDKR-ANYWLANGG----------VDQYIGGIEHAIL
SYL_VESOH       HTCNN-------------NNNAMLDKR-VNYWLE-------------VDQYIGGVEHSIL
SYL_RICRS       YCN-S-------------NATEMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICRO       YCN-S-------------NATEMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICCN       YCN-S-------------NATEMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICM5       YCN-S-------------NAIEMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICFE       YCN-S-------------NATEMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICAH       YCN-S-------------NATEMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICCK       YCN-S-------------HATDMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICBR       YCN-S-------------QALEMTDKKACDYWLP-------------VDKYIGGIEHAVM
SYL_RICPR       YCN-S-------------NAVEMTDKKACNYWLP-------------VDKYIGGIEHAVM
SYL_RICTY       YCN-N-------------NAVEMTDSKACNYWLP-------------VDKYIGGIEHAVM
SYL_ORITB       FCN-P-------------TSDDMVDAKAAKYWLP-------------VDQYIGGIEHAVM
SYL_WOLPM       FCS-E-------------DKS--IDKDACNRFMP-------------VDYYIGGIEHAIL
SYL_WOLTR       FCS-E-------------NKS--IDKNACNRFMP-------------VDYYIGGIEHAIL
SYL_EHRRW       FCG-I-------------GKG--IDKDVCNKLLP-------------VDYYIGGIEHAVL
SYL_EHRRG       FCG-I-------------GKG--IDKDVCNKLLP-------------VDYYIGGIEHAVL
SYL_EHRCJ       FCG-T-------------SSG--IDKDTCNMLLP-------------VDYYIGGIEHAVL
SYL_EHRCR       FCG-T-------------SNG--INKDVCNMLLP-------------VNYYVGGVEHAVL
SYL_ANAMM       FCS-E-------------QGG--INAADCNKLLP-------------VDYYIGGVEHAVL
SYL_NEOSM       FCS-K-------------EGG--IVKESCKRFLP-------------VDMYIGGIEHAIL
SYL2_RHIL3      FTAPW-------------ED-KPTDPEAANRWLP-------------VDQYIGGIEHAIL
SYL_RHIEC       FTAPW-------------EA-KPTDPEAANRWLP-------------VDQYIGGIEHAIL
SYL_RHIME       FTAPW-------------ED-NPTDPKAANHWLP-------------VDQYIGGIEHAIL
SYL_SINMW       FTAPW-------------ED-GPTDPKAANHWLP-------------VDQYIGGIEHAIL
SYL_AGRFC       FTAPW-------------ED-EPTDPQVANHWLP-------------VDQYIGGIEHAIL
SYL_BRUAB       FTAPW-------------EN-EPTDRKAADHWLP-------------VDQYIGGIEHAIL
SYL_BRUA2       FTAPW-------------EN-EPTNRKAADHWLP-------------VDQYIGGIEHAIL
SYL_BRUSI       FTAPW-------------EN-EPTDRKAADHWLP-------------VDQYIGGIEHAIL
SYL_BRUO2       FTAPW-------------EN-EPTDRKAADHWLP-------------VDQYIGGIEHAIL
SYL_BRUME       FTAPW-------------EN-EPTDRKAADHWLP-------------VDQYIGGIEHAIL
SYL_BRUSU       FTAPW-------------EN-EPTDRKAADHWLP-------------VDQYIGGIEHAIL
SYL_BRUC2       FTAPW-------------EN-EPTDRKAADHWLP-------------VDQYIGGIEHAIL
SYL_OCHA4       FTAPW-------------EN-EPTDRKVADHWLP-------------VDQYIGGIEHAIL
SYL_CHESB       FTSPH-------------AD-SPVEKDVVNRWLP-------------VDQYIGGIEHAIL
SYL_RHILO       FTAPW-------------AY-EPTDPRAANEWLP-------------VDQYIGGIEHAIL
SYL_BART1       FTAPF-------------AP-EPVEKQATAEWLP-------------VQQYIGGIEHAIL
SYL_BARHE       FTAPF-------------AQ-EPVDKKATTEWLP-------------VQQYIGGIEHAIL
SYL_BARQU       FTAPW-------------AQ-EPVDKNAIAEWLP-------------VQQYIGGIEHAIL
SYL_BARBK       FTAPW-------------AQ-EPTDQDIAAQWLP-------------VQQYIGGIEHAIL
SYL_RHOP2       FTDPW-------------NETAPTTPDVVNRMLP-------------VDQYIGGVEHAIL
SYL_RHOPS       FTDPW-------------NENAPTTPDVVNRMLP-------------VDQYIGGVEHAIL
SYL_RHOPA       FTDPW-------------NTEAPTTPDVVNRMMP-------------VDQYIGGVEHAIL
SYL_RHOP5       FTDPW-------------NENAPTTPDVVNKMMP-------------VDQYIGGVEHAIL
SYL_NITHX       FTDPW-------------NETAPTTPEIANRMMP-------------VDQYIGGVEHAIL
SYL_NITWN       FTDPW-------------NDSAPTTREVADRMLP-------------VDQYIGGVEHAIL
SYL_BRASB       FTDPW-------------NETAPTTPDVANRMMP-------------VDQYIGGVEHAIL
SYL_BRASO       FTDPW-------------NETAPTTPAVANRMMP-------------VDQYIGGVEHAIL
SYL_BRADU       FTDPW-------------NENAPTTPAVANRMLP-------------IDQYIGGVEHAIL
SYL_RHOPB       FTDPW-------------NEDAPTTRAVVDRMMP-------------VDQYIGGVEHAIL
SYL_AZOC5       YASDN-------------PD-KPLDKDAVRHWLP-------------VDQYIGGIEHAIL
SYL_PARL1       FTAPD-------------AP-TPTDKALADHWLP-------------VDQYIGGIEHAIL
SYL_CAUVC       FADTQ-------------AAE-PVGKDAADHWLP-------------VDQYIGGVEHAIL
SYL_CAUSK       FTDPT-------------AAE-PISKAAADHWMP-------------VDQYIGGVEHAVL
SYL_MARMM       FTSPW-------------SEDTPFLASDAEHWMP-------------VDQYVGGIEHAIL
SYL_HYPNA       FASVS-------------DPE------ERAYWLP-------------VDQYIGGVEHAVL
SYL_RUEST       FTAPR-------------AET-PTDLDAANYWMN-------------VDQYIGGIEHAIL
SYL_RUEPO       FTAPR-------------AET-PTDMAEAEYWMN-------------VDQYIGGIEHAIL
SYL_ROSDO       FTAPR-------------AET-PTVMEDAQYWMN-------------VDQYIGGIEHAIL
SYL_JANSC       FTAPH-------------ADT-PTSKAEVEYWMN-------------VDQYIGGIEHAIL
SYL_DINSH       FTAPR-------------AET-PTDPAEVGYWMN-------------VDQYIGGVEHAIL
SYL_RHOS1       FTAPR-------------AAT-PTDAEEADYWMN-------------VDQYIGGIEHAIL
SYL_RHOS4       FTAPR-------------AAT-PTDAEEADYWMN-------------VDQYIGGIEHAIL
SYL_RHOS5       FTAPR-------------ATT-PTDPEEAEYWMN-------------VDQYIGGIEHAIL
SYL_PARDP       FTSPH-------------AAT-PTDRPETDYWMN-------------VDQYIGGIEHAIL
SYL_ZYMMO       FASQP-------------DD-KPFDKATAEKWLP-------------VGQYIGGVEHAIL
SYL_SPHWW       FASQP-------------SD-KPFDRAVAESWMP-------------VGQYIGGVEHAIL
SYL_NOVAD       FASQP-------------ED-RPFDPEEIKRWLP-------------VEQYIGGIEHAIL
SYL_SPHAL       FASAP-------------TD-KPFDPEVIRRWLP-------------VDQYIGGIEHAIL
SYL_GRABC       FASPH-------------AH-VPVLKEAAQNWLP-------------VDQYIGGIEHAIL
SYL_GLUOX       FTSPH-------------AE-TPTVPAAANGWLP-------------VDQYIGGIEHAIL
SYL_ACICJ       FCAPH-------------AP-VPADPAATSHWMP-------------VDHYIGGIEHAIL
SYL_MAGSA       YTSPD-------------RTDVAFDRVAADYWMS-------------VDQYIGGIEHAVL
SYL_RHORT       FCAPH-------------DTDRAFEREAVDYWLP-------------VDQYVGGVEHAVL
SYL_MAGMM       YCSPH-------------MGGVPLDKAAVDRWMP-------------VNQYVGGIEHAVL
SYL_CAMJ8       FASDEKT-----------WQEKALDEKSVKYWMS-------------VDQYIGGIEHAIL
SYL_CAMJJ       FASDEKT-----------WQEKALDEKSVKYWMS-------------VDQYIGGIEHAIL
SYL_CAMJR       FASDEKT-----------WQEKALDEKSVKYWMS-------------VDQYIGGIEHAIL
SYL_CAMJE       FASDEKT-----------WQEKALDEKSVKYWMS-------------VDQYIGGIEHAIL
SYL_CAMJD       FASDEKT-----------WQEKALDEKSVKYWMS-------------VDQYIGGIEHAIL
SYL_CAMC1       FASDEKT-----------WEQKALDEKSVNYWMN-------------VDQYIGGIEHAIL
SYL_CAMC5       FASDEKT-----------WQQTAFDKKSVDYWMS-------------VDQYIGGIEHAIL
SYL_CAMFF       FASDEKT-----------WEDVAFDKKSVDYWMS-------------VDQYIGGIEHAIL
SYL_CAMHC       FTSDENM-----------WQEKGIDEKSANYWMN-------------VDQYIGGIEHAIL
SYL_ARCB4       YATDNKK-----------WNEVGISKEDSDYWMD-------------VDQYIGGIEHAIL
SYL_NITSB       YTTPRKY-----------WEEVPFRKEDTDYWMP-------------VDQYIGGIEHAIL
SYL_WOLSU       YTTPKEE-----------WETHALNEAMQRYWMG-------------VDEYIGGIEHAIL
SYL_HELHP       YSTPRKL-----------WEKQAFDKESLTYWLN-------------VDEYIGGIEHAIL
SYL_HELPY       YTTPKNQ-----------RENQAFDQNYLKYFMP-------------VDTYIGGIEHAIL
SYL_HELPH       YTTPKNQ-----------RENQAFDQNYLKYFMP-------------VDTYIGGIEHAIL
SYL_HELPJ       YTTPKNQ-----------RENQAFDQNYLKYFMP-------------VDTYIGGIEHAIL
SYL_HELAH       YTTPKNQ-----------RENQAFDKNYLKYFMP-------------VDTYIGGIEHAIL
SYL_THEMA       YVNPHL------------EDKP-FEPDDVNYWLP-------------VDQYIGGVEHAVL
SYL_THEP1       YVNPHL------------EDKP-FEPDDVNYWLP-------------VDQYIGGVEHAVL
SYL_THEM4       YINPKL------------EDKP-FDTEDINYWMP-------------VDQYIGGVEHAVL
SYL_FERNB       YVNPKL------------DDKP-FESDDVNYWLP-------------VDQYIGGVEHAVL
SYL_PSELT       YVNPDR------------DDVP-FVKEDVDHWLP-------------VDQYVGGVEHAVL
SYL_CALS8       YTDPKN------------SEKP-FEKSLVDYWLP-------------VDQYIGGVEHAIL
SYL_HUNT2       YCDPCN------------DKAP-FDKERIRYWLP-------------VDQYIGGVEHAIL
SYL_DESHY       YTDPHN------------AQLP-FAKEAADHWMN-------------VDQYVGGVEHAIL
SYL_SYNWW       FCSPHE------------SKQP-FSREAVDYWMP-------------VDQYIGGVEHAIL
SYL_CARHZ       YTSPRD------------KQQP-WSKEKVERWLP-------------VDQYIGGVEHAIL
SYL_PELTS       YTSPRD------------NDAP-WDRNKVDYWLP-------------VDQYIGGVEHAIL
SYL_MOOTA       YTSPHS------------QDRA-FERDKVDYWMN-------------VDQYIGGVEHAIL
SYL_DESRM       YTSSRD------------TEYA-WDKNKADRWMN-------------VDQYIGGVEHAIL
SYL_SYMTH       YTDPQN------------AERP-WNREDVDYWMP-------------VDQYVGGIEHAVL
SYL_DESVH       YTDATN------------DKAP-FTPDALRYWLP-------------VDQYIGGVEHAIL
SYL_DESVV       YTDATN------------DKAP-FTPDALRYWLP-------------VDQYIGGVEHAIL
SYL_DESAG       YTSAGD------------NEAP-FDAQALKYWLP-------------VDQYIGGVEHAIL
SYL_LAWIP       FVDPKN------------TKQP-FDTSIAKYWLN-------------VDQYIGGVEHAIL
SYL_GEOMG       YCCPDF------------AAGP-IDKARAEYWMS-------------VDQYIGGIEHAVL
SYL_GEOSL       YCCPDF------------ACGP-IDRARAGYWMP-------------VDQYIGGIEHAVL
SYL_GEOUR       YCCPDF------------VSGP-LDKEKTEYWMS-------------VDQYIGGIEHAVM
SYL_PELPD       YCCPDF------------HDAP-LDRTRVDYWMS-------------VDQYIGGIEHAVL
SYL_PELCD       YTCPRF------------EQGP-VDRATVDHWLP-------------VDQYIGGIEHAVM
SYL_SYNAS       YCCPHF------------AEKPGLNRQQVDYWMP-------------VDQYIGGIEHAIL
SYL_SYNFM       FACARY------------DQGP-LDLPKVKYWMP-------------VDQYIGGIEHAVL
SYL_DESPS       YTSPRH------------TEAP-LDKAKAKYWLA-------------VDQYIGGVEHAIL
SYL_FUSNN       YCDPK-------------NLNLPFSKEIVDKWTP-------------VDQYIGGVEHAVM
SYL_TRIV2       FTDAR-------------NEAQVFESAKTNDWMP-------------VDQYVGGIEHAIL
SYL_NOSS1       FTDAR-------------NEAQVFESAKTNDWMP-------------VDQYVGGIEHAIL
SYL_ACAM1       YPDAK-------------NDKAVFDSAKTNDWLP-------------VDQYVGGIEHAIL
SYL_TRIEI       YPDAT-------------NEEQVFDSKIVNDWLP-------------VDQYVGGIEHAIL
SYL_SYNY3       YADAQ-------------NTELPFDGEKVAHWLP-------------VDQYVGGIEHAIL
SYL_SYNE7       YSDAS-------------NPEIAFTKDKVNDWLP-------------VDQYVGGIEHAIL
SYL_SYNP6       YSDAS-------------NPEIAFTKDKVNDWLP-------------VDQYVGGIEHAIL
SYL_THEEB       YADAR-------------NSEAPFDPAAIKDWLP-------------VDQYVGGIEHAIL
SYL_SYNJB       FSDAR-------------NDREIFRKDRVNAWLP-------------VDQYVGGIEHAIL
SYL_SYNJA       FSDPR-------------NDREIFRKDLVNAWLP-------------VDQYVGGIEHAIL
SYL_GLOVI       FADAR-------------NGAEPFSREAVDYWLP-------------VDQYVGGIEHAIL
SYL_SYNS3       FADPH-------------NRDLPFNATSVNRWLP-------------VKQYVGGIEHAIL
SYL_SYNPW       FADPH-------------NTERAFDADAVERWLP-------------VQQYVGGIEHAIL
SYL_PROMM       FADPL-------------NSQRPFDKDIVDEWLP-------------VDQYVGGIEHAIL
SYL_PROM3       FADPL-------------NSQRPFDKDIVDEWLP-------------VDQYVGGIEHAIL
SYL_SYNSC       FADPH-------------NTEKPFSKEAVNRWLP-------------VKQYVGGIEHAIL
SYL_SYNS9       FADPH-------------NTDQPFSKEAVRRWLP-------------VKQYVGGIEHAIL
SYL_SYNPX       FADPH-------------NTEQPFSREAVNRWLP-------------VQQYVGGIEHAIL
SYL_SYNR3       YTDAN-------------NDSAAFTNASIDAWMP-------------VDQYVGGVEHAIL
SYL_PROMT       YINPD-------------NCEKPFLKSEIDKWLP-------------VKQYVGGIEHAIL
SYL_PROM1       YINPD-------------NCEKPFLKSEIDKWLP-------------VKQYVGGIEHAIL
SYL_PROMA       YIDVE-------------NNKLPFTKTEVDKWLP-------------VDQYVGGIEHAIL
SYL_PROM0       YPSSK-------------CPNKPFEKIEINKWLP-------------VDQYVGGVEHAIL
SYL_PROM9       YPSSR-------------CSTKPFEKIEINNWLP-------------VDQYVGGVEHAIL
SYL_PROMS       YPSSK-------------CSTKPFEKNEINKWLP-------------VDQYVGGVEHAIL
SYL_PROM2       YPSSK-------------CSNKPFEKIEINKWLP-------------VDQYVGGVEHAIL
SYL_PROMP       YPSSK-------------SLTKPFEKEKINKWLP-------------VDQYVGGVEHAIL
SYL_PROM5       YPSSK-------------CKTKPFEKDNVNKWLP-------------VDQYVGGVEHAIL
SYL_SOLUE       YCDPH-------------NSERPFDPAKIAYWFE-------------IDQYIGGIEHAIL
SYL_DEIRA       YLSPN-------------YDGGPFDPSK-AGLLP-------------VDLYTGGIEHAIL
SYL_DEIGD       YLSPH-------------DDQHPFDPAH-ANLLP-------------VDLYTGGIEHAIL
SYL_RUBXD       YLSPH-------------YEEGPFDPERGSRWLP-------------VDQYTGGIEHATM
SYL_CLOPE       YPDNK-------------NTEAPFNPELINKMLP-------------VDKYVGGPEHACM
SYL_CLOPS       YPDNK-------------NTEAPFNPELINKMLP-------------VDKYVGGPEHACM
SYL_CLOP1       YPDNK-------------NTEAPFNPELINKMLP-------------VDKYVGGPEHACM
SYL_CLOB8       YVDNK-------------NDDAPFDSEKVNKMLP-------------VDKYVGGPEHACM
SYL_CLOB1       YPDNN-------------NEKDAFNPELINKMLP-------------VDKYVGGPEHACM
SYL_CLOBH       YPDNN-------------NEKDAFNPELINKMLP-------------VDKYVGGPEHACM
SYL_CLOBL       YPDNN-------------NEKDAFNPELINKMLP-------------VDKYVGGPEHACM
SYL_CLONN       YVDNN-------------NSEKAFDIDKVNKMLP-------------VDKYVGGPEHACM
SYL_CLOAB       YADNE-------------NSDAPFDKEKISKMLP-------------VDKYVGGPEHACM
SYL_CLOK5       YADNK-------------NTEKAFDKDKINKLLP-------------VDMYVGGPEHACM
SYL_CLOTE       YADNK-------------NSEKAFDPKIINEILP-------------VDKYVGGPEHACM
SYL_CALS4       YPDNK-------------NDKEPFNKEWINKMLP-------------VDKYVGGAEHATM
SYL_ROSCS       FCDAR-------------NDREIFSREAAHRWMP-------------VDQYIGGVEHAIL
SYL_ROSS1       FCDAQ-------------NDREIFSREAARQWMP-------------VDQYIGGVEHAIL
SYL_THEFY       YCSPN-------------LDTAPFDQEKVAKWGP-------------IDQYVGGVEHAIL
SYL_ACIC1       YCSPH-------------DPSQPFDVAKVRQWLP-------------VHQYVGGVEHAIL
SYL_ARTS2       FVSPQ-------------YTEGPFDPKKINDWMP-------------VGQYVGGVEHAIL
SYL_PAEAT       FVSPD-------------YTEGPFDPEKINNWMP-------------VGQYVGGVEHAIL
SYL_RENSM       YTSPE-------------YTDGPFDPAAATRWMG-------------VDQYVGGVEHAIL
SYL_CLAMS       FLSPN-------------DATKAFDPADADRWAP-------------IDQYVGGVEHAIL
SYL_CLAM3       FLSPN-------------DATKAFDPADADRWAP-------------IDQYVGGVEHAIL
SYL_LEIXX       FLNPN-------------DDTRAFDPREAEKWAP-------------VDQYVGGVTHAIL
SYL_KINRD       FVSPH-------------DDTKAFDTDLIAQWGP-------------VDQYVGGVTHAIL
SYL_NOCSJ       YCSPD-------------YTEGPFDVEKAKAWMP-------------ADIYVGGVEHAVL
SYL_TROW8       YLNPD-------------CDTAPFTLEKAKKWGP-------------VDQYCGGVEHAVL
SYL_TROWT       YLNPD-------------CDTAPFTLEKAKKWGP-------------VDQYCGGVEHAVL
SYL_MYCPA       YTDPH-------------NSERFCAKENEAYWMGPRPAEHGPQDPGGVDLYVGGAEHAVL
SYL_MYCA1       YTDPH-------------NSERFCAKENEAYWMGPRPAEHGPQDPGGVDLYVGGAEHAVL
SYL_MYCLE       YTDPH-------------NSERLCAKENEAYWMGPRPTEHGIDDPGGVDLYVGGAEHAVL
SYL_MYCTA       YTDPH-------------NSERFCAKENEAYWMGPRPAEHGPDDPGGVDLYVGGAEHAVL
SYL_MYCBO       YTDPH-------------NSERFCAKENEAYWMGPRPAEHGPDDPGGVDLYVGGAEHAVL
SYL_MYCTU       YTDPH-------------NSERFCAKENEAYWMGPRPAEHGPDDPGGVDLYVGGAEHAVL
SYL_MYCBP       YTDPH-------------NSERFCAKENEAYWMGPRPAEHGPDDPGGVDLYVGGAEHAVL
SYL_MYCUA       YTDPH-------------NADRFCAKENETYWMGPRPAEHGPDDPGGVDLYVGGAEHAVL
SYL_MYCSS       YTDPL-------------NKEALCAKENEAYWMGPQPAEHGPDDPGGVDLYVGGVEHAVL
SYL_MYCSK       YTDPL-------------NKEALCAKENEAYWMGPQPAEHGPDDPGGVDLYVGGVEHAVL
SYL_MYCSJ       YTDPL-------------NKEALCAKENEAYWMGPRPAEHGPDDPGGVDLYVGGVEHAVL
SYL_MYCS2       YTDPH-------------NPDEMCAKENEAYWMGPRPDEHGPEDPGGVDLYVGGVEHAVL
SYL_MYCVP       YADPH-------------NTEALCAKENEAYWMGPRPAEHGPDDPGGVDLYVGGVEHAVL
SYL_MYCGI       YTDPY-------------NSEALCAKENEAYWMGPRPAEHGPDDPGGVDLYVGGVEHAVL
SYL_NOCFA       YADPT-------------NADAFCAKENEQYWLGPRTAEHGPDDPGGVDLYVGGVEHAVL
SYL_RHOJR       YIDPT-------------NPDVFCDKENERYWTGPRPEIHGPNDPGGVDLYVGGVEHAVL
SYL_SACEN       YIDPD-------------NDQAFVDPANERYWMGKRPELHGPDDPGGLDLYIGGVEHGVL
SYL_CORGB       YVDPS-------------NDEQFCNIENERYWTGPRPETHGPNDPGGVDLYVGGVEHAVL
SYL_CORGL       YVDPS-------------NDEQFCNIENERYWTGPRPETHGPNDPGGVDLYVGGVEHAVL
SYL_COREF       YIDPT-------------NDDQFCNLENEAYWTGPRPDVHGPNDPGGVDLYVGGVEHAVL
SYL_CORDI       YIDPT-------------NSEAFCDIENERYWTGPRS----AEDSGGVDLYVGGVEHAVL
SYL_CORJK       YIDPN-------------NDNALVDIENERYWVGPRE----GRPSGGVDLYVGGVEHAVL
SYL_STRCO       YLDPH-------------NGERLVDPEIEQYWMGPREG----LPHGGVDLYVGGAEHAVL
SYL_STRAW       YLDPH-------------NDQKLVDPAIEQYWMGPREG----QPTGGVDLYVGGAEHAVL
SYL_SALAI       YLDPT-------------NADRFVDPDTERYWMGPRGE----GDCGGTDLYVGGAEHAVL
SYL_BIFAA       YLDPT-------------DTKHMVEKDEFDYWMGPDHNKTA-GKSGGVDLYIGGVEHAVL
SYL_BIFLO       YIDPT-------------DTKHMVEKDEFDYWMGPNHNKYS-GDEGGVDLYIGGVEHAVL
SYL_FRACC       YLDPT-------------NTERFVDPTVERYWMARPGAVPG---DGGVDLYVGGVEHAVL
SYL_FRAAA       YLDPT-------------NTERFVDETVERYWLAKPGAAAG---DGGVDLYVGGVEHAVL
                .                                                 * **  *   

SYL_GEOKA       HLLYARFWHKFLYDLGIVPT--KEPFQKLFNQGMILGENN--------------------
SYL_GEOTN       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGENN--------------------
SYL_BACCZ       HLLYARFWHKVLYDIGVVPT--KEPFQQLFNQGMILGENN--------------------
SYL_BACAH       HLLYARFWHKVLYDIGVVPT--KEPFQQLFNQGMILGENN--------------------
SYL_BACAN       HLLYARFWHKVLYDIGVVPT--KEPFQQLFNQGMILGENN--------------------
SYL_BACHK       HLLYARFWHKVLYDIGVVPT--KEPFQQLFNQGMILGENN--------------------
SYL_BACC1       HLLYARFWHKVLYDIGVVPT--KEPFQQLFNQGMILGENN--------------------
SYL_BACCR       HLLYARFWHKVLYDIGVVPT--KEPFQQLFNQGMILGENN--------------------
SYL_BACCN       HLLYARFWHKVLYDIGVVPT--KEPFQQLFNQGMILGENN--------------------
SYL_BACSU       HLLYARFWHKFLYDIGVVPT--KEPFQKLYNQGMILGENN--------------------
SYL_BACVZ       HLLYARFWHKFLYDIGVVPT--KEPFQKLYNQGMILGENN--------------------
SYL_BACLD       HLLYARFWHKFLYDIGVVPT--KEPFKQLYNQGMILGENN--------------------
SYL_BACP2       HLLYARFWHKFLYDIGVVPT--KEPFMKLFNQGMILGENN--------------------
SYL_BACHD       HLLYARFWHKVLYDLGVVPT--KEPFQKLYNQGMILGENN--------------------
SYL_BACSK       HLLYARFWHKFLYDIGVVPT--KEPFQKVFNQGMILGENN--------------------
SYL_OCEIH       HLLYARFWHKFLFDIGVVST--KEPFQKLYNQGMILGEGN--------------------
SYL_STAES       HLLYARFWHKVLYDLGVVPT--KEPFQKLYNQGMILGEGN--------------------
SYL_STAEQ       HLLYARFWHKVLYDLGVVPT--KEPFQKLYNQGMILGEGN--------------------
SYL_STAAW       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAS       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAN       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAA1       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAM       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAA9       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAA2       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAA3       HLLYARFWHKVLYDLAIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAC       HLLYARFWHKVLYDLAIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAA8       HLLYARFWHKVLYDLAIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAT       HLLYARFWHKVLYDLAIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAE       HLLYARFWHKVLYDLAIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAB       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAAR       HLLYARFWHKVLYDLGIVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAHJ       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_STAS1       HLLYARFWHKVLFDLGVVPT--KEPFQKLFNQGMILGEGN--------------------
SYL_LISMF       HLLYARFWHKFLYDIGVVPT--KEPFQKLFNQGMILGENN--------------------
SYL_LISMO       HLLYARFWHKFLYDIGVVPT--KEPFQKLFNQGMILGENN--------------------
SYL_LISIN       HLLYARFWHKFLYDIGVVPT--KEPFQKLFNQGMILGENN--------------------
SYL_LISW6       HLLYARFWHKFLYDIGVVPT--KEPFQKLFNQGMILGENN--------------------
SYL_ENTFA       HLLYARFWHKFLYDIGVVPT--KEPFQKLYNQGMILGENN--------------------
SYL_STRTD       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_STRT2       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_STRT1       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_STRP2       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_STRR6       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_STRPN       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_STRSV       HLLYARFWHKFLYDIGVVPT--KEPFQKLFNQGMILGTSYRDSRCALVATDKVEKRDGSF
SYL_STRGC       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_STRS2       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRSY       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRPD       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRPG       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRP6       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRPM       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRPF       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRPB       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRPC       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRP3       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRP1       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRP8       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRA3       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRA5       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRA1       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSF
SYL_STRMU       HLLYARFWHKFLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGSF
SYL_LACLM       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGGF
SYL_LACLA       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGGF
SYL_LACLS       HLLYARFWHKVLYDLGVVPT--KEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGGF
SYL_LACSS       HLLYVRFWHKFLYDIGVVPT--KEPFQHLYNQGMILGDNH--------------------
SYL_LACDA       HLLYARFWHKVLYDLGVVPT--KEPFQKLYNQGLIL------------------------
SYL_LACDB       HLLYARFWHKVLYDLGVVPT--KEPFQKLYNQGLIL------------------------
SYL_LACP3       HLLYARFWNLFLYDIGAIPN--KEPFQRLFNQGMILG-----------------------
SYL_LACPL       HLLYARFWHKFLYDLGVVPT--KEPFQKLVNQGMILGDNH--------------------
SYL_LACBA       HLLYARFWHKFLYDLGVVPT--KEPFQKLVNQGMILGTNH--------------------
SYL_PEDPA       HLLYARFWHKVLYDLGVVPT--KEPFQKLVNQGMILGSNH--------------------
SYL_LACS1       HLLYARFWHKFLYDLGVVPT--KEPFQKLVNQGMILGSNH--------------------
SYL_LACRD       HLLYARFWHKVLYDLGLVPT--KEPFMKLVNQGMILGSNH--------------------
SYL_LEUMM       HLLYARFWHKFLYDLGVVPT--KEPFQKLVNQGMILGENH--------------------
SYL_OENOB       HLLYARFWHKFLYDLGIVPT--KEPFQKLVNQGMILGTNH--------------------
SYL_SALRD       HLLYARFWHKVLYDAGVVST--KEPFQTLVHQGMILGETEYTAYRDDAGEFVSAEQVDDD
SYL1_RHIL3      HLLYARFWHKVLYDIGVVST--EEPFQRLFNQGMILAHSYRDAAGRYYAPSSVVEEEGRW
SYL_RHOBA       HLLYSRFWHKVLFDRGHVTC--PEPFGKLVNQGMILGEVEFTSFVDPSGKHVSTKDVKKD
SYL_PELLD       HLLYARFWHKVLYDLKVVST--KEPFQKLFNQGMILGE----------------------
SYL_CHLPM       HLLYARFWHKVLFDLKVVST--KEPFQRLFNQGMILGE----------------------
SYL_CHLCH       HLLYSRFWHKVLYDLGVVST--KEPFQKLFNQGMILGE----------------------
SYL_CHLTE       HLLYSRFWHKVLYDLGVVST--KEPFQRLFNQGMILGE----------------------
SYL_CHLPD       HLLYARFWHKVLYDLGVVSS--REPFKKLFNQGMILGE----------------------
SYL_LEPBL       HLLYSRFWHKFLYDIGVVST--QEPFAKLIHQGLILGE----------------------
SYL_LEPBJ       HLLYSRFWHKFLYDIGVVST--QEPFAKLIHQGLILGE----------------------
SYL_LEPIC       HLLYSRFWHKFLFDIGAVST--KEPFDKLIHQGLILGE----------------------
SYL_LEPIN       HLLYSRFWHKFLFDIGAVST--KEPFDKLIHQGLILGE----------------------
SYL_BACTN       HLIYSRFWNKFLHDVGASVV--EEPFQKLVNQGMIQGRSNFVYRIKDTHTFVSLNLKDQY
SYL_BACV8       HLIYSRFWNKFLHDLGVSIK--EEPFQKLVNQGMIQGRSNFVYRIKDTNTFVSLNLKDQY
SYL_BACFR       HLIYSRFWNKFLHDWGISVA--EEPFQKLVNQGMIQGRSNFVYRIKDTNTFVSLNLKDQY
SYL_BACFN       HLIYSRFWNKFLHDWGISVA--EEPFQKLVNQGMIQGRSNFVYRIKDTNTFVSLNLKDQY
SYL_PARD8       HLIYSRFWNKFLFDLGIVCE--EEPFKKLINQGMIQGRSNFVYRINGTNKFVSLNLKDQY
SYL_PORGI       HLIYSRFWNKFLFDLGIVCE--AEPFRKLVNQGMIQGRSNFVYRIKNTNTFVSYGLREQY
SYL_FLAPJ       HLLYARFWNKFLKDKGYAPT--EEPFKKLINQGMILGNSAFVYRSEDSKKLYSKGLISDK
SYL_FLAJ1       HLLYSRFWNKFLKDKGFAPT--EEPFKKLINQGMILGTTAYVYRLEGTNTFVSKNKIKGQ
SYL_GRAFK       HLLYSRFWTKFLYDRGWLTV--EEPFKKLINQGMILGTSAFVYRLEGENVFVSKNQINGN
SYL_CYTH3       HLLYSRFWNKFLFDMGITPN--DEPFAKLINQGMIQGVSKFAYRINGTNKFVSAGLKKEY
SYL_BDEBA       HLLYARFWTKVLFDCGLVTH--DEPFQKLAHQGMILGP----------------------
SYL_SORC5       HLLYARFWHKVLYDLGHVKH--PEPFAKLVHQGMILGEDN--------------------
SYL_TREDE       HLLYARFWHKVLYDLGLVST--KEPFTRLINQGMITSFAYMRKNKSLVPVDKVKKISETE
SYL_TREPA       HLLYARFWHKVLYDLGLVST--KEPFARLVNQGMITSYAYRRKNGALVPHDEVHTNAQGT
SYL_BORAP       HLLYSRFWHKVLYDLGHVNT--KEPFKKLINQGIITAFSYQKENGVLIPNDQVIE-KDNK
SYL_BORBP       HLLYSRFWHKVLYDLGYVNT--KEPFKKLINQGIITAFSYQKENGILIPNDQVIE-KNSK
SYL_BORBU       HLLYSRFWHKVLYDLGYVNT--KEPFKKLINQGIITSFSYQKENGVLIPNDQVIE-KDNK
SYL_CHLTR       HLLYARFWHQVFYEAGIVST--PEPFKKLVNQGLVLATSYRIPGKGYIYPEIAKE-ENGK
SYL_CHLTA       HLLYARFWHQIFYEAGIVST--PEPFKKLVNQGLVLATSYRIPGKGYIYPEIAKE-ENGK
SYL_CHLMU       HLLYARFWHQVFYEAGIVST--PEPFKKLVNQGLVLSTSYRIPGKGYIAPEMAKE-ENGQ
SYL_CHLFF       HLLYSRFWHRVFYDAGMVST--PEPFKKLINQGLVLATSYRIPGKGYVYPEDAHE-DNGV
SYL_CHLCV       HLLYSRFWHRVFYEAGMVST--AEPFKKLINQGLVLATSYRIPGKGYVYPEDARE-DNGV
SYL_CHLAB       HLLYSRFWHRVFYEAGLVST--PEPFKKLINQGLVLATSYRIPGKGYVHPEDARE-DNGK
SYL_CHLPN       HLLYSRFWHRVFYDAGLVST--PEPFKKLINQGLVLASSYRIPGKGYVSIEDVRE-ENGT
SYL_PARUW       HLLYARFWHKVLYDCGYVHT--LEPFQTLRNQGLVVARSYQNKMRVYVEPRYVEQ-RDGK
SYL_ALKOO       HLLYSRFWHKFLYDCGVVPS--CEPYQKRTSHGMILGENN--------------------
SYL_UREP2       HLLYSRFWHRFLYDIGVVPT--KEPFYKVINQGMILGEN---------------------
SYL_UREPA       HLLYSRFWHRFLYDIGVVPT--KEPFYKVINQGMILGEN---------------------
SYL_MYCPU       HLLYSRFWHRFLYDIGVVPT--KEPFQKVVNQGMILGTD---------------------
SYL_MYCPE       HLLYARFWHKFLHQINVVPN--KEPFYKIINQGMILVN----------------------
SYL_MYCGA       HLLYARFWYKFLHHIKIVSS--TEPFSQLINQGMILGED---------------------
SYL_MYCGE       HLLYARFWHKFLFDKKLVST--KEPFQKLINQGMVLGPD---------------------
SYL_MYCPN       HLLYARFWHQFLYQKGIVTT--KEPFKKLINQGMVLGPD---------------------
SYL_MYCCT       HLLYSRFWTHFLYDLGLLPT--SEPFQRLFNQGMILGPD---------------------
SYL_MYCMS       HLLYARFWTHFLYDLGLLPT--NEPFKRLFNQGMILGPD---------------------
SYL_MESFL       HLLYARFWNYVLYDLGITSV--KEPFKQLFNQGMILGPD---------------------
SYL_ACHLI       HLLYARFWHKFFYDLGFVSS--KEPFMKLVNQGMILGAD---------------------
SYL_PSEA6       HLLYSRFFHKLLRDEGLVNS--DEPYKRLLCQGMVLADSFFRED-ESGKKEWFSPADVDT
SYL_COLP3       HLLYSRFFHKLLRDVGLVKC--DEPFKKLLCQGMVLAETYYREA-DNGAQEWIAPTDVEV
SYL_IDILO       HLLYARFFHKLLRDTGLVES--DEPFKRLLCQGMVLADSYYRED-EKGGKQWVSPLEVDI
SYL_PSEHT       HLLYSRFFHKLLRDFGLVDS--DEPFDRLLCQGMVLAETFYRKD-EKGADIWISPSDVNT
SYL_PSYIN       HLLYSRFFHKLLRDFGLVDC--DEPYKKLLTQGMVLADAYYYED-AKGGKVWIAPTDVET
SYL_SALCH       HLLYFRFFHKLMRDAGMVTS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SALTI       HLLYFRFFHKLMRDAGMVTS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SALTY       HLLYFRFFHKLMRDAGMVTS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SALPB       HLLYFRFFHKLMRDAGMVTS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SALPA       HLLYFRFFHKLMRDAGMVTS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_CITK8       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SALAR       HLLYFRFFHKLMRDAGMVTS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SHIFL       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SHIF8       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SHIBS       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECOL6       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECOL5       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECO57       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SHISS       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECOLI       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECOLC       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_SHIDS       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECOHS       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECOUT       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECOK1       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_ECO24       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_KLEP7       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ENGERNWVSPVDAIV
SYL_CROS8       HLLYFRFFHKLMRDAGMVNS--DEPAKQLLCQGMVLADAFYYVG-ANGERNWVSPKDAIV
SYL_ENT38       HLLYFRFFHKLMRDAGLVNS--DEPAKQLLCQGMVLADAFYYVG-VNGERNWVSPVDAIV
SYL_YERPA       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYTG-NNGERIWVSPVDAIV
SYL_YERP3       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYTG-NNGERIWVSPVDAIV
SYL_YERPE       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYTG-NNGERIWVSPVDAIV
SYL_YERPN       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYTG-NNGERIWVSPVDAIV
SYL_YERPS       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYTG-NNGERIWVSPVDAIV
SYL_YERPP       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYTG-NNGERIWVSPVDAIV
SYL_YERE8       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYSG-SNGERIWVSPVDAIV
SYL_SERP5       HLMYFRFFHKLLRDAGLVDS--DEPAKRLLCQGMVLADAFYYSG-NSGERVWVSPADAIV
SYL_PECAS       HLMYFRFFHKLMRDAGLVTS--DEPAKRLLCQGMVLADAFYYLG-NNGERIWVSPTDVTV
SYL_SODGM       HLMYFRFYHKLLRDAGLVTS--DEPAKRLLCQGMVLADAFYYLT-SSGERVWVSPLEVSV
SYL_PHOLL       HLMYFRFFHKLMRDASLVNS--NEPAKRLLCQGMVLADAFYYIG-KNGEKIWVSPADTIV
SYL_MANSM       HLLYFRFFHKLLRDAGLVST--DEPTKKLLCQGMVLADAFYYTS-PTNERIWVSPTKVML
SYL_ACTSZ       HLLYFRFFHKLLRDAGLVST--DEPTKKLLCQGMVLADAFYYTS-PTNERIWVSPTKVTL
SYL_HAES1       HLLYFRFFHKLLRDAGFVTS--DEPSKKLLCQGMVLADAFYYTS-PTNERIWVSPTKVTL
SYL_HISS2       HLLYFRFFHKLLRDAGFVTS--DEPSKKLLCQGMVLADAFYYTS-PTNERIWVSPTKVTL
SYL_PASMU       HLLYFRFFHKLLRDAGFVTS--DEPADKLLCQGMVLADAFYYTS-PTNERIWVSPTEVTL
SYL_HAEIG       HLLYFRFFHKLLRDAGFVTS--EEPADKLLCQGMVLADAFYYTS-PTNERIWVSPTQVTL
SYL_HAEIN       HLLYFRFFHKLLRDAGFVTS--EEPADKLLCQGMVLADAFYYTS-PTNERIWVSPTQVTL
SYL_HAEI8       HLLYFRFFHKLLRDAGFVTS--DEPADKLLCQGMVLADAFYYTS-PTNERIWVSPTLVTL
SYL_HAEIE       HLLYFRFFHKLLRDAGFVTS--DEPADKLLCQGMVLADAFYYTS-PTNERIWVSPTQVTL
SYL_ACTP2       HLLYFRFFHKLLRDAGILNS--DEPATKLLCQGMVLADAFYYTS-PTNERIWVSPTQVTL
SYL_HAEDU       HLLYFRFFHKLLRDAGILTS--DEPATKLLCQGMVLADAFYYTS-PTNERIWVSPTQVSL
SYL_SHESA       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYTN-DKGARVWVSPLDVVT
SYL_SHESM       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYNN-DKGARVWVSPLDVVT
SYL_SHESR       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYTN-DKGARVWVSPLDVVT
SYL_SHEON       HLLYFRFFHKLLRDAGLVNT--NEPAKQLLTQGMVLADAFYYTN-DKGARVWVSPLDVAT
SYL_SHEB9       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYIN-EKGARVWVSPLDVAT
SYL_SHEB5       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYIN-EKGARVWVSPLDVAT
SYL_SHEB8       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYIN-EKGARVWVSPLDVAT
SYL_SHESW       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYIN-EKGARVWVSPLDVAT
SYL_SHEPC       HLLYFRFFHKLLRDAGLVNS--NEPAKQLLTQGMVLADAFYYIN-EKGARVWVSPLDVAT
SYL_SHEAM       HLLYFRFFHKLLRDAGLVNS--NEPAKRLLTQGMVLADAFYYNN-EKGARVWVSPLDVTV
SYL_SHEHH       HLLYFRFFHKLLRDSGLVNS--DEPAKRLLTQGMVLADAYYYNN-EKGARVWVAPSDVTV
SYL_SHEPA       HLLYFRFFHKLLRDTGLVNS--NEPAKRLLTQGMVLADAYYYNN-EKGARVWVAPSDVTV
SYL_SHELP       HLLYFRFFHKLLRDIGLVNS--DEPAKRLLTQGMVLADAFYYTD-DKGARVWVSPNDAKV
SYL_SHESH       HLLYFRFFHKLLRDIGLVNS--DEPAKRLLTQGMVLADAFYYNN-EKGARVWVAPSDVTV
SYL_SHEDO       HLLYFRFFHKLLRDAGLVNS--NEPAKRLLTQGMVLADAYYYTN-DKGARVWVSPLEAEV
SYL_SHEFN       HLLYFRFFHKLLRDAGLVNS--DEPAKQLLTQGMVLADAYYYTN-EKGARVWVSPLEVTV
SYL_VIBPA       HLLYSRFFHKLLRDAGYVTS--DEPFKQLLCQGMVLADAFYFEN-EKGGKEWVAPTDVAV
SYL_VIBCB       HLLYSRFFHKLLRDAGYVTS--DEPFKQLLCQGMVLADAFYFEN-EKGGKEWVAPTDVAV
SYL_VIBVU       HLLYSRFFHKLLRDAGYVTS--DEPFKQLLCQGMVLADAFYYTN-DKGGKEWVSPTEVKV
SYL_VIBVY       HLLYSRFFHKLLRDAGYVTS--DEPFKQLLCQGMVLADAFYYTN-DKGGKEWVSPTEVKV
SYL_VIBCH       HLLYSRFFHKLLRDAGYVKS--DEPFKKLLCQGMVLADAFYYTN-DKGGKEWVSPTEVKV
SYL_VIBC3       HLLYSRFFYKLLRDAGYVKS--DEPFKKLLCQGMVLADAFYYTN-DKGGKEWVSPTEVKV
SYL_ALIF1       HLLYSRFFHKLLRDAGYVTS--DEPFKQLLCQGMVLADAFYYTN-DKGGKEWVAPTDVTI
SYL_PHOPR       HLLYSRFFHKLLRDAGYVTS--NEPFKQLLCQGMVLADAFHHTN-EKGTKEWIAPTDVTI
SYL_AERS4       HLLYARFFHKLLRDAGLVNS--DEPFKRLLCQGMVLADAFYYKD-EKGGNVWVSPTDVKV
SYL_AERHH       HLLYARFFHKLLRDAGLVNS--DEPFKRLLCQGMVLADAFYYKD-EKGGNVWVSPTDVKV
SYL_MARHV       HLLYARFFHKLLRDVGLVNS--SEPFKRLLTQGMVLAETYYRNE-ANGGKTWYNPADVTV
SYL_HAHCH       HLLYSRFFHKLLRDEGLVDS--DEPFKKLLCQGMVIAETFYRED-PSSKKTYFNPRDVRV
SYL_SACD2       HLLYARFFHKLMRDEGLVEC--DEPFERLLCQGMVL------------------------
SYL_MARMS       HLLYSRFFHKLLRDAGLVNS--DEPFKRLLTQGMVN------------------------
SYL_ALCBS       HLLYSRFFHKLLRDTGLVNC--DEPFKQLLCQGMVL------------------------
SYL_PSEAB       HLLYARFFHKLMRDEGLVGS--DEPFKNLLTQGMVVADTYYRTT-ANGGKDWFNPADVEV
SYL_PSEAE       HLLYARFFHKLMRDEGLVGS--DEPFKNLLTQGMVVADTYYRTT-ANGGKDWFNPADVEV
SYL_PSEA7       HLLYARFFHKLMRDEGLVGS--DEPFRNLLTQGMVVADTYYRTT-ANGGKDWFNPADVEV
SYL_PSEU5       HLLYARFFHKLMRDEGLVSS--NEPFKNLLTQGMVVAETYYRTL-ENGGKDWFNPADVEV
SYL_PSEMY       HLLYARFFHKLMRDEGLVSS--NEPFKNLLTQGMVVAETYYRTL-ENGGKDWFNPADVEV
SYL_PSEP1       HLLYARFFHKLMRDEGLVTS--NEPFKNLLTQGMVVAETYYRVA-SNGGKDWFNPADVEI
SYL_PSEPK       HLLYARFFHKLMRDEGLVTS--NEPFKNLLTQGMVVAETYYRVA-SNGGKDWFNPADVEI
SYL_PSEPG       HLLYARFFHKLMRDEGLVTS--NEPFKNLLTQGMVVAETYYRVA-SNGGKDWFNPADVEI
SYL_PSEE4       HLLYARFFHKLMRDEGLVTS--NEPFKNLLTQGMVVAETYYRVA-SNGGKDWFNPADVEI
SYL_PSEU2       HLLYARFFHKLMRDEGLVTS--NEPFKNLLTQGMVNAETYFRME-TSGKKTWINPADVTL
SYL_PSE14       HLLYARFFHKLMRDEGLVTS--NEPFKNLLTQGMVNAETYFRME-TSGKKTWINPADVTL
SYL_PSESM       HLLYARFFHKLMRDEGLVTS--NEPFKNLLTQGMVNAETYFRME-TSGKKTWINPADVTL
SYL_NEIMB       HLLYARFFTKLMRDEGLVNV--DEPFERLLTQGMVVCETYYREN-DKGGKDWINPADVEL
SYL_NEIMF       HLLYARFFTKLMRDEGLVNV--DEPFERLLTQGMVVCETYYREN-DKGGKDWINPADVEL
SYL_NEIG1       HLLYARFFTKLMRDEGLVNV--DEPFERLLTQGMVVCETYYREN-DKGGKDWINPADVEL
SYL_NEIM0       HLLYARFFTKLMRDEGLVNV--DEPFERLLTQGMVVCETYYREN-DKGGKDWINPADVEL
SYL_NEIMA       HLLYARFFTKLMRDEGLVNV--DEPFERLLTQGMVVCETYYREN-DKGGKDWINPADVEL
SYL_CHRVO       HLLYARFFHKLMRDEGLVSS--DEPFKSLLTQGMVVCETFYRDL-PNGTKDWIAPQDVIL
SYL_THIDA       HLLYARFFHKLMRDEGLVAS--DEPFANLLTQGMVVADTYYRED-AGGKKTWFNPADVET
SYL_DECAR       HLLYSRFFTKLMRDVGLIGDL-GEPFANLLTQGMVVAPTFYREL-DGGKKQWINPADVDV
SYL_AZOSB       HLLYSRFFTRAMRDCGLVNV--SEPFTNLLTQGMVVAETYYREL-DGGKKQWLNPADVQV
SYL_CUPMC       HLLYARFWTKVMRDMGLVKF--DEPFTNLLTQGMVLNETFYRED-ASGKKTWYNPADVDV
SYL_CUPPJ       HLLYARFWTKVMRDLGLVKF--DEPFTNLLTQGMVLNETFYRED-AAGKKTWYNPADVDV
SYL_RALSO       HLLYARFWTKVMRDLGLVKF--DEPFTKLLTQGMVLNETYYRED-AAGKKQWINPADVDV
SYL_JANMA       HLLYARFWTKVMRDFGLVKF--DEPFTNLLTQGMVLNETYFRED-ASGKKTWFNPADVQL
SYL_HERAR       HLLYARFWTKVMRDFGLVKF--DEPFTNLLTQGMVLNETYYRED-ASGKKTWFNPADVQL
SYL_BURCH       HLLYSRFWTKVMRDLGLVKF--GEPAKNLLTQGMVLNETYYRED-AAGKKTWYNPLDVTV
SYL_BURCA       HLLYSRFWTKVMRDLGLVKF--GEPAKNLLTQGMVLNETYYRED-AAGKKTWYNPLDVTV
SYL_BURL3       HLLYSRFWTKVMRDLGLVKF--GEPAKNLLTQGMVLNETFYRED-ASGKKTWYNPLDVTV
SYL_BURCM       HLLYSRFWTKVMRDLGLVKF--GEPAKNLLTQGMVLNETFYRED-ASGKKTWYNPADVTV
SYL_BURVG       HLLYSRFWTKVMRDLGLVKF--GEPAKNLLTQGMVLNETYYRED-ATGKKTWYNPADVTV
SYL_BURP0       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURPS       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURP6       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURP1       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURM7       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURM9       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURMA       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURMS       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_BURTA       HLLYSRFWAKVMRDLGLVAF--GEPAKNLLTQGMVLNETFYRED-AAGKKTWYNPADVTV
SYL_PARXL       HLLYSRFWAKVMRDLGLIRF--GEPAKNLLTQGMVLNETYYREN-EAGKKTWYNPAEVTV
SYL_POLAQ       HLLYARFWTKVMRDLDLITF--DEPFQNLLTQGMVLNETYYSEE-ASGKKTWLNPLDVEL
SYL_BORBR       HLLYARFWTKVMRDLGLLNF--DEPFTKLLCQGMVLNHIYSRKT-PQGGIEYFWPEEVDN
SYL_BORPA       HLLYARFWTKVMRDLSLLNF--DEPFTKLLCQGMVLNHIYSRKT-PQGGIEYFWPEEVDN
SYL_BORPE       HLLYARFWTKVMRDLGLLNF--DEPFTKLLCQGMVLNHIYSRKT-PQGGIEYFWPEEVDN
SYL_BORPD       HLLYARFWTRVMRDLGLLKF--DEPFTKLLCQGMVLNHIYSRKN-AQGGIEYFWPEEVEN
SYL_BORA1       HLLYARFWTKVMRDLGMLKF--DEPFTRLLCQGMVLNHIYSRRT-PQGGIEYFWPEEVEN
SYL_METPP       HLLYARFWTKAMRDCGLVKF--DEPFTKLFTQGMLLNESYYRED-ASGKKRWFYPSEVEV
SYL_ACISJ       HLLYARFWTKVMRDLGLVKV--DEPFTKLLTQGMVLNHIYSRRT-AKGAKDYFWPHDVEH
SYL_ACIAC       HLLYARFWTKVMRDLGLVKV--DEPFTKLLTQGMVLNHIYSRRT-DKGGKEYFWPHDVEH
SYL_RHOFT       HLLYARFWTKVMRDLGLVKV--DEPFTKLLTQGMVLNHIYSRKG-ENGAKDYFWPNDVEN
SYL_VEREI       HLLYARFWTKVMRDLGLVKV--DEPFNRLLTQGMVLNHIYSRRN-DNGGREYFWPQDVEQ
SYL_POLNA       HLLYARFWTKVMRDLGLVKV--DEPFTKLLTQGMVLNHIYSRRT-DKGGKEYFWPHDVEH
SYL_POLSJ       HLLYARFWTKVMRDLGLVKI--DEPFTKLLTQGMVLNHIYSRKG-DKGGIEYFWPSEVED
SYL_METCA       HLLYARFFHKLMRDAGLVHC--DEPFTNLLTQGMVVAPTFYREE--GGKKHYFGPTEVEL
SYL_DICNV       HLLYARFFTKLLRDEGLVHT--DEPFKKLLTQGMVLAGTWYREQ-EHGSKIWFNPADVQV
SYL_PSYCK       HLLYARFFHKLMRDENLVSG--DEPFANLMTQGMVLAGTFYRVN-ADGSTTYYFTKDIDI
SYL_PSYA2       HLLYARFFHKLMRDENLVSG--DEPFANLMTQGMVLAGTFYRVN-PDGSTTYYFTKDIDI
SYL_PSYWF       HLLYARFYHKLMRDEGLVSG--DEPFKNLLTQGMVLAGTLYRDN-PEGGKTYYFADDVEI
SYL_ACIAD       HLLYARFFHKLMRDEGVVQG--NEPFTNLLTQGMVLADTFYRES-ESGKKTWFNPADIIL
SYL_NITEU       HLLYSRFWSKVMRDLGLVSF--DEPFANLLTQGMVLNEIFFRKT-SSGRIQYFNPAEVDV
SYL_NITEC       HLLYSRFWSKVMRDLGLVSF--DEPFANLLTQGMVLNEIFFRKT-GNGRIQYFNPVEVDV
SYL_NITMU       HLLYSRFWSKVMRDLGLVLF--DEPFANLLTQGMVLNEIMFRKT-GSGRIVYFNPADVDI
SYL_METFK       HLLYARFFNKLMRDVGLVRH--DEPFTKLLTQGMVLKD-------GS-------------
SYL_HYDCU       HLLYARFFHKLMRDEGLVSS--DEPFKNLLTQGMVLAGSWFTQD-EKGKQTWYSPLDVDP
SYL_XYLFA       HLMYFRFYHKLMRDARLVDS--DEPAINLLTQGMVIAETFYRKN-PDGSKDWINPADVNV
SYL_XYLFT       HLMYFRFYHKLMRDARLVDS--DEPAINLLTQGMVIAETFYRKN-PDGSKDWINPADVNV
SYL_XANC8       HLMYFRFYHKLMRDARLVDS--DEPVTNLLTQGMVIAETFYRDA-DNGGKDWINPADVEI
SYL_XANCP       HLMYFRFYHKLMRDARLVDS--DEPVTNLLTQGMVIAETFYRDA-DNGGKDWINPADVEI
SYL_XANCB       HLMYFRFYHKLMRDARLVDS--DEPVTNLLTQGMVIAETFYRDA-DNGGKDWINPADVEI
SYL_XANC5       HLMYFRFYHKLMRDARLVDS--DEPVTNLLTQGMVIAETFYRDA-DNGGKDWINPADVEI
SYL_XANAC       HLMYFRFYHKLMRDARLVDS--DEPVTNLLTQGMVIADTFYRDA-DNGGKDWINPADVEI
SYL_XANOR       HLMYFRFYHKLMRDARLVDS--DEPVTNLLTQGMVIADTFYRDA-DNGGKDWINPADVEI
SYL_XANOM       HLMYFRFYHKLMRDARLVDS--DEPVTNLLTQGMVIADTFYRDA-DNGGKDWINPADVEI
SYL_NITOC       HLLYARFFHKVMRDMGLVRS--DEPFTHLLTQGMVLKDG---------------------
SYL_ALKEH       HLLYARFFHKLMRDEGLLQS--DEPFRNLLTQGMVIAETYYRER-GDGGKDWYNPAEVTV
SYL_HALHL       HLLYARFYHKVLRDEGLVSS--DEPFTRLLTQGMVLKDG---------------------
SYL_CHRSD       HLLYARFFHKLMRDFGLVAS--DEPFQRLLTQGMVIAETFYRAN-DDGSKDWFNPADVDV
SYL_BUCAI       HLMYFRFYHKLLRDFKLVDF--DEPVKNLLCQGMVLSEAFYKID-SNSQRKWFNSSSVLI
SYL_BUCAP       HLIYFRFYHKLLRDFKLVEL--NEPVKNLICQGMVLSEAFYQFD-KNNQRNWIHPSCVQV
SYL_BUCCC       HLIYFRFYHKLLYDFGYVQS--KEPVKKLICQGMVIIDSFYKYN-KDGSKKWLSISKIEI
SYL_BUCBP       HLIYFRFVHKLLRDLGLVYS--NEPVKKLLCQGMVLSDAFYYFD-HNKQKQWISAKSITI
SYL_WIGBR       HLLYLRFYHKILRDMNFVKC--DEPVNRLLCQGMVLSDTFYYFS-KSGNKIWTSPKNKNF
SYL_BLOPB       HLLYFRFYHKLMRDEGLVYS--DEPAIRLLCQGMVLADSFYYVS-PNGQHIWVDPTHVTI
SYL_BLOFL       HLMYFRFYHKLMRDIGLIQS--NEPAIRLLCQGMILADSFYYIS-NDGQKNWVSPNKVIS
SYL_BAUCH       HLMYFRFYHKLLRDAGMLTS--DEPTIRILCQGMVLADSFYYISCTTGERIWVSPINVRV
SYL_COXBU       HLLYARFMHKILRDLGLLNS--NEPFIRLLTQGMVLKDG---------------------
SYL_COXBR       HLLYARFMHKILRDLGLLNS--NEPFIRLLTQGMVLKDG---------------------
SYL_COXBN       HLLYARFMHKILRDLGLLNS--NEPFIRLLTQGMVLKDG---------------------
SYL_LEGPH       HLLYARFFHKLMRDEGLVNS--DEPFKALLTQGMVLKDG---------------------
SYL_LEGPC       HLLYARFFHKLMRDEGLVNS--DEPFKALLTQGMVLKDG---------------------
SYL_LEGPA       HLLYARFFHKLMRDEGLVNS--DEPFKALLTQGMVLKDG---------------------
SYL_LEGPL       HLLYARFFHKLMRDEGLVNS--DEPFKALLTQGMVLKDG---------------------
SYL_FRATT       HLLYARFFHKLMRDQGLVKS--DEPFKNLLTQGMVLKDG---------------------
SYL_FRAT1       HLLYARFFHKLMRDQGLVKS--DEPFKNLLTQGMVLKDG---------------------
SYL_FRATW       HLLYARFFHKLMRDQGLVKS--DEPFKNLLTQGMVLKDG---------------------
SYL_FRATF       HLLYARFFHKLMRDQGLVKS--DEPFKNLLTQGMVLKDG---------------------
SYL_FRATH       HLLYARFFHKLMRDQGLVKS--DEPFKNLLTQGMVLKDG---------------------
SYL_FRATO       HLLYARFFHKLMRDQGLVKS--DEPFKNLLTQGMVLKDG---------------------
SYL_FRATN       HLLYARFFHKLMRDQGLVKS--DEPFKNLLTQGMVLKDG---------------------
SYL_FRAP2       HLLYARFFHKLMRDQGLVTS--DEPFKNLLTQGMVLKDG---------------------
SYL_RUTMC       HLLYARFFNKLLRDEGFIKN--DEPFKNLLTQGMVLKDG---------------------
SYL_VESOH       HLLYARFFNKLLRDEGLIKY--DEPFKNLLTQGMVLKNG---------------------
SYL_RICRS       HLLYARFFTKVMNEQNYVSV--QEPFKGLFTQGMVLHATYKD-----EHNNWLYPE----
SYL_RICRO       HLLYARFFTKVMNEQNYVSV--QEPFKGLFTQGMVLHATYKD-----EHNNWLYPE----
SYL_RICCN       HLLYARFFTKVMNEQNYVSV--REPFKGLFTQGMVLHATYKD-----EHNNWLYPE----
SYL_RICM5       HLLYARFFTKVMNEQKYVSV--REPFKGLFTQGMVLHATYKD-----EHNNWLYPE----
SYL_RICFE       HLLYARFFTKVMNEQNYVSV--REPFKGLFTQGMVLHATYKD-----EHNNWLYPE----
SYL_RICAH       HLLYARFFTKVMNEQHYVSV--REPFKGLFTQGMVLHATYKD-----EHNNWLYPE----
SYL_RICCK       HLLYARFFTKVMNEQNYVSV--REPFKGLFTQGMVLHATYKD-----EHNNWLYPD----
SYL_RICBR       HLLYARFFTKVMNEQDYVSV--REPFKGLFTQGMVLHATYKD-----EHNNWLYPE----
SYL_RICPR       HLLYARFFTKLMNEHNYVSI--REPFKGLFTQGMVLHATYKD-----ENNNWLYPA----
SYL_RICTY       HLLYARFFTKLMNEHHYVSI--REPFKGLFTQGMVLHATYKD-----ENNNWLYPA----
SYL_ORITB       HLLYARFITRVMYDLKYIDI--QEPFTSLITQGMVLHRTYQD-----KSNNWLYPN----
SYL_WOLPM       HLLYSRFFCRALTKCGYFDI--KEPFSTLITQGMVCHATYKD-----ENGKWLFPA----
SYL_WOLTR       HLLYSRFFCRALTKCGYFNV--KEPFSTLITQGMVCHVTYKD-----KNGKWLFPE----
SYL_EHRRW       HLLYSRFFCRALTRCGYFDV--KEPFSSLITQGMVCHSTYLD-----KYGNYLFPE----
SYL_EHRRG       HLLYSRFFCRALTRCGYFDV--KEPFSSLITQGMVCHSTYLD-----KYGNYLFPE----
SYL_EHRCJ       HLLYSRFFCRALTKCGYFNV--KEPFSSLITQGMVCHATYSD-----AQGNYLFPE----
SYL_EHRCR       HLLYSRFFCRALTKCGYFNI--KEPFSNLITQGMVCHSTYSD-----EQGNYLFPE----
SYL_ANAMM       HLLYARFFCRALKKCGHLAV--EEPFRNLITQGMVCHSVYRD-----AAGNYLFPE----
SYL_NEOSM       HLLYARFFTRALNKCGYIDI--VEPFRNLLTQGMVCHETYQN-----SSGEYLYPE----
SYL2_RHIL3      HLLYSRFFTRAMRETGHVAA--TEPFKGLFTQGMVVHETYSRG--AGASREWVAPA----
SYL_RHIEC       HLLYSRFFTRAMRETGHVAA--TEPFKGLFTQGMVVHETYSRG--AGASREWVAPA----
SYL_RHIME       HLLYSRFFTRAMKATGHVAL--DEPFKGLFTQGMVVHETYSRG--EGAQREWITPA----
SYL_SINMW       HLLYSRFFTRAMKATGHVAL--DEPFKGLFTQGMVVHETYSRG--EGAQREWITPA----
SYL_AGRFC       HLLYSRFFTRAMRETGHVGV--KEPFKGLFTQGMVVHETYSRG--EGLTREWVPPA----
SYL_BRUAB       HLLYSRFFTRAMKVAGHVGV--DEPFKGLFTQGMVVHETYK------ANGQWVSPA----
SYL_BRUA2       HLLYSRFFTRAMKVAGHVGV--DEPFKGLFTQGMVVHETYK------ANGQWVSPA----
SYL_BRUSI       HLLYSRFFTRAMKVAGHVGV--DEPFKGLFTQGMVVHETYK------ANGQWVSPA----
SYL_BRUO2       HLLYSRFFTRAMKVAGHVGV--DEPFKGLFTQGMVVHETYK------ANGQWVSPA----
SYL_BRUME       HLLYSRFFTRAMKVAGHVGV--DEPFKGLFTQGMVVHETYK------ANGQWVSPA----
SYL_BRUSU       HLLYSRFFTRAMKVAGHVGV--DEPFKGLFTQGMVVHETYK------ANGQWVSPA----
SYL_BRUC2       HLLYSRFFTRAMKVAGHVGV--DEPFKGLFTQGMVVHETYK------ANGQWVSPA----
SYL_OCHA4       HLLYSRFFTRAMKVAGHVGI--DEPFKGLFTQGMVVHETYK------ANGQWVAPA----
SYL_CHESB       HLLYSRFFTRAMRDTGHLDL--AEPFKGLFTQGMVVHETYRAE-----DGRWLTPA----
SYL_RHILO       HLLYSRFFTRAMRATGHVDL--AEPFKGLFTQGMVVHETYRVGG-ASNNGRWLSPA----
SYL_BART1       HLLYARFFMRAMKLVGHVSV--DEPFKGLFTQGMVVHETYR------DDQGWVSPA----
SYL_BARHE       HLLYARFFTRAMKSMGYVTV--DEPFKGLFTQGMVVHETYR------DEKDWVSPE----
SYL_BARQU       HLLYARFFMRAMKLIGYVTV--DEPFKGLFTQGMVVHETYR------DDQGWVSPA----
SYL_BARBK       HLLYARFFMRAMKLAGHVNA--DEPFTGLFTQGMVVHETYR------DAQGWVAPD----
SYL_RHOP2       HLLYSRFFTRAMKATGHLGL--DEPFRGMFTQGMVVHETYRT-----ADGHFASPA----
SYL_RHOPS       HLLYSRFFTRAMKATGHVGL--DEPFRGMFTQGMVVHETYRK-----ADGMFASPA----
SYL_RHOPA       HLLYSRFFTRAMKAAGHIDIQHDEPFAGLFTQGMVVHETYRK-----ADGHFASPA----
SYL_RHOP5       HLLYSRFFTRAMKATGHVGL--DEPFAGMFTQGMVVHETYRR-----KSGEWVSPA----
SYL_NITHX       HLLYSRFFTRAMKATGHLSM--DEPFKGMFTQGMVVHETYRK-----ADGGWASPD----
SYL_NITWN       HLLYSRFFTRAMKATGHLGM--DEPFKGMFTQGMVVHETYRK-----PDGGWASPE----
SYL_BRASB       HLLYSRFFTRAMKATGHVAM--DEPFAGMFTQGMVVHETYQK-----ADGTYVNPA----
SYL_BRASO       HLLYSRFFTRAMKATGHVAM--DEPFAGMFTQGMVVHETYQK-----ADGTYVNPA----
SYL_BRADU       HLLYSRFFTRAMKATGHVAL--DEPFAGMFTQGMVVHETYQK-----ADGSYVQPA----
SYL_RHOPB       HLLYSRFFTRAMQATGHVGF--DEPFRGMFTQGMVVHETYRK-----LDGTFASPA----
SYL_AZOC5       HLLYSRFFTRALKACGRVDV--AEPFAGLFTQGMIVHETYKD-----KDGRWLFPE----
SYL_PARL1       HLLYSRFFTRAMKATGHVSL--DEPFAGLFTQGMVNHETYRD-----AEGRWVPPA----
SYL_CAUVC       HLLYARFITRALKDEGLLSVE--EPFAGLFTQGMVTHEAYKN-----EAGEWVEPSD---
SYL_CAUSK       HLLYARFITRALKDEGLVSVE--EPFAGLFTQGMVTHEAYKN-----AAGEWVEPSD---
SYL_MARMM       HLLYARFFTRALNDAGLMNMKSGEPFAGLFTQGMVTHETYKS-----ADGKWLSPE----
SYL_HYPNA       HLLYSRFFSRAMRDVGELDLPSGEPFAGLFTQGMVTHETYRS-----EGGTWLEPS----
SYL_RUEST       HLLYSRFFARAMQICGHLPESAKEPFDALFTQGMVTHAIYEN-----AERKDDNG-----
SYL_RUEPO       HLLYSRFFARAMHICGHLPEKSKEPFNALFTQGMVTHAIYKT-----TGADD--------
SYL_ROSDO       HLLYSRFFARAMQMTGHLPQSAIEPFDALFTQGMVTHEIYQT-----RDANG--------
SYL_JANSC       HLLYSRFFARAMHITGHLPRKAIEPFDALFTQGMVTHAIYKT-----TDAKN--------
SYL_DINSH       HLLYSRFFARAMHLCGHLPESAREPFDALFTQGMVTHAIYKT-----TGTDG--------
SYL_RHOS1       HLLYSRFFARAMQKTGHLPAKAIEPFNALFTQGMVTHEIYLT-----RDAAGRPV-----
SYL_RHOS4       HLLYSRFFARAMQKTGHLPAKAIEPFNALFTQGMVTHEIYLT-----RDAAGRPV-----
SYL_RHOS5       HLLYSRFFARAMQKTGHLPAKAIEPFNALFTQGMVTHEAYYS-----EEAKQEPVWQGML
SYL_PARDP       HLLYSRFFARAMVKTGHLPESAKEPFDALFTQGMVTHEIYMT-----RDERGRPV-----
SYL_ZYMMO       HLLYARFWTRALQSIGRLDI--KEPFTGLFTQGMVTHETYKD-----PEG-----H----
SYL_SPHWW       HLLYARFWTRALERIGRIGV--KEPFTGLFTQGMVTHETYKD-----PAG-----Q----
SYL_NOVAD       HLLYARFWTRALARIGKVEV--TEPFGSLFTQGMVTHETYER-----RNPENGQPI----
SYL_SPHAL       HLLYARFWTRALNKLGMIDI--EEPFASLFTQGMVTHETYSR-----PQGEGLPPL----
SYL_GRABC       HLLYARFFTRAMADTGHVPV--REPFAGLFTQGMVTHESYRA-----ADGR---------
SYL_GLUOX       HLLYARFFTRAMHETGHLDV--DEPFAGLFTQGMVTHESYRD-----DSG----------
SYL_ACICJ       HLLYARFFTRAMHRLGQVGV--AEPFAGLFTQGMLTHESYRT-----EDGK---------
SYL_MAGSA       HLLYSRFFTRALKDCGYLNV--KEPFAGLLTQGMICHETYKS-----EDGAWLFPT----
SYL_RHORT       HLLYSRFFTRALRDCGYLGV--SEPFTGLFTQGMICHETYRD-----TDGAWLSPD----
SYL_MAGMM       HLLYARFFHKALRDIGEVSC--DEPFARLLTQGMVRKDTHRC-----AQHGWRYPK----
SYL_CAMJ8       HLLYARFFQKALRDLGYLTQ--NEPFDRLLTQGMVLKDG---------------------
SYL_CAMJJ       HLLYARFFQKALRDLGYLTQ--NEPFDRLLTQGMVLKDG---------------------
SYL_CAMJR       HLLYARFFQKALRDLGYLTQ--NEPFDRLLTQGMVLKDG---------------------
SYL_CAMJE       HLLYARFFQKALRDLGYLTQ--NEPFDRLLTQGMVLKDG---------------------
SYL_CAMJD       HLLYARFFQKALRDLGYLTQ--NEPFDRLLTQGMVLKDG---------------------
SYL_CAMC1       HLLYARFFQKVLRDLGYLRD--DEPFENLLTQGMVLKDG---------------------
SYL_CAMC5       HLLYARFFQKVLRDLGYLRD--DEPFSNLLTQGMVLKDG---------------------
SYL_CAMFF       HLLYARFFQKALRDLGYLRD--CEPFDSLLTQGMVLKDG---------------------
SYL_CAMHC       HLLYARFFQKVLRDLGYLRD--SEPFANLLTQGMVLKDG---------------------
SYL_ARCB4       HLLYARFFTKVLRDLGYTNS--SEPFKKLLTQGMVLKDG---------------------
SYL_NITSB       HLLYARFFTKVLRDLGYVNL--DEPFKRLLTQGMVLKDG---------------------
SYL_WOLSU       HLLYARFFTKVLRDLGYTET--NEPFTHLLTQGMVLKDG---------------------
SYL_HELHP       HLLYARFWTKVLRDLGYIEI--DEPFANLLTQGMVLKDG---------------------
SYL_HELPY       HLLYARFFTKALRDLGYLHL--DEPFKQLITQGMVLKNG---------------------
SYL_HELPH       HLLYARFFTKALRDLGYLHL--DEPFKQLITQGMVLKDG---------------------
SYL_HELPJ       HLLYARFFTKALRDLGYLHL--DEPFKQLITQGMVLKDG---------------------
SYL_HELAH       HLLYARFFTKALRDLGYIDL--DEPFKQLITQGMVLKDG---------------------
SYL_THEMA       HLLYSRFVTKVLHDLGYL--NFDEPFTNLFTQGMIYKDGA--------------------
SYL_THEP1       HLLYSRFVTKVLHDLGYL--NFDEPFTNLFTQGMIYKDGA--------------------
SYL_THEM4       HLLYSRFITKVLYDLGYL--KFEEPFENLFTQGMIYKDGW--------------------
SYL_FERNB       HLLYSRFITKVLHDLGYL--KFDEPFENLFTQGMIYKDGW--------------------
SYL_PSELT       HLLYSRFITKVLYDLGYL--SFDEPFENLFTQGMIYKDGA--------------------
SYL_CALS8       HLLYSRFFTKVLYDLGYI--SFEEPFKNLLTQGMVLKDGA--------------------
SYL_HUNT2       HLLYSRFLMKVLYDLGYV--DYDEPFTNLLTQGMVLKDGA--------------------
SYL_DESHY       HLLYSRFFTKALRDFGYL--KVDEPFANLLTQGMVCLGGA--------------------
SYL_SYNWW       HLMYARFFTKFLFDINVL--SCQEPFTRLLTQGMVLKDNA--------------------
SYL_CARHZ       HLLYSRFFTKVLYDLGLV--HVDEPFTNLLTQGMVLKDGA--------------------
SYL_PELTS       HLLYSRFFTKVLYDLKLV--SNLEPFSNLLTQGMVLKDGA--------------------
SYL_MOOTA       HLMYARFFTKALHDFGLV--GVEEPFQNLLTQGMVLKDGS--------------------
SYL_DESRM       HLLYSRFFTKVFYDLGLV--NVQEPFENLLTQGMVLKDGS--------------------
SYL_SYMTH       HLLYARFFTKVLRDMGLV--KVDEPFARLLTQGMVLKDGS--------------------
SYL_DESVH       HLLYSRFFTKALRDCGFI--ELDEPFANLLTQGMVLMDGS--------------------
SYL_DESVV       HLLYSRFFTKALRDCGFI--ELDEPFANLLTQGMVLMDGS--------------------
SYL_DESAG       HLLYARFFIKALRDCGYM--DLDEPFANLLTQGMVLMDGA--------------------
SYL_LAWIP       HLLYSRFFTKLLRDLGYLPSNINEPFAKLLTQGMVIKDGS--------------------
SYL_GEOMG       HLLYARFFTKALRDLGYV--TVDEPFTNLLTQGMVIKDGA--------------------
SYL_GEOSL       HLLYSRFFTKALRDLGYV--TVAEPFKNLLTQGMVIKDGA--------------------
SYL_GEOUR       HLLYARFFTKVLRDLGYC--DIDEPFTNLLTQGMVIKDGA--------------------
SYL_PELPD       HLLYARFFTKVLRDLGYV--ECSEPFTNLLTQGMVIKDGA--------------------
SYL_PELCD       HLLYARFFTKVMRDLGMM--AHDEPFKNLLTQGMVCMETASCPEHGWLFPEQVVEGKCVL
SYL_SYNAS       HLLYARFYTRMLRDFGLV--GVDEPFTNLLTQGMVCKETTRCPDHGYLYPEEVREGRCIH
SYL_SYNFM       HLLYSRFFVKVLRDMGAL--EVDEPFRNLLTQGMVIKDGA--------------------
SYL_DESPS       HLLYSRFFTKVLRDLGYL--EIDEPFIKLLTQGMVIKDGT--------------------
SYL_FUSNN       HLLYARFFHKVLRDLGLLSS--NEPFKRLLTQGMVLGPSYYSEK----ENKYLLQKAAII
SYL_TRIV2       HLLYSRFFTKVLRDRGLLNF--DEPFERLLTQGMVQGLTYFNPNKGGKDKWVPSHLVN--
SYL_NOSS1       HLLYSRFFTKVLRDRGLLNF--DEPFERLLTQGMVQGLTYFNPNKGGKDKWVPSHLVN--
SYL_ACAM1       HLLYSRFFTKVMRDRKLLNF--DEPFKKLLTQGMVQALTYKNPETG---QYIAPINVD--
SYL_TRIEI       HLLYSRFFTKVLRDRGLCDF--DEPFQNLLTQGMVQGVTYKNPVTG---KYIPFADVN--
SYL_SYNY3       HLLYSRFFTKVLADRQLIPV--KEPFQKLLTQGMVQGITYKNPTTG---KYVPAKDLQTG
SYL_SYNE7       HLLYSRFFTKVLRDRGLLSF--DEPFKRLLTQGMVQGLTYKNPKTG---KYVPSDRIS--
SYL_SYNP6       HLLYSRFFTKVLRDRGLLSF--DEPFKRLLTQGMVQGLTYKNPKTG---KYVPSDRIS--
SYL_THEEB       HLLYSRFFTKVLRDRQLVHV--SEPFQRLLTQGMVQGRTYKNPRTG---KYVIPSRIA--
SYL_SYNJB       HLLYSRFFTKVLRDRGLLDF--DEPFLRLLTQGMVQGRTYYNPNKSGKDRWIPAALVK--
SYL_SYNJA       HLLYSRFFTKVLRDLGLLNF--DEPFSRLLTQGMVQARTYYNPNKSGKDRWIPTALVK--
SYL_GLOVI       HLLYSRFFTKVLRDRGLLSF--DEPFKRLLTQGMVLSNAFVDPATK---KYYPPDQVEE-
SYL_SYNS3       HLLYARFFTKALNDRDLLQT--KEPFERLLTQGMVQGTTYRNPRTG---RYISPAAVK--
SYL_SYNPW       HLLYSRFFTKALRDRGLLNI--REPFERLLTQGMVQGVTYRNPRTG---RYVAPSEVS--
SYL_PROMM       HLLYARFFTKALHDRNLIGF--KEPFNRLLTQGMVQGLTYRNAKNG---SYISPELVS--
SYL_PROM3       HLLYARFFTKALHDRNLIGF--KEPFNTLLTQGMVQGLTYRNTKNG---SYISPELVS--
SYL_SYNSC       HLLYARFFTKALKDRGLIDI--NEPFERLLTQGMVQGVTYRNATTG---KYIAPADVA--
SYL_SYNS9       HLLYSRFFTKALRDRGLIDI--DEPFERLLTQGMVQAITYRNPITG---KYIATADVS--
SYL_SYNPX       HLLYSRFFTKALKDRGLIDV--AEPFDRLLTQGMVQGTTYRNPSTG---KYVASADVS--
SYL_SYNR3       HLLYSRFFTKVLQQRNLVSC--SEPFQKLLTQGMVQGVTYRNPKTR---KYIAPSAVS--
SYL_PROMT       HLLYSRFLTKALKKCGLINI--DEPFKKLLTQGMVQAVTFKNPNTN---KYFSKDQIK--
SYL_PROM1       HLLYSRFLTKALKRCGLINI--DEPFKKLLTQGMVQAVTFKNPNTN---KYFSKDQIK--
SYL_PROMA       HLLYSRFLIKALRNRGLLNI--KEPFSNLLTQGMVQGVTFKNPKTS---KYISPDHIN--
SYL_PROM0       HLLYARFFTKALRDNQLFEI--DEPFKKLLTQGMVQAAAYKNNKTG---KYVSPSDIN--
SYL_PROM9       HLLYARFFTKALRDNELFEI--DEPFKKLLTQGMVQSAAYKNNKTG---KYISPSDIN--
SYL_PROMS       HLLYARFFTKALRDNELFDI--DEPFKKLLTQGMVQSAAYKNNKTG---KYVSPSDIT--
SYL_PROM2       HLLYARFFTKALRDNELFEI--DEPFKKLLTQGMVQAAAYKNNKTG---KYVSPSDIN--
SYL_PROMP       HLLYARFLTKALRDNNLFDI--DEPFKRLLTQGMVQSAAYKNSITG---KYISPTDIK--
SYL_PROM5       HLLYARFLTKALRDNNLFDI--DEPFKKLLTQGMVQAAAYKNTKTG---KYISPKDIK--
SYL_SOLUE       HLIYSRFFTKVMRDIGLISN--NEPARRLFTQGMVIAEG---------------------
SYL_DEIRA       HLLYSRFWTKVMRDMGLTTQ--SEPFARLRNQGMVLG-----------------------
SYL_DEIGD       HLLYSRFWTKVMRDMGLTVQ--NEPFARLRNQGIILG-----------------------
SYL_RUBXD       HLLYTRFFTKVMRDLGLVDF--DEPMLRLFNQGVILG-----------------------
SYL_CLOPE       HLLYARFITKALRDMGYLNF--DEPFTSLTHQGLILG-----------------------
SYL_CLOPS       HLLYARFITKALRDMGYLNF--DEPFTSLTHQGLILG-----------------------
SYL_CLOP1       HLLYARFITKALRDMGYLNF--DEPFTSLTHQGLILG-----------------------
SYL_CLOB8       HLLYARFITKALRDMGYLNF--DEPFLSLTHQGLILG-----------------------
SYL_CLOB1       HLLYARFITKALRDMGYLNF--DEPFLSLTHQGLILG-----------------------
SYL_CLOBH       HLLYARFITKALRDMGYLNF--DEPFLSLTHQGLILG-----------------------
SYL_CLOBL       HLLYARFITKALRDMGYLNF--DEPFLSLTHQGLILG-----------------------
SYL_CLONN       HLLYARFITKALRDMGYLNF--DEPFTSLTHQGLILG-----------------------
SYL_CLOAB       HLLYARFITKALRDIGYLNF--DEPFLSLRHQGLILG-----------------------
SYL_CLOK5       HLLYARFITKALRDMGFLNF--DEPFLSLRHQGLILG-----------------------
SYL_CLOTE       HLLYARFFTKALRDMGYLNF--DEPFSSLTHQGLILG-----------------------
SYL_CALS4       HLLYSRFITKVLRDLGYLNF--DEPFLSLVHQGTILG-----------------------
SYL_ROSCS       HLLYARFITKVLYDEGLVPD--DEPFRALFTQGMVQRRVRTPLEVVAPGMVRFPEELRRK
SYL_ROSS1       HLLYARFITKVLYDEGLVPE--DEPFKALFTQGMVQRRVRTPLDIVAPGMVRFPEELRRK
SYL_THEFY       HLLYSRFFTKVLYDMGMVPF--TEPFVRLLNQGQVINQG---------------------
SYL_ACIC1       HLLYSRFITKVLHDMGLVDF--VEPFSALLNQGQVINQG---------------------
SYL_ARTS2       HLLYARFFTKVIHDLGMIDA--DEPFSALLNQGQVLNGG---------------------
SYL_PAEAT       HLLYARFFTKVIKDIGLIEA--NEPFSALLNQGQVLNGG---------------------
SYL_RENSM       HLLYSRFFVKVLNDLGLLEA--KEPFKALLNQGQVLNGG---------------------
SYL_CLAMS       HLLYSRFITKVLFDLGYVTF--TEPFSALLNQGMVLSGG---------------------
SYL_CLAM3       HLLYSRFITKVLFDLGYVTF--TEPFSALLNQGMVLSGG---------------------
SYL_LEIXX       HLLYSRFITKVLFDQGFVSF--TEPFTVLLNQGMVLMDG---------------------
SYL_KINRD       HLLYARFITKVLHDLGYLPF--DEPFTRLLNQGMVQMDG---------------------
SYL_NOCSJ       HLLYARFFTKVLRDMGMLEV--DEPFAAQLNQGIVINQG---------------------
SYL_TROW8       HLLYARFITKFLYDIGFVDF--KEPFLRLINQGMVVLNG---------------------
SYL_TROWT       HLLYARFITKFLYDIGFVDF--KEPFLRLINQGMVVLNG---------------------
SYL_MYCPA       HLLYARFWHKVLYDLGHVSS--REPYRRLVNQGYIQAFAYTDSRGSYVPAEEVVER-DGR
SYL_MYCA1       HLLYARFWHKVLYDLGHVSS--REPYRRLVNQGYIQAFAYTDSRGSYVPAEEVVER-DGR
SYL_MYCLE       HLLYARFWHKVLYDLGHVSS--REPYRRLINQGYIQAFAYTDAHGSYVPANQVFQR-GDG
SYL_MYCTA       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAYAYTDARGSYVPAEQVIER-GDR
SYL_MYCBO       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAYAYTDARGSYVPAEQVIER-GDR
SYL_MYCTU       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAYAYTDARGSYVPAEQVIER-GDR
SYL_MYCBP       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAYAYTDARGSYVPAEQVIER-GDR
SYL_MYCUA       HLLYARFWHKVLYDLGHVSS--REPYRKLINQGYIQAFAYTDARGSYVPAEEVIER-DGG
SYL_MYCSS       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAFAYTDSRGSYVPAAEVVER-DGK
SYL_MYCSK       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAFAYTDSRGSYVPAAEVVER-DGK
SYL_MYCSJ       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAFAYTDSRGSYVPAAEVVER-DGK
SYL_MYCS2       HLLYSRFWHKVLYDLGYVSS--REPYRRLVNQGYIQAFAYTDSRGTYVPAAEVIER-DGK
SYL_MYCVP       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAFAYTDARGSYVPAAEVVER-DGK
SYL_MYCGI       HLLYSRFWHKVLYDLGHVSS--REPYRRLVNQGYIQAFAYTDSRGSYVPAAEVIER-DGK
SYL_NOCFA       HLLYARFWQKVLFDLGYVSS--SEPYRRLFNQGYIQAFAYTDPRGAYVPAAEVVER-DGA
SYL_RHOJR       HLLYSRFWHKVLFDLGYVSS--SEPYRRLYNQGYIQAYAYTDARGVYVPADEVEEK-DGK
SYL_SACEN       HLLYSRFWHKVLYDLGHVSS--EEPYRRLYNQGYIQAYAYTDSRGVYVPAEEVEER-DGK
SYL_CORGB       HLLYARFWHKVLFDLGHVSS--KEPYRRLYNQGYIQAFAYTDSRGVYVPADDVEEK-DGK
SYL_CORGL       HLLYARFWHKVLFDLGHVSS--KEPYRRLYNQGYIQAFAYTDSRGVYVPADDVEEK-DGK
SYL_COREF       HLLYSRFWHKVLYDLGYVTS--KEPYRRLYNQGYIQAFAYTDSRGVYVPAEEVEEK-DGK
SYL_CORDI       HLLYSRFWHKVLFDLGFVTS--REPYRRLFNQGYIQAFAYTDSRGVYVPAEEVEEK-DGK
SYL_CORJK       HLLYARFWHKVLFDLGVVSS--FEPYYRLYNQGYIQAYAYTDSRGVYVPAEEVTER-DGK
SYL_STRCO       HLLYARFWSKVLFDLGHVSS--AEPFHKLFNQGMIQAYVYRDSRGIAVPAAEVEER-DGA
SYL_STRAW       HLLYARFWSKVLFDLGHISS--AEPFHKLFNQGMIQAYVYRDSRGIAVPAAEVEER-DGA
SYL_SALAI       HLLYARFWHKVLYDLGHVSS--FEPFRKLFNQGYIQAYAYTDARGAYVPAEEVVER-SGA
SYL_BIFAA       HLLYSRFWHKVLFDLGYVDS--MEPFHKLFNQGMIQAYAYTDDRGQYVPAAEVVEG-PAD
SYL_BIFLO       HLLYSRFWHKVLFDLGYVDS--AEPFHKLFNQGMIQAYAYTDDRGQYVPADEVVEG-PAD
SYL_FRACC       HLLYARFWHKVLYDLGHVST--KEPFKRLFNQGYIQADAFTDARGMYVPAAEVTATPDGR
SYL_FRAAA       HLLYARFWQKVLYDLGHVSS--KEPFKRLFNQGYIQADAFTDARGMYVPAAEVKQTDDGR
                **:* **    :           **      :* :                         

SYL_GEOKA       ------------------------------------------------------------
SYL_GEOTN       ------------------------------------------------------------
SYL_BACCZ       ------------------------------------------------------------
SYL_BACAH       ------------------------------------------------------------
SYL_BACAN       ------------------------------------------------------------
SYL_BACHK       ------------------------------------------------------------
SYL_BACC1       ------------------------------------------------------------
SYL_BACCR       ------------------------------------------------------------
SYL_BACCN       ------------------------------------------------------------
SYL_BACSU       ------------------------------------------------------------
SYL_BACVZ       ------------------------------------------------------------
SYL_BACLD       ------------------------------------------------------------
SYL_BACP2       ------------------------------------------------------------
SYL_BACHD       ------------------------------------------------------------
SYL_BACSK       ------------------------------------------------------------
SYL_OCEIH       ------------------------------------------------------------
SYL_STAES       ------------------------------------------------------------
SYL_STAEQ       ------------------------------------------------------------
SYL_STAAW       ------------------------------------------------------------
SYL_STAAS       ------------------------------------------------------------
SYL_STAAN       ------------------------------------------------------------
SYL_STAA1       ------------------------------------------------------------
SYL_STAAM       ------------------------------------------------------------
SYL_STAA9       ------------------------------------------------------------
SYL_STAA2       ------------------------------------------------------------
SYL_STAA3       ------------------------------------------------------------
SYL_STAAC       ------------------------------------------------------------
SYL_STAA8       ------------------------------------------------------------
SYL_STAAT       ------------------------------------------------------------
SYL_STAAE       ------------------------------------------------------------
SYL_STAAB       ------------------------------------------------------------
SYL_STAAR       ------------------------------------------------------------
SYL_STAHJ       ------------------------------------------------------------
SYL_STAS1       ------------------------------------------------------------
SYL_LISMF       ------------------------------------------------------------
SYL_LISMO       ------------------------------------------------------------
SYL_LISIN       ------------------------------------------------------------
SYL_LISW6       ------------------------------------------------------------
SYL_ENTFA       ------------------------------------------------------------
SYL_STRTD       FHVETGEE----------------------------------------------------
SYL_STRT2       FHVETGEE----------------------------------------------------
SYL_STRT1       FHVETGEE----------------------------------------------------
SYL_STRP2       FHIETGEE----------------------------------------------------
SYL_STRR6       FHIETGEE----------------------------------------------------
SYL_STRPN       FHVETGEE----------------------------------------------------
SYL_STRSV       FNIETGEE----------------------------------------------------
SYL_STRGC       FNIETGEE----------------------------------------------------
SYL_STRS2       FHMETGEE----------------------------------------------------
SYL_STRSY       FHMETGEE----------------------------------------------------
SYL_STRPD       FHVETGEE----------------------------------------------------
SYL_STRPG       FHLETGEE----------------------------------------------------
SYL_STRP6       FHVETGEE----------------------------------------------------
SYL_STRPM       FHVETGEE----------------------------------------------------
SYL_STRPF       FHVETGEE----------------------------------------------------
SYL_STRPB       FHVETGEE----------------------------------------------------
SYL_STRPC       FHVETGEE----------------------------------------------------
SYL_STRP3       FHVETGEE----------------------------------------------------
SYL_STRP1       FHVETGEE----------------------------------------------------
SYL_STRP8       FHLETGEE----------------------------------------------------
SYL_STRA3       FHVETGEE----------------------------------------------------
SYL_STRA5       FHVETGEE----------------------------------------------------
SYL_STRA1       FHVETGEE----------------------------------------------------
SYL_STRMU       FNIETDEE----------------------------------------------------
SYL_LACLM       YHMETGEA----------------------------------------------------
SYL_LACLA       YHMETGEA----------------------------------------------------
SYL_LACLS       YHMETGEE----------------------------------------------------
SYL_LACSS       ------------------------------------------------------------
SYL_LACDA       ------------------------------------------------------------
SYL_LACDB       ------------------------------------------------------------
SYL_LACP3       ------------------------------------------------------------
SYL_LACPL       ------------------------------------------------------------
SYL_LACBA       ------------------------------------------------------------
SYL_PEDPA       ------------------------------------------------------------
SYL_LACS1       ------------------------------------------------------------
SYL_LACRD       ------------------------------------------------------------
SYL_LEUMM       ------------------------------------------------------------
SYL_OENOB       ------------------------------------------------------------
SYL_SALRD       ADLTPVPVDDGDVKKDGDVFVLADRP-------AVR------------------------
SYL1_RHIL3      FAGSVEVQ----------------------------------------------------
SYL_RHOBA       AEGNRVHKATGEQVEIVSLTEEQVVK-------KGEGFVLAS---------------DAS
SYL_PELLD       ------------------------------------------------------------
SYL_CHLPM       ------------------------------------------------------------
SYL_CHLCH       ------------------------------------------------------------
SYL_CHLTE       ------------------------------------------------------------
SYL_CHLPD       ------------------------------------------------------------
SYL_LEPBL       ------------------------------------------------------------
SYL_LEPBJ       ------------------------------------------------------------
SYL_LEPIC       ------------------------------------------------------------
SYL_LEPIN       ------------------------------------------------------------
SYL_BACTN       EVTPLHVDVNIVS--NDILDLEAFK--AWRPEYAEAEFILE----------------DGK
SYL_BACV8       ETTPLHVDVNIVS--NDILDVEAFK--AWRPEYNDAEFILE----------------DGK
SYL_BACFR       EVTPIHVDVNIVS--NDILDLEAFK--AWRPEYETAEFILE----------------DGK
SYL_BACFN       EVTPIHVDVNIVS--NDILDLEAFK--AWRPEYETAEFILE----------------DGK
SYL_PARD8       EVTPIHVDVNIVS--NDLLDIEAFK--NWRPEYNDAEFVLE----------------DGK
SYL_PORGI       EVTPLHVDVNIVS--NDQLDIDRFR--AWRPEYTSAEFILE----------------DGK
SYL_FLAPJ       TTQAIHVDLAIINETTNELDIEAFKKHPLYSDYANAEFILE----------------NGK
SYL_FLAJ1       NVQPIRVDVHFVN-SSDELNIEKFK--AWREDFNTAEFIFDE---------------NGK
SYL_GRAFK       NVQPIHADVSLVN-SSDELDIEGFK--KWRPEFADAKFLTE----------------DGK
SYL_CYTH3       DTTPIHVDVSIVH--NDVLDTEAFK--KWRPDFASAEFILE----------------NNT
SYL_BDEBA       ------------------------------------------------------------
SYL_SORC5       ------------------------------------------------------------
SYL_TREDE       FEDIE-----------------------------------------------------TG
SYL_TREPA       YVHAR-----------------------------------------------------TG
SYL_BORAP       FFDKK-----------------------------------------------------DN
SYL_BORBP       FFDKR-----------------------------------------------------DN
SYL_BORBU       FFDKK-----------------------------------------------------DN
SYL_CHLTR       WVAP------------------------------------------------------SG
SYL_CHLTA       WVAP------------------------------------------------------SG
SYL_CHLMU       WISP------------------------------------------------------SG
SYL_CHLFF       WMST------------------------------------------------------SG
SYL_CHLCV       WMSA------------------------------------------------------SG
SYL_CHLAB       WTTA------------------------------------------------------SG
SYL_CHLPN       WIST------------------------------------------------------CG
SYL_PARUW       YFDSR-----------------------------------------------------TG
SYL_ALKOO       ------------------------------------------------------------
SYL_UREP2       ------------------------------------------------------------
SYL_UREPA       ------------------------------------------------------------
SYL_MYCPU       ------------------------------------------------------------
SYL_MYCPE       ------------------------------------------------------------
SYL_MYCGA       ------------------------------------------------------------
SYL_MYCGE       ------------------------------------------------------------
SYL_MYCPN       ------------------------------------------------------------
SYL_MYCCT       ------------------------------------------------------------
SYL_MYCMS       ------------------------------------------------------------
SYL_MESFL       ------------------------------------------------------------
SYL_ACHLI       ------------------------------------------------------------
SYL_PSEA6       V------------------------KDEKGRITQATLKAD------------------GK
SYL_COLP3       E------------------------RDEKGQITSSISKID------------------GQ
SYL_IDILO       E------------------------RDDKGAIAGAKHKQD------------------GQ
SYL_PSEHT       E------------------------TDDKGRVTKAWHKVD------------------GN
SYL_PSYIN       E------------------------TDEKGKVISAATK-D------------------GQ
SYL_SALCH       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SALTI       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SALTY       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SALPB       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SALPA       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_CITK8       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SALAR       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SHIFL       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SHIF8       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SHIBS       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECOL6       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECOL5       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECO57       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SHISS       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECOLI       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECOLC       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_SHIDS       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECOHS       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECOUT       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECOK1       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_ECO24       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_KLEP7       E------------------------RDEKGRIVKAKDA-A------------------GH
SYL_CROS8       E------------------------RDEKGRIVKASDA-A------------------GH
SYL_ENT38       E------------------------RDEKGRIVKAKDA-A------------------GN
SYL_YERPA       E------------------------RDDKGRIVKAVDA-E------------------GH
SYL_YERP3       E------------------------RDDKGRIVKAVDA-E------------------GH
SYL_YERPE       E------------------------RDDKGRIVKAVDA-E------------------GH
SYL_YERPN       E------------------------RDDKGRIVKAVDA-E------------------GH
SYL_YERPS       E------------------------RDDKGRIVKAVDA-E------------------GH
SYL_YERPP       E------------------------RDDKGRIVKAVDA-E------------------GH
SYL_YERE8       E------------------------RDDKGRIIKATDA-E------------------GH
SYL_SERP5       E------------------------RDDKGRIIKATDP-Q------------------GR
SYL_PECAS       E------------------------RDEKGRIVKATDN-E------------------GR
SYL_SODGM       E------------------------RDEKGRIVKSTDA-S------------------GR
SYL_PHOLL       E------------------------RDDKGRIVKATDK-E------------------GH
SYL_MANSM       E------------------------RDEKGRILKATDD-E------------------GH
SYL_ACTSZ       E------------------------RDEKGRIVKALDD-E------------------GR
SYL_HAES1       E------------------------RDEKGRIIKAVDD-E------------------GH
SYL_HISS2       E------------------------RDEKGRIIKAVDD-E------------------GH
SYL_PASMU       E------------------------RDEKGRILKAFDK-E------------------GR
SYL_HAEIG       E------------------------RDEKGRIIKATDP-E------------------GR
SYL_HAEIN       E------------------------RDEKGRIIKATDP-E------------------GR
SYL_HAEI8       E------------------------RDEKGRIIKATDP-E------------------GR
SYL_HAEIE       E------------------------RDEKGRIIKATDP-E------------------GR
SYL_ACTP2       E------------------------RDEKGRIIKATDP-E------------------GR
SYL_HAEDU       E------------------------RDEKGRIINATDP-A------------------GH
SYL_SHESA       TE-----------------------KDDKGRVTKAIDK-D------------------GN
SYL_SHESM       TE-----------------------KDDKGRVTKAIDK-D------------------GN
SYL_SHESR       TE-----------------------KDDKGRVTKAIDK-D------------------GN
SYL_SHEON       TE-----------------------KDDKGRITKAIDK-D------------------GN
SYL_SHEB9       TE-----------------------KDDKGRITKAIDK-D------------------GN
SYL_SHEB5       TE-----------------------KDDKGRITKAIDK-D------------------GN
SYL_SHEB8       TE-----------------------KDDKGRITKAIDK-D------------------GN
SYL_SHESW       TE-----------------------KDDKGRITKAIDK-D------------------GN
SYL_SHEPC       TE-----------------------KDDKGRITKAIDK-D------------------GN
SYL_SHEAM       VE-----------------------KDDKGRILKAVDT-E------------------GH
SYL_SHEHH       LE-----------------------TDDKGRTVKAVDS-E------------------GN
SYL_SHEPA       QE-----------------------TDDKGRTVKAVDS-E------------------GH
SYL_SHELP       TE-----------------------TDDKGRIVKAVDS-Q------------------GH
SYL_SHESH       QE-----------------------TDEKGRIQKAVDS-E------------------GH
SYL_SHEDO       VE-----------------------KDDKGRVVKAVDS-Q------------------GN
SYL_SHEFN       VE-----------------------KDDKGRIIKAIDN-Q------------------GH
SYL_VIBPA       E------------------------RDGKGRIISAKDN-E------------------GR
SYL_VIBCB       E------------------------RDGKGRITSAKDT-E------------------GR
SYL_VIBVU       E------------------------RDGKGRITSAVDN-E------------------GR
SYL_VIBVY       E------------------------RDGKGRITSAVDN-E------------------GR
SYL_VIBCH       E------------------------RDGKGRIVSAVDA-T------------------GR
SYL_VIBC3       E------------------------RDGKGRIVSAVDA-T------------------GR
SYL_ALIF1       E------------------------RDGKGRIEKAIDD-Q------------------GR
SYL_PHOPR       E------------------------RDAKGRIEKAIDD-Q------------------GR
SYL_AERS4       E------------------------RDEKGRITKAIDN-D------------------GR
SYL_AERHH       E------------------------RDEKGRITKAVDN-E------------------GR
SYL_MARHV       E------------------------RDGKGQVVRAVLKSD------------------GE
SYL_HAHCH       E------------------------LDTQGNSPKAFLIED------------------GQ
SYL_SACD2       --------------------------------------KD------------------G-
SYL_MARMS       --------------------------------------KD------------------G-
SYL_ALCBS       --------------------------------------KD------------------G-
SYL_PSEAB       E------------------------RDAKAKVVGARLKSD------------------GQ
SYL_PSEAE       E------------------------RDAKAKVVGARLKSD------------------GQ
SYL_PSEA7       E------------------------RDAKAKVVGARLKSD------------------GQ
SYL_PSEU5       E------------------------RDAKAKVIGARLKTD------------------GL
SYL_PSEMY       E------------------------RDAKAKVIGAKLKSD------------------GL
SYL_PSEP1       E------------------------RDAKAKIIGARLKTD------------------GL
SYL_PSEPK       E------------------------RDAKAKIIGARLKTD------------------GL
SYL_PSEPG       E------------------------RDAKAKIIGARLKTD------------------GL
SYL_PSEE4       E------------------------RDAKAKIIGARLKTD------------------GL
SYL_PSEU2       E------------------------RDAKAKVISARLTSD------------------GL
SYL_PSE14       E------------------------RDAKAKVISAKLTSD------------------GL
SYL_PSESM       E------------------------RDAKAKVISATLTSD------------------GL
SYL_NEIMB       T------------------------FDDKGRPISAVLKAD------------------GL
SYL_NEIMF       T------------------------FDDKGRPISAVLKAD------------------GL
SYL_NEIG1       T------------------------FDDKGRPVSAVLKAD------------------GL
SYL_NEIM0       T------------------------FDDKGRPVSAVLKAD------------------GL
SYL_NEIMA       T------------------------FDDKGRPVSAVLKVD------------------GL
SYL_CHRVO       E------------------------RDAKGKIVAAKHRVD------------------GQ
SYL_THIDA       K------------------------DGV------ATLRAD------------------GK
SYL_DECAR       V------------------------TDERGRPTGATLKTD------------------GL
SYL_AZOSB       E------------------------RDERGRITAAKLASD------------------GL
SYL_CUPMC       Q------------------------TDERGRPAGATAKAD------------------GQ
SYL_CUPPJ       Q------------------------TDDRGRPVGATLKAD------------------GQ
SYL_RALSO       Q------------------------TDDRGRPIGATLKAD------------------GQ
SYL_JANMA       Q------------------------LDDKGRPVSAVLSSD------------------GK
SYL_HERAR       E------------------------LDDKGRPVSAILNND------------------RQ
SYL_BURCH       T------------------------HDDKGRPVGATLNAD------------------GQ
SYL_BURCA       T------------------------HDDKGRPVGATLNAD------------------GQ
SYL_BURL3       T------------------------HDDKGRPVGATLNTD------------------GQ
SYL_BURCM       T------------------------HDDKGRPVGATLNTD------------------GQ
SYL_BURVG       T------------------------HDDKGRPVGATLNAD------------------GQ
SYL_BURP0       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURPS       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURP6       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURP1       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURM7       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURM9       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURMA       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURMS       S------------------------FDDKGRPVGAVLKSD------------------GQ
SYL_BURTA       S------------------------FDDKGRPVGAVLKAD------------------GQ
SYL_PARXL       S------------------------FDDKGRPVGAILNED------------------GQ
SYL_POLAQ       D------------------------LDEKGRPQGAKLKGDS----------------SGT
SYL_BORBR       V------------------------YDAKGAIVGAKLQRD------------------GS
SYL_BORPA       V------------------------YDAKGAIVGAKLQRD------------------GS
SYL_BORPE       V------------------------YDAKGAIVGAKLQRD------------------GS
SYL_BORPD       L------------------------YDAKGAITGARLKSD------------------GS
SYL_BORA1       I------------------------YDAKGAIVGARLKSD------------------GS
SYL_METPP       Q------------------------FDDKGHPVGAIARED------------------GQ
SYL_ACISJ       V------------------------YDEAGKIVGAKLKNPAESGD--------GLLPVGT
SYL_ACIAC       I------------------------QDEAGKITGARLKNAV------------GDLPAGT
SYL_RHOFT       V------------------------SDETGKVVAAKLKVAV------------GNLPAGT
SYL_VEREI       V------------------------HDAAGKIIGARLIRAV------------GDWPAGS
SYL_POLNA       V------------------------LDDTGKIAGARLKNAV------------GDLPVGT
SYL_POLSJ       I------------------------HDAAGKVTGAKRKSD------------------GL
SYL_METCA       S------------------------TDERGRPLGATLKSD------------------GA
SYL_DICNV       K------------------------TDDKGRIIGGVLLSD------------------GK
SYL_PSYCK       D------------------------FNERGQPIKAILKSD------------------GQ
SYL_PSYA2       D------------------------FNERGQPIKAILKSD------------------GQ
SYL_PSYWF       S------------------------YDDRGQPTQAILKAD------------------GQ
SYL_ACIAD       E------------------------RDEKGRIVSAKYSGD------------------GQ
SYL_NITEU       Q------------------------HDGEGKRVGAVLQAD------------------NQ
SYL_NITEC       Q------------------------YDAEGKKIGAVLQAD------------------GQ
SYL_NITMU       Q------------------------TDEQGRRIGAVLRAD------------------GQ
SYL_METFK       ------------------------------------------------------------
SYL_HYDCU       V------------------------TDDKGAIVKGTLKSD------------------GT
SYL_XYLFA       E------------------------CDERGRITGATLISD------------------GQ
SYL_XYLFT       E------------------------CDERGRITGATLISD------------------GQ
SYL_XANC8       Q------------------------RDERGRVVGASLIAD------------------GQ
SYL_XANCP       Q------------------------RDERGRVVGASLIAD------------------GQ
SYL_XANCB       Q------------------------RDERGRVVGASLIAD------------------GQ
SYL_XANC5       Q------------------------RDERGRVTGAVLIAD------------------GQ
SYL_XANAC       Q------------------------RDERGRVTGAVLIAD------------------GQ
SYL_XANOR       Q------------------------RDERGRVTGAVLIAD------------------GQ
SYL_XANOM       Q------------------------RDERGRVTGAVLIAD------------------GQ
SYL_NITOC       ------------------------------------------------------------
SYL_ALKEH       Q------------------------RDERGRPVSAVLEDD------------------GE
SYL_HALHL       ------------------------------------------------------------
SYL_CHRSD       Q------------------------RDDKGRPVSAILRED------------------GQ
SYL_BUCAI       K------------------------RNTKGEIIESHTQK-------------------GE
SYL_BUCAP       E------------------------KNLKGETIKVDIKN-------------------KK
SYL_BUCCC       N------------------------RDSKGKIISAIEKSS------------------QK
SYL_BUCBP       K------------------------YDSNHKIQSHFYSN-------------------NK
SYL_WIGBR       E------------------------RNKDNKIINAIDSL-------------------GN
SYL_BLOPB       K------------------------RDRIGGIVKAIDKD-------------------GR
SYL_BLOFL       T------------------------RDKMGHIIKSIDAD-------------------GN
SYL_BAUCH       Q------------------------RDEKGNIINAIDLQ-------------------GH
SYL_COXBU       ------------------------------------------------------------
SYL_COXBR       ------------------------------------------------------------
SYL_COXBN       ------------------------------------------------------------
SYL_LEGPH       ------------------------------------------------------------
SYL_LEGPC       ------------------------------------------------------------
SYL_LEGPA       ------------------------------------------------------------
SYL_LEGPL       ------------------------------------------------------------
SYL_FRATT       ------------------------------------------------------------
SYL_FRAT1       ------------------------------------------------------------
SYL_FRATW       ------------------------------------------------------------
SYL_FRATF       ------------------------------------------------------------
SYL_FRATH       ------------------------------------------------------------
SYL_FRATO       ------------------------------------------------------------
SYL_FRATN       ------------------------------------------------------------
SYL_FRAP2       ------------------------------------------------------------
SYL_RUTMC       ------------------------------------------------------------
SYL_VESOH       ------------------------------------------------------------
SYL_RICRS       --------------------------EVVKKGN------------------EFFHKESNN
SYL_RICRO       --------------------------EVVKKGN------------------EFFHKESNN
SYL_RICCN       --------------------------EVVKKGN------------------EFFHKESNN
SYL_RICM5       --------------------------EVVKKGN------------------EFFHKESNN
SYL_RICFE       --------------------------EVVKKGN------------------EFFHKESNN
SYL_RICAH       --------------------------EVVKKGN------------------EFFRKESND
SYL_RICCK       --------------------------EVVKKDN------------------KFFHKKSGN
SYL_RICBR       --------------------------EVIKKGN------------------EFFHKENGG
SYL_RICPR       --------------------------EVVKKGN------------------EFFHKENNT
SYL_RICTY       --------------------------EVVKNGN------------------EFFHKETNT
SYL_ORITB       --------------------------EVEVDSNG-----------------QLRCKADLQ
SYL_WOLPM       --------------------------EAKELIA------------------------RGA
SYL_WOLTR       --------------------------EAKRLIT------------------------QGA
SYL_EHRRW       --------------------------DGKKMIQ------------------------EGK
SYL_EHRRG       --------------------------DGKKMIQ------------------------EGK
SYL_EHRCJ       --------------------------EARKMME------------------------EGQ
SYL_EHRCR       --------------------------EAKKMME------------------------NGQ
SYL_ANAMM       --------------------------DAQRMIR------------------------DGE
SYL_NEOSM       --------------------------EAKSLLE------------------------KGE
SYL2_RHIL3      --------------------------DIRIDELDGK--------------RRAFLLTNNE
SYL_RHIEC       --------------------------DIRIEEIDGK--------------RRAFLLASDE
SYL_RHIME       --------------------------EIRVEEVDGQ--------------RRAVHIETGE
SYL_SINMW       --------------------------EIRIEEADGQ--------------RRAVHIETSE
SYL_AGRFC       --------------------------ELRIEENDGT--------------RRAFLLSSGE
SYL_BRUAB       --------------------------DIRIEEIDGK--------------RVATMLDSGA
SYL_BRUA2       --------------------------DIRIEEIDGK--------------RVATMLDSGA
SYL_BRUSI       --------------------------DIRIEEIDGK--------------RVATMLDSGA
SYL_BRUO2       --------------------------DIRIEEIDGK--------------RVATMLDSGA
SYL_BRUME       --------------------------DIRIEEIDGK--------------RVATMLDSGA
SYL_BRUSU       --------------------------DIRIEEIDGK--------------RVATMLDSGA
SYL_BRUC2       --------------------------DIRIEEIDGK--------------RVATMLDSGA
SYL_OCHA4       --------------------------DIRIEETDGK--------------RSAALLSTGE
SYL_CHESB       --------------------------EVRIEGSAGE--------------RRAFEIATGK
SYL_RHILO       --------------------------EVRIEDAEGK--------------RRAIEIATGE
SYL_BART1       --------------------------EISIVEKDGK--------------RCAYKLTDQS
SYL_BARHE       --------------------------EISIVEKDGK--------------RQAYKLTDQS
SYL_BARQU       --------------------------EISIIEKDGK--------------RQAHKLTDQS
SYL_BARBK       --------------------------EVSIVEQDGK--------------RRAYKLTDQS
SYL_RHOP2       --------------------------EVAIVAEGDG--------------RRATLLDGGT
SYL_RHOPS       --------------------------EVAIVAEGDG--------------RRATLLDDGT
SYL_RHOPA       --------------------------EISITVEGDT--------------RRATLLDGGS
SYL_RHOP5       --------------------------ELDATMTIESIATDASGEAKTTTKRKVWLRETGE
SYL_NITHX       --------------------------EVGIEAVGNG--------------RRATLISTGE
SYL_NITWN       --------------------------EVRIEVDGNN--------------RRATLITTGE
SYL_BRASB       --------------------------EVKIEVGGNG--------------RRAVLTATGE
SYL_BRASO       --------------------------DVKIEVGGNG--------------RRAVLTATGE
SYL_BRADU       --------------------------EVKIELGGNG--------------RRATLLTTGE
SYL_RHOPB       --------------------------EIRIVADGDN--------------RLASLLDSGQ
SYL_AZOC5       --------------------------EVKLLG-DGK----------------AEKLDDGS
SYL_PARL1       --------------------------EVDIETVSGK--------------RVAKRIADGE
SYL_CAUVC       ---------------------------VVITTEGST--------------RTAKHAKTGA
SYL_CAUSK       ---------------------------VVIAVEGAT--------------RSARHAATGE
SYL_MARMM       ------------------------------EVDLRK--------------DGAVEMSTGK
SYL_HYPNA       ------------------------------AVERKD--------------GQVFEIATGK
SYL_RUEST       ------------------RAI----YHYPSEVEERD--------------GGVFVKETGE
SYL_RUEPO       ------------------RPV----YHYPEAVRLE---------------GGKGYLEDGT
SYL_ROSDO       ------------------RPV----YHLPEDVTD-------------------GRLADGT
SYL_JANSC       ------------------RPV----YHYPETVDLR---------------DGGGYLDDGT
SYL_DINSH       ------------------RPV----YHYPEEVETTE--------------EGAVLKKTGA
SYL_RHOS1       -------------------------YHLPEDVTDGR-------------------LADGT
SYL_RHOS4       -------------------------YHLPEDVTDGK-------------------LADGT
SYL_RHOS5       EPGESPDTQMTVR-----HIT----YHFPEEVERTE--------------DGAILKTTGQ
SYL_PARDP       -------------------------YHLPEDVVDGK-------------------LADGT
SYL_ZYMMO       -------------------------WLSPEQIHKDE--------------AGIFLTESGE
SYL_SPHWW       -------------------------WLSPE----EV--------------SDGIVVATGA
SYL_NOVAD       -------------------------FFSPGEVERTG--------------EGATLKVDGA
SYL_SPHAL       -------------------------YFTPDEVERGA--------------DGATLIADGA
SYL_GRABC       -------------------------WLSPVEVTRHG--------------ETVVETATGE
SYL_GLUOX       -------------------------WLYPEEVERQG--------------DQVVRRETGT
SYL_ACICJ       -------------------------WLYPEEVIRHA--------------DHATTLD-GR
SYL_MAGSA       --------------------------EVVPGADGK-----------------LVHAETGA
SYL_RHORT       --------------------------QIDKAADGT-----------------ATLLSDGS
SYL_MAGMM       --------------------------EVQERD------------------GALYCIECGG
SYL_CAMJ8       ------------------------------------------------------------
SYL_CAMJJ       ------------------------------------------------------------
SYL_CAMJR       ------------------------------------------------------------
SYL_CAMJE       ------------------------------------------------------------
SYL_CAMJD       ------------------------------------------------------------
SYL_CAMC1       ------------------------------------------------------------
SYL_CAMC5       ------------------------------------------------------------
SYL_CAMFF       ------------------------------------------------------------
SYL_CAMHC       ------------------------------------------------------------
SYL_ARCB4       ------------------------------------------------------------
SYL_NITSB       ------------------------------------------------------------
SYL_WOLSU       ------------------------------------------------------------
SYL_HELHP       ------------------------------------------------------------
SYL_HELPY       ------------------------------------------------------------
SYL_HELPH       ------------------------------------------------------------
SYL_HELPJ       ------------------------------------------------------------
SYL_HELAH       ------------------------------------------------------------
SYL_THEMA       ------------------------------------------------------------
SYL_THEP1       ------------------------------------------------------------
SYL_THEM4       ------------------------------------------------------------
SYL_FERNB       ------------------------------------------------------------
SYL_PSELT       ------------------------------------------------------------
SYL_CALS8       ------------------------------------------------------------
SYL_HUNT2       ------------------------------------------------------------
SYL_DESHY       ------------------------------------------------------------
SYL_SYNWW       ------------------------------------------------------------
SYL_CARHZ       ------------------------------------------------------------
SYL_PELTS       ------------------------------------------------------------
SYL_MOOTA       ------------------------------------------------------------
SYL_DESRM       ------------------------------------------------------------
SYL_SYMTH       ------------------------------------------------------------
SYL_DESVH       ------------------------------------------------------------
SYL_DESVV       ------------------------------------------------------------
SYL_DESAG       ------------------------------------------------------------
SYL_LAWIP       ------------------------------------------------------------
SYL_GEOMG       ------------------------------------------------------------
SYL_GEOSL       ------------------------------------------------------------
SYL_GEOUR       ------------------------------------------------------------
SYL_PELPD       ------------------------------------------------------------
SYL_PELCD       CGATAQTGRNE-------------------------------------------------
SYL_SYNAS       CLAEVIVGKTE-------------------------------------------------
SYL_SYNFM       ------------------------------------------------------------
SYL_DESPS       ------------------------------------------------------------
SYL_FUSNN       K-------------------------GDKAYSQ-------------------------SG
SYL_TRIV2       ---------------------------PNDPRDPQ-----------------------TG
SYL_NOSS1       ---------------------------PNDPRDPQ-----------------------TG
SYL_ACAM1       ---------------------------ADDPKDPE-----------------------TG
SYL_TRIEI       ---------------------------PQEPKDPK-----------------------TG
SYL_SYNY3       QQVI----------------------DPKDPKDPD-----------------------SG
SYL_SYNE7       --------------------------DPSQPVDPD-----------------------TG
SYL_SYNP6       --------------------------DPSQPVDPD-----------------------TG
SYL_THEEB       --------------------------DLNQPTDPD-----------------------TG
SYL_SYNJB       --------------------------DPDNPTDPE-----------------------TG
SYL_SYNJA       --------------------------DPNDPRDPE-----------------------TG
SYL_GLOVI       --------------------------RGGAFFARP-----------------------DG
SYL_SYNS3       --------------------------DESNPLDPD-----------------------DG
SYL_SYNPW       --------------------------DENAPKDPV-----------------------DG
SYL_PROMM       --------------------------DDSDPRDPE-----------------------SG
SYL_PROM3       --------------------------DEGDPRDPE-----------------------SG
SYL_SYNSC       --------------------------DAEDPRDPN-----------------------TG
SYL_SYNS9       --------------------------DPNDPLDPT-----------------------TG
SYL_SYNPX       --------------------------DPETPTDPT-----------------------SG
SYL_SYNR3       --------------------------DPNQPTDPD-----------------------DG
SYL_PROMT       --------------------------DIDNPKDPL-----------------------TG
SYL_PROM1       --------------------------DIDNPKDPL-----------------------TG
SYL_PROMA       --------------------------DINTPLDPE-----------------------TG
SYL_PROM0       --------------------------DLSNPTDPI-----------------------DN
SYL_PROM9       --------------------------DLSNPTDPI-----------------------DN
SYL_PROMS       --------------------------DLSNPTDPI-----------------------DN
SYL_PROM2       --------------------------DLSNPTDPI-----------------------DN
SYL_PROMP       --------------------------DITNPKDPK-----------------------DN
SYL_PROM5       --------------------------DFNNPTDPN-----------------------DD
SYL_SOLUE       ------------------------------------------------------------
SYL_DEIRA       --------------------------------------------------------EDG-
SYL_DEIGD       --------------------------------------------------------EDG-
SYL_RUBXD       --------------------------------------------------------PDG-
SYL_CLOPE       --------------------------------------------------------PDG-
SYL_CLOPS       --------------------------------------------------------PDG-
SYL_CLOP1       --------------------------------------------------------PDG-
SYL_CLOB8       --------------------------------------------------------PDG-
SYL_CLOB1       --------------------------------------------------------PDG-
SYL_CLOBH       --------------------------------------------------------PDG-
SYL_CLOBL       --------------------------------------------------------PDG-
SYL_CLONN       --------------------------------------------------------PDG-
SYL_CLOAB       --------------------------------------------------------PDG-
SYL_CLOK5       --------------------------------------------------------PDG-
SYL_CLOTE       --------------------------------------------------------PDG-
SYL_CALS4       --------------------------------------------------------PDG-
SYL_ROSCS       LELPADAQSLDQARALLKERGYTLE-----------------------------EESNGG
SYL_ROSS1       LELPAEAQTVDQARALLKERGYTLE-----------------------------EESDGG
SYL_THEFY       ------------------------------------------------------------
SYL_ACIC1       ------------------------------------------------------------
SYL_ARTS2       ------------------------------------------------------------
SYL_PAEAT       ------------------------------------------------------------
SYL_RENSM       ------------------------------------------------------------
SYL_CLAMS       ------------------------------------------------------------
SYL_CLAM3       ------------------------------------------------------------
SYL_LEIXX       ------------------------------------------------------------
SYL_KINRD       ------------------------------------------------------------
SYL_NOCSJ       ------------------------------------------------------------
SYL_TROW8       ------------------------------------------------------------
SYL_TROWT       ------------------------------------------------------------
SYL_MYCPA       FFYRGPDG---------------------------------------------------E
SYL_MYCA1       FFYRGPDG---------------------------------------------------E
SYL_MYCLE       FFCPGPDG---------------------------------------------------E
SYL_MYCTA       FVYPGPDG---------------------------------------------------E
SYL_MYCBO       FVYPGPDG---------------------------------------------------E
SYL_MYCTU       FVYPGPDG---------------------------------------------------E
SYL_MYCBP       FVYPGPDG---------------------------------------------------E
SYL_MYCUA       FVYPGADG---------------------------------------------------E
SYL_MYCSS       FWFEGA------------------------------------------------------
SYL_MYCSK       FWFEGA------------------------------------------------------
SYL_MYCSJ       FWFEGA------------------------------------------------------
SYL_MYCS2       FFWPGPDG---------------------------------------------------E
SYL_MYCVP       FFWPGPDG---------------------------------------------------E
SYL_MYCGI       FVWPGPDG---------------------------------------------------E
SYL_NOCFA       FFWTDATGT--------------------------------------------------E
SYL_RHOJR       FFHQG-------------------------------------------------------
SYL_SACEN       FFFQGE------------------------------------------------------
SYL_CORGB       FFYQG-------------------------------------------------------
SYL_CORGL       FFYQG-------------------------------------------------------
SYL_COREF       FFYQG-------------------------------------------------------
SYL_CORDI       FYYQG-------------------------------------------------------
SYL_CORJK       FFWVRKADDAEGV--------------------------------------------TKE
SYL_STRCO       YYYQGE------------------------------------------------------
SYL_STRAW       YYYQGE------------------------------------------------------
SYL_SALAI       YYLGDV------------------------------------------------------
SYL_BIFAA       ANGEPTFTW-------------------------------------------------NG
SYL_BIFLO       ASGEPTFTW-------------------------------------------------NG
SYL_FRACC       FLFQGA------------------------------------------------------
SYL_FRAAA       FTHHGA------------------------------------------------------
                                                                            

SYL_GEOKA       -------EKMSKSKGNVVNPDDIIESHGADTLRLYEMFMGPLEASIAWSTKGLDGARRFL
SYL_GEOTN       -------EKMSKSKGNVVNPDDIVESHGADTLRLYEMFMGPLEASIAWSTKGLDGARRFL
SYL_BACCZ       -------EKMSKSKGNVVNPDDIVASHGADTLRLYEMFMGPLDASIAWSENGLDGARRFL
SYL_BACAH       -------EKMSKSKGNVVNPDDIVASHGADTLRLYEMFMGPLDASIAWSENGLDGARRFL
SYL_BACAN       -------EKMSKSKGNVVNPDDIVASHGADTLRLYEMFMGPLDASIAWSENGLDGARRFL
SYL_BACHK       -------EKMSKSKGNVVNPDDIVASHGADTLRLYEMFMGPLDASIAWSENGLDGARRFL
SYL_BACC1       -------EKMSKSKGNVVNPDDIVASHGADTLRLYEMFMGPLDASIAWSENGLDGARRFL
SYL_BACCR       -------EKMSKSKGNVVNPDDIVASHGADTLRLYEMFMGPLDASIAWSENGLDGARRFL
SYL_BACCN       -------EKMSKSKGNVVNPDDIVASHGADTLRLYEMFMGPLDASIAWSENGLDGARRFL
SYL_BACSU       -------EKMSKSKGNVVNPDEIVASHGADTLRLYEMFMGPLDASIAWSESGLDGARRFL
SYL_BACVZ       -------EKMSKSRGNVVNPDEIVASHGADTLRLYEMFMGPLDASIAWSESGLDGARRFL
SYL_BACLD       -------EKMSKSKGNVVNPDEIVETHGADTLRLYEMFMGPLDASIAWSTTGLDGARRFL
SYL_BACP2       -------EKMSKSKGNVVNPDDIVESHGADTLRLYEMFMGPLDASIAWSETGLDGARRFL
SYL_BACHD       -------EKMSKSKGNVVNPDDIIDSHGADTLRLYEMFMGPLDASIAWSTTGLDGARRFL
SYL_BACSK       -------EKMSKSKGNVVNPDEIIASHGADTLRLYEMFMGPLDASVAWSTNGLDGSRRFL
SYL_OCEIH       -------EKMSKSKGNVVNPDDIIDSHGADTLRLYEMFMGPLDASVAWSTNGLDGSRRFL
SYL_STAES       -------EKMSKSKGNVINPDDIVASHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAEQ       -------EKMSKSKGNVINPDDIVASHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAW       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAS       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAN       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAA1       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAM       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAA9       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAA2       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAA3       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAC       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAA8       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAT       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAE       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAB       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAAR       -------EKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL
SYL_STAHJ       -------EKMSKSKGNVVNPDDIVDSHGADTLRLYEMFMGPLDAAIAWSENGLDGSRRFL
SYL_STAS1       -------EKMSKSKGNVINPDDIVKSHGADTLRLYEMFMGPLDAAIAWSENGLDGSRRFL
SYL_LISMF       -------EKMSKSRGNVVNPDEVVEKYGADTLRLYEMFMGPLEASIAWNENGLEGARKFL
SYL_LISMO       -------EKMSKSRGNVVNPDEVVEKYGADTLRLYEMFMGPLEASIAWNENGLEGARKFL
SYL_LISIN       -------EKMSKSRGNVVNPDEVVEKYGADTLRLYEMFMGPLEASIAWNENGLEGARKFL
SYL_LISW6       -------EKMSKSRGNVVNPDEVVEKYGADTLRMYEMFMGPLDASIAWNENGLEGARKFL
SYL_ENTFA       -------EKMSKSRGNVVNPDDVVAKYGADTLRLYEMFMGPLDASIAWNENGLEGSRKFL
SYL_STRTD       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRT2       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRT1       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRP2       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRR6       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRPN       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRSV       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRGC       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRS2       --LEQAPAKMSKSLKNVVNPDDVVEQFGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRSY       --LEQAPAKMSKSLKNVVNPDDVVEQFGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRPD       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRPG       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRP6       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRPM       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRPF       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRPB       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRPC       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRP3       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRP1       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRP8       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRA3       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRA5       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRA1       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_STRMU       --LEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFL
SYL_LACLM       --LEQAPAKMSKSLKNVVNPDDVVEHYGADTLRVYEMFMGPLDASIPWSEEGLEGARKFL
SYL_LACLA       --LEQAPAKMSKSLKNVVNPDDVVEHYGADTLRVYEMFMGPLDASIPWSEEGLEGARKFL
SYL_LACLS       --LEQAPAKMSKSLKNVVNPDDVVEHYGADTLRVYEMFMGPLDASIPWSEEGLEGARKFL
SYL_LACSS       -------EKMSKSKGNVVNPDDVVDRFGADTLRLYEMFMGPLDASISWSEKGLAGARKFL
SYL_LACDA       ----KNHEKMSKSRGNVVNPDDVVDEYGADSLRTYEMFMGPLNASIDWDDNGPSGVKKFL
SYL_LACDB       ----KNHEKMSKSRGNVVNPDDVVDEYGADSLRTYEMFMGPLNASIDWDDNGPSGVKKFL
SYL_LACP3       ----DNHEKMSKSKGNVVNPDDVVDEYGADTLRLYEMFMGPLDAGIAWSTKGLAGARKFL
SYL_LACPL       -------EKMSKSRGNVVNPDDIVDQYGADTLRLYEMFMGPLEASIPWSTDGLHGANKWI
SYL_LACBA       -------EKMSKSKGNVINPDEIVEKHGADTLRLYEMFMGPLEASKPWSTEGINGSRRWL
SYL_PEDPA       -------EKMSKSKGNVVNPDDIVERFGADTLRLYEMFMGPLTESVAWSEDGLNGSRKWI
SYL_LACS1       -------EKMSKSKGNVVNPDDIVEQYGADTLRLYEMFMGPLDASIPWSEEGLGGAHKFI
SYL_LACRD       -------EKMSKSKGNVVNPDDIVDQYGADTLRLYEMFMGPLEESVPWDEKGLHGANKWV
SYL_LEUMM       -------EKMSKSKGNVVNPDEIVNNYGADTLRVYEMFMGPLTQSKPWSEDGVSGSRRWL
SYL_OENOB       -------EKMSKSKGNVVNPDEIVDSYGADALRVYEMFMGPLTQSKPWSTESLAGIRRYL
SYL_SALRD       --VDARSHKMSKSRGNVINPDDVVDEYGADTLRLYEMFMGPLEQDKPWSTDDMEGVHRFL
SYL1_RHIL3      ----RAVEKMSKSQLNVVNPDDVVHQFGADALRLYEMFMGPLDAAKPWQTAGVIGVRRFL
SYL_RHOBA       IKVDSRAFKMSKSRGNVVNPDSVVRDYGADSLRLYEMFMGPLEATKPWAMNGVGGVRSFL
SYL_PELLD       -----DGEKMSKSRGNVIPADHVLEKYGADAVRLYEMFLGPLEQVKPWNTNGIEGVSRFL
SYL_CHLPM       -----DNEKMSKSRGNVIPADHVLQTYGADAVRLYEMFLGPLEQVKPWNTNGIEGISRFL
SYL_CHLCH       -----DNEKMSKSRGNVIPADHVLQRYGADAVRLYEMFLGPLEQVKPWNTNGIEGISRFL
SYL_CHLTE       -----DNEKMSKSRGNVIPADHVLSTYGADALRLYEMFLGPLDQVKPWNTHGIEGISRFL
SYL_CHLPD       -----DNEKMSKSRGNVIPADQVLKDYGADAVRLYEMFLGPLEQVKPWNTNGIEGISRFL
SYL_LEPBL       -----DKRKMSKSLGNVINPDDVIRKYGADSLRLFEMFMGPLEMVKPWSTRGVEGVFRFL
SYL_LEPBJ       -----DKRKMSKSLGNVINPDDVIRKYGADSLRLFEMFMGPLEMVKPWSTRGVEGVFRFL
SYL_LEPIC       -----DKRKMSKSLGNVVNPDDVIKEYGADSLRLFEMFMGPLEMVKPWSTRGVEGVFRFL
SYL_LEPIN       -----DKRKMSKSLGNVVNPDDVIKEYGADSLRLFEMFMGPLEMVKPWSTRGVEGVFRFL
SYL_BACTN       YICGWAVEKMSKSMFNVVNPDMIVDKYGADTLRMYEMFLGPVEQSKPWDTNGIDGVHRFI
SYL_BACV8       YICGWAVEKMSKSMYNVVNPDMIVEKYGADTLRMYEMFLGPVEQSKPWDTNGIDGVHRFL
SYL_BACFR       YICGWAVEKMSKSMFNVVNPDMIVEKYGADTLRMYEMFLGPVEQSKPWDTNGIDGVHRFI
SYL_BACFN       YICGWAVEKMSKSMFNVVNPDMIVEKYGADTLRMYEMFLGPVEQSKPWDTNGIDGVHRFI
SYL_PARD8       YICGWAVEKMSKSMFNVVNPDMIVEKYGADTLRLYEMFLGPLEQSKPWDTNGIDGVHRFL
SYL_PORGI       YICGWAIEKMSKSMFNVVNPDDIIARYGADTLRLYEMFLGPLEQSKPWDTNGIDGVHRFL
SYL_FLAPJ       YIVGREVEKMSKSKYNVVNPDDICNEYGADTLRLYEMFLGPLEQSKPWNTAGITGVFGFL
SYL_FLAJ1       YIVGREVEKMSKSYYNVVTPDDICAEYGADTLRLYEMFLGPLEQAKPWNTAGISGVFGFL
SYL_GRAFK       YIVGREVEKMSKSKYNVVNPDEICQDYGADTLRMYEMFLGPLEQAKPWNTAGITGVHNFL
SYL_CYTH3       YVCGSEVEKMSKSKFNVVNPDDIVNKYGADTLRMYEMFLGPLEQSKPWNTNGIEGVYKFL
SYL_BDEBA       -----DGEKMSKSRGNVISPEDIARSHGADALRTFISFMGPVDKDKPWAPTGIDGVKRFL
SYL_SORC5       -------EKMSKSRGNVINPDDIVRAHGADVLRMYEMFMGPLEAVKPWQSGQIQGVVRFR
SYL_TREDE       EKLEQVIAKMSKSLKNVINPDDIIKEYGADTLRLYEMFLGPLEVSKPWNTSGIMGVFRFL
SYL_TREPA       EKLECVVAKMSKALKNVVNPDDMIAAYGADACRVYEMFMGPLEASKPWNTQGLVGVFRFL
SYL_BORAP       KEVTQVIAKMSKSLKNVINPDGIIKEFGADSIRIYEMFMGPLTDSKPWNTKGIIGVFRFL
SYL_BORBP       KEVIQVIAKMSKSLKNVINPDDIIKEFGADSIRIYEMFMGPLTDSKPWNTKGIIGVFRFL
SYL_BORBU       KEVTQVIAKMSKSLKNVINPDDIIKEFGADSMRIYEMFMGPLTDSKPWNTKGIIGVFRFL
SYL_CHLTR       EELDVRQEKMSKSKLNGVDPQILIDEFGADAVRMYAMFSGPLDKNKLWSNQGVAGCRRFL
SYL_CHLTA       EELDVRQEKMSKSKLNGVDPQILIDEFGADAVRMYAMFSGPLDKNKLWSNQGVAGCRRFL
SYL_CHLMU       ELLDVRQEKMSKSKLNGVDPKVLIDEFGADAVRMYAMFSGPLDKNKLWSNQGVAGCRRFL
SYL_CHLFF       EELEVRQEKMSKSKLNGVDPQILIEEFGADALRMYAMFSGPLDKNKLWCNQGVSGCRRFL
SYL_CHLCV       EELEVRQEKMSKSKLNGVDPQILIDEFGADALRMYAMFSGPLDKNKLWSNQGVSGCRRFL
SYL_CHLAB       EELEVRQEKMSKSKLNGVDPQILIDEFGADALRMYAMFSGPLDKNKLWCNQGVSGCRRFL
SYL_CHLPN       EIVEVRQEKMSKSKLNGVDPQVLIEEYGADALRMYAMFSGPLDKNKTWSNEGVGGCRRFL
SYL_PARUW       EELTSQIDKMSKSKLNGESPDEIIQEYGADALRLYEMFMGPLEKEKVWNTDAVSGTRRFL
SYL_ALKOO       -------EKMSKSRGNVINPDDIVTEFGADTLRLYEMFIGDFEKSVPWSQNGVKGCRRFL
SYL_UREP2       ------NEKMSKSKGNVINPDDIIASHGADTLRIYEMFMGPLTASLPWNPDGLDAMRKWL
SYL_UREPA       ------NEKMSKSKGNVINPDDIIASHGADTLRIYEMFMGPLTASLPWNPDGLDAMRKWL
SYL_MYCPU       ------GQKMSKSRGNIINPSEIVDELGADTLRVYEMFMGPLTDDKDWQVESIKGIRKWL
SYL_MYCPE       ------GEKMSKSKGNVVNPSDFVVSHGADALRLYMMFMGPITASLPWEESGIDGMYKWV
SYL_MYCGA       ------NTKMSKSKGNIINPDDLVLSHGADTIRTYVMFMGPLNASLAWNSNALNGTRKFL
SYL_MYCGE       ------GKKMSKSKGNTINPTPLVDSHGADALRLYLMFMGPISASLTWNDEGLNGMRRWL
SYL_MYCPN       ------GKKMSKSKGNTINPTPLIDSHGADALRLYLMFMGPISAALTWLDDGLNGMRRWL
SYL_MYCCT       ------NRKMSKSWGNVINPDDVIDTHGADALRLYEMFMGPLDASLPWSFDGLDASLKWL
SYL_MYCMS       ------NRKMSKSWGNVINPDDVIDTHGADALRLYEMFMGPLDASLPWSFDGLDASLKWL
SYL_MESFL       ------GRKMSKSWGNVINPDDIVSTHGADSLRLYEMFMGPLDASLPWSEDGLDSALKWI
SYL_ACHLI       ------HSKMSKSKGNSVSPDDFIQSHGADALRLFEMFMGPLEAEKPWSNEGLEGAKRFL
SYL_PSEA6       PVEHGGMTKMSKSKNNGIDPQHVIDLYGADTIRVFTMFAAPPEQTLEWVDSGVEGANRFI
SYL_COLP3       PVLSAGMSKMSKSKNNGIDPQEVIEKYGADTVRLFIMFTSPPEQTLEWSDAGVEGAHRFV
SYL_IDILO       PVNIGGMSKMSKSKNNGIDPQTMVERYGADTVRLFMMFAAPPEMTLEWSDSGVEGAQRFL
SYL_PSEHT       PVFSSGMSKMSKSKNNGIDPQHVIAQYGADTVRLFMMFTAPPEQTLEWSDAGVEGAHRFL
SYL_PSYIN       TVIYDGMSKMSKSKNNGVDPQVMIDKYGADSVRLFMMFAAPADQTLEWSDSALEGSLRFL
SYL_SALCH       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFI
SYL_SALTI       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFI
SYL_SALTY       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFI
SYL_SALPB       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFI
SYL_SALPA       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFI
SYL_CITK8       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_SALAR       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFI
SYL_SHIFL       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_SHIF8       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_SHIBS       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECOL6       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECOL5       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECO57       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_SHISS       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECOLI       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECOLC       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_SHIDS       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECOHS       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECOUT       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECOK1       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ECO24       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_KLEP7       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_CROS8       ELVYTGMSKMSKSKNNGIDPQEMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ENT38       ELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_YERPA       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_YERP3       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_YERPE       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_YERPN       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_YERPS       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_YERPP       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_YERE8       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_SERP5       ELVYAGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_PECAS       DVVYAGMSKMSKSKNNGIDPQIMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_SODGM       ELVYAGMSKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_PHOLL       ELVYTGMSKMSKSKNNGIDPQLMVEKYGADTVRLFMMFAAPPELTLEWQESSVEGANRFL
SYL_MANSM       ELVHAGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_ACTSZ       ELVHAGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_HAES1       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_HISS2       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGANRFL
SYL_PASMU       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_HAEIG       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_HAEIN       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_HAEI8       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_HAEIE       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_ACTP2       ELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_HAEDU       KLVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFL
SYL_SHESA       ELVYTGMCKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHESM       ELVYTGMCKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHESR       ELVYTGMCKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEON       ELVYTGMCKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEB9       ELVYTGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEB5       ELVYTGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEB8       ELVYTGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHESW       ELVYTGMCKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEPC       ELVYTGMCKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEAM       ELVYTGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEHH       ELVYTGMSKMSKSKNNGIDPQEMVDKYGADTVRLFMMFAAPPELTLEWQESSVEGAHRFI
SYL_SHEPA       ELVYTGMSKMSKSKNNGIDPQEMVDKYGADTVRLFMMFAAPPELTLEWQESSVEGAHRFI
SYL_SHELP       ELVYTGMSKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPPELTLEWQESSVEGAHRFI
SYL_SHESH       ELVYTGMSKMSKSKNNGIDPQVMVDKYGADTVRLFMMFAAPPELTLEWQESSVEGAHRFI
SYL_SHEDO       ELVYTGMSKMSKSKNNGIDPQTMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_SHEFN       ELVYTGMSKMSKSKNNGIDPQVMVEKYGADTVRLFMMFASPPELTLEWQESGVEGAHRFI
SYL_VIBPA       DVTHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_VIBCB       DVTHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_VIBVU       NVEHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_VIBVY       NVEHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_VIBCH       QVEHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_VIBC3       QVEHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_ALIF1       EVEHSGMIKMSKSKNNGIDPQEMVDKYGADTVRLFMMFASPADMTLEWQESGVEGANRFL
SYL_PHOPR       EVQHSGMIKMSKSKNNGIDPQEMVDKFGADTVRLFMMFASPADMTLEWQESGVEGASRFL
SYL_AERS4       EVIHSGMTKMSKSKNNGIDPQLMVERYGADTVRLFMMFASPAEMTLEWSDSGVEGAQRFL
SYL_AERHH       EVIHSGMTKMSKSKNNGIDPQLMVERYGADTVRLFMMFASPAEMTLEWSDSGVEGAQRFL
SYL_MARHV       PVEIGGVTKMSKSKNNGIDPQAIIDQHGADTVRLFMMFAAPPEQSLEWSDSGVEGAHRFL
SYL_HAHCH       PVIIGPKEKMSKSKNNGVDPQELIDKYGADTVRLFTMFAAPPEQSLEWSESGVEGQHRFL
SYL_SACD2       -------TKMSKSKGNTVDPEDLIKTYGADTVRLFSMFAAPPEQSLEWTDSGVEGAFRFL
SYL_MARMS       -------TKMSKSKGNTVDPQEMIEKYGADTVRLFMMFSAPPEQSLEWNDAGVDGASRFL
SYL_ALCBS       -------AKMSKSKGNTVDPQQMIEEYGADTVRLFMMFAAPPEQSLEWNDAGVEGAFRFI
SYL_PSEAB       PVEIGGTEKMSKSKNNGVDPQSMIDQYGADTCRLFMMFASPPDMSLEWSDAGVEGANRFL
SYL_PSEAE       PVEIGGTEKMSKSKNNGVDPQSMIDQYGADTCRLFMMFASPPDMSLEWSDAGVEGANRFL
SYL_PSEA7       PVEIGGTEKMSKSKNNGVDPQSMIDQYGADTCRLFMMFASPPDMSLEWSDAGVEGANRFL
SYL_PSEU5       PVEIGGTEKMSKSKNNGVDPQAMIDAYGADTCRLFMMFASPPDMSLEWSDSGVEGASRFL
SYL_PSEMY       PVEIGGTEKMSKSKNNGVDPQDMIDAYGADTCRLFMMFASPPDMSCEWSDAGVEGANRFL
SYL_PSEP1       PVEIGGTEKMSKSKNNGVDPQSMIEAYGADTCRLFMMFASPPDMSLEWSDSGVEGASRFL
SYL_PSEPK       PVEIGGTEKMSKSKNNGVDPQSMIEAYGADTCRLFMMFASPPDMSLEWSDSGVEGASRFL
SYL_PSEPG       PVEIGGTEKMSKSKNNGVDPQSMIEAYGADTCRLFMMFASPPDMSLEWSDSGVEGASRFL
SYL_PSEE4       PVEIGGTEKMSKSKNNGVDPQSMIEQYGADTCRLFMMFASPPDMSLEWSDSGVEGASRFL
SYL_PSEU2       PVEIGGTEKMSKSKKNGIDPQTMIDQYGADTCRLFMMFASPPDMSLEWSDSGVEGSHRFL
SYL_PSE14       PVEIGGTEKMSKSKKNGIDPQTMIDQYGADTCRLFMMFASPPDMSLEWSDSGVEGSHRFL
SYL_PSESM       PVEIGGTEKMSKSKKNGIDPQTMIDQYGADTCRLFMMFASPPDMSLEWSDSGVEGSHRFL
SYL_NEIMB       PVVISGTEKMSKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFL
SYL_NEIMF       PVVISGTEKMSKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFL
SYL_NEIG1       PVVISGTEKMSKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFL
SYL_NEIM0       PVVISGTEKMSKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFL
SYL_NEIMA       PVVISGTEKMSKSKNNGVDPQELINAYGADTARLFMMFAAPPEQSLEWSDSGVEGAHRFL
SYL_CHRVO       PVVVGGIEKMSKSKNNGVDPQEFIEKYGADTARLFMMFAAPPEQSLEWSDAGVEGAFRFL
SYL_THIDA       PVVVGGTEKMSKSKNNGVDPQALIDQYGADTARLFTMFAAPPEQSLEWSDAGVEGAHRFL
SYL_DECAR       PVVIGGTEKMSKSKNNGVDPQALIDQYGADTARLFIMFASPPDQSLEWSDAGVEGAYRFL
SYL_AZOSB       PVVIGGTEKMSKSKNNGVDPQALVDQYGADTARLFIIFAAPPDQQLEWSDSGVEGASRFL
SYL_CUPMC       PVVIGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFL
SYL_CUPPJ       PVVIGGVEKMSKSKNNGIDPQALIDQHGADTARLFVMFAAPPEQQLEWSGSGVEGASRFL
SYL_RALSO       PVVIGGVEKMSKSKNNGIDPQALIDQYGADTARLFTMFAAPPEQQLEWSDAGVEGASRFL
SYL_JANMA       AVEIGGTEKMSKSKNNGIDPQAQIDQYGADTARLFTMFASPPEQTLEWSGAGVEGANRFL
SYL_HERAR       PVEIGGTEKMSKSKNNGIDPQAQIDQYGADTARLFTMFASPPEQTLEWSGAGVEGANRFL
SYL_BURCH       PVVLGGIEKMSKSKNNGVDPQLLIDQYGADTARLFTMFAAPPEQQLEWSGAGVEGASRFL
SYL_BURCA       PVVLGGIEKMSKSKNNGVDPQLLIDQYGADTARLFTMFAAPPEQQLEWSGAGVEGASRFL
SYL_BURL3       PVVLGGIEKMSKSKNNGVDPQLLIDQYGADTARLFTMFAAPPEQQLEWSGAGVEGASRFL
SYL_BURCM       PVVLGGIEKMSKSKNNGVDPQVLIDQYGADTARLFTMFAAPPEQQLEWSGAGVEGASRFL
SYL_BURVG       PVVLGGIEKMSKSKNNGVDPQVLIDQYGADTARLFTMFAAPPEQQLEWSGAGVEGASRFL
SYL_BURP0       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURPS       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURP6       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURP1       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURM7       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURM9       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURMA       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURMS       PVELGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_BURTA       PVVLGGIEKMSKSKNNGVDPQMLIDHYGADTARLFTMFAAPPEQQLEWSGAGVDGASRFL
SYL_PARXL       PVVLGGVEKMSKSKNNGVDPQLLIDQHGADTARLFVMFAAPPEQSLEWSGSGVEGASRFL
SYL_POLAQ       PVIIGGVEKMSKSKNNGVDPQALIDQYGADTARLFVMFAAPPEQQLEWSGAGVDGASRFL
SYL_BORBR       EVNYGGVGTMSKSKNNGVDPQSLIDTLGADTARLFVMFASPPEQTLEWSDSGVEGANRFL
SYL_BORPA       EVNYGGVGTMSKSKNNGVDPQSLIDTLGADTARLFVMFASPPEQTLEWSDSGVEGANRFL
SYL_BORPE       EVNYGGVGTMSKSKNNGVDPQSLIDTLGADTARLFVMFASPPEQTLEWSDSGVEGANRFL
SYL_BORPD       DVNYGGVGTMSKSKNNGVDPQALIDTLGADTARLFVMFASPPEQTLEWSDSGVEGANRFL
SYL_BORA1       EITYGGVGTMSKSKNNGVDPQSLIDTLGADTARLFVMFASPPEQTLEWSDSGVDGANRFL
SYL_METPP       PVQLGGIEKMSKSKNNVVEPRDIIAKFGADTARLFTMFAGPPDQSAAWSDSGAEGSFRYL
SYL_ACISJ       PIDYEGVGTMSKSKNNGVDPQQLIEKYGADTARLYTMFTAPPELTLEWNDAAVEGSYRFL
SYL_ACIAC       PIDYEGVGTMSKSKNNGVDPQELIEKYGADTARLYTMFTAPPEATLEWNDAAVEGSYRFL
SYL_RHOFT       LVDYEGIGTMSKSKNNGVDPQDLIERYGADTARLYTMFTAPPEATLEWNDAAVEGSYRFL
SYL_VEREI       AIDYEGMGTMSKSRNNGVDPQELIGKYGADTARLHTMFTAPPEAALEWNDAAVEGSHRFL
SYL_POLNA       AIDYEGVGTMSKSKNNGVDPQDIIEKYGADTARLYTMFTAPPEATLEWNDAGVEGSYRFL
SYL_POLSJ       LVNYEGVGTMSKSKNNGVDPQDLIERYGADTARLYTMFTAPPEATLEWNDAAVEGSYRFL
SYL_METCA       PVTVGHIEKMSKSKNNGVDPEALIDRYGADTVRLFTMFAAPPDQSLEWSDSGVEGAFRFL
SYL_DICNV       PVQYGGMEKMSKSKNNGVDPQALIKTYGADTARLYTMFTAPPEASLEWSESGVEGAYRFL
SYL_PSYCK       PVTIGKIEKMSKSKNNGVDPQITIDKYGADTVRLYTLFTAPADQTLEWSDDALKGPYNFV
SYL_PSYA2       PVTIGKIEKMSKSKNNGVDPQITIDKYGADTVRLYTLFTAPADQTLEWSDDALKGPYNFV
SYL_PSYWF       PVTIGKIEKMSKSKNNGVDPQTTIDQYGADTVRLYTLFAAPADQTLEWSDDSLKGPYNFL
SYL_ACIAD       DVVIGGQEKMSKSKNNGIDPQAIIDQYGADTARVFMMFAAPPDQSLEWSDAGVEGANRFL
SYL_NITEU       PVESGGIGTMSKSKNNGIDPQEIIEQYGADTARLFMMFASPPTQTLEWSDAGVEGAFRFL
SYL_NITEC       PVESGGIGTMSKSKNNGIDPQEIIEQYGADTARLFMMFASPPTQTLEWSDAGVEGAFRFL
SYL_NITMU       PVEAGGIGTMSKSRNNGVDPQKLVEQYGADTARLFMMFASPPEQTLEWADAGVEGAFRFL
SYL_METFK       --------KMSKSKGNTVDPQELIDNYGADTARLFMMFAAPPEQSLEWSDAGVEGAHRFL
SYL_HYDCU       EVQYGGIIKMSKSKNNGIDPQTLIDQYGADTLRLYIMFASPPEQTLEWSDSAVEGAHRFL
SYL_XYLFA       PVLIGATEKMSKSKNNGVDPQIMVTKYGADTVRLFSMFAAPPEQSLEWNEAGVEGMARFL
SYL_XYLFT       PVLIGATEKMSKSKNNGVDPQIMVTKYGADTVRLFSMFAAPPEQSLEWNETGVEGMARFL
SYL_XANC8       PVHIGGTEKMSKSKNNGVDPQAMVAKYGADTVRLFSMFAAPPEQSLEWNEAGVDGMARFM
SYL_XANCP       PVHIGGTEKMSKSKNNGVDPQAMVAKYGADTVRLFSMFAAPPEQSLEWNEAGVDGMARFM
SYL_XANCB       PVHIGGTEKMSKSKNNGVDPQAMVAKYGADTVRLFSMFAAPPEQSLEWNEAGVDGMARFM
SYL_XANC5       PVHIGGTEKMSKSKNNGVDPQSMVAKYGADTVRLFSMFAAPPEQSLEWNEAGVDGMARFM
SYL_XANAC       PVQIGGTEKMSKSKNNGVDPQSMVAKYGADTVRLFSMFAAPPEQSLEWNEAGVDGMARFM
SYL_XANOR       PVHIGGTEKMSKSKNNGVDPQSMVAKYGADTVRLFSMFAAPPEQSLEWNEAGVDGMARFM
SYL_XANOM       PVHIGGTEKMSKSKNNGVDPQSMVAKYGADTVRLFSMFAAPPEQSLEWNEAGVDGMARFM
SYL_NITOC       -------AKMSKSKGNTVDPQALIEHYGADTARLFIMFAAPPEQSLEWSESGVEGAHRFL
SYL_ALKEH       PVVMGAIEKMSKSKNNGVDPQALIDRYGADTVRLYTMFAAPPDQSLEWSDSAVEGAYRFL
SYL_HALHL       -------TKMSKSKGNTVDPQELVDRFGADTVRLFTMFAAPPDQSLEWSDSGVEGAYRFL
SYL_CHRSD       PVEMGGIEKMSKSKNNGVDPQAMIDRFGADTVRLFMMFAAPPEQSLEWSDSGVEGAHRFL
SYL_BUCAI       KLIYAGMIKMSKSKNNGIEPELIIQRYGADTIRLFIMFSAPVESDLEWKESGLKGIYRFL
SYL_BUCAP       KVIYAGMIKMSKSKNNGIEPELMINRYGADTLRLFIMFAAPIESSLEWRESGVKGIYRFL
SYL_BUCCC       KIIYAGKIKMSKSKNNGIDPVNIIKQYGADSLRLFIMFAAPINISLEWNSKNIIGMHRFL
SYL_BUCBP       KIFHAGMIKMSKSKFNGIEPEDIIKKYGTDTIRLFIMFAAPVESALEWKESGVKGIHKFL
SYL_WIGBR       KLTHIGMSKMSKSKNNGVDPQGIINKYGSDTLRLFIMFAAPPELSLEWSDKGIIGANRFI
SYL_BLOPB       DLIYDGMCKMSKSKNNGIDPNIIIEKYGADAVRFFIMFAAPIEAPLEWKESGIEGAQRFL
SYL_BLOFL       NVIYAGLCKMSKSKNNGIDPNAMIQKYGADAVRFFIMFAAPAHSTLEWKESGIEGALRFL
SYL_BAUCH       HLVYAGTIKMSKSKNNSIDPLTMVEKYGADTIRLFIMFASPVTMALEWRESGVEGANRFL
SYL_COXBU       -------AKMSKSKGNVVTPQSLIKKYGADTVRLFIIFAAPPEQDLEWSDSGVEGAYRFL
SYL_COXBR       -------AKMSKSKGNVVTPQSLIKKYGADTVRLFIIFAAPPEQDLEWSDSGVEGAYRFL
SYL_COXBN       -------AKMSKSKGNVVTPQSLIKKYGADTVRLFIIFAAPPEQDLEWSDSGVEGAYRFL
SYL_LEGPH       -------HKMSKSLGNVVDPNHLINTYGADTARLFVMFASPPEQSLEWSDSGVEGAHRFL
SYL_LEGPC       -------HKMSKSLGNVVDPNHLINTYGADTARLFVMFASPPEQSLEWSDSGVEGAHRFL
SYL_LEGPA       -------HKMSKSLGNVVDPNHLINTYGADTARLFVMFASPPEQSLEWSDSGVEGAHRFL
SYL_LEGPL       -------HKMSKSLGNVVDPNHLINTYGADTARLFVMFASPPEQSLEWSDSGVEGAHRFL
SYL_FRATT       -------AKMSKSKGNIVDPQELIDKYGADTVRLFSMFAAPPEQSLEWSETGVEGANKFL
SYL_FRAT1       -------AKMSKSKGNIVDPQELIDKYGADTVRLFSMFAAPPEQSLEWSETGVEGANKFL
SYL_FRATW       -------AKMSKSKGNIVDPQELIDKYGADTVRLFSMFAAPPEQSLEWSETGVEGANKFL
SYL_FRATF       -------AKMSKSKGNIVDPQELIDKYGADTVRLFSMFAASPEQSLEWSETGVEGANKFL
SYL_FRATH       -------AKMSKSKGNIVDPQELIDKYGADTVRLFSMFAASPEQSLEWSETGVEGANKFL
SYL_FRATO       -------AKMSKSKGNIVDPQELIDKYGADTVRLFSMFAASPEQSLEWSETGVEGANKFL
SYL_FRATN       -------AKMSKSKGNTVDPQELIDRYGADTVRLFSMFAAPPEQSLEWSETGVEGANKFL
SYL_FRAP2       -------AKMSKSKGNTVDPQELIDKYGADTVRLFSMFAAPPEQSLEWSDTGVDGANKFL
SYL_RUTMC       -------AKMSKSKGNTVDPAQMIEKYGADTVRLFILFAAPPTQNLEWSDSGLEGVHRFI
SYL_VESOH       -------VKMSKSKGNTVDPTKMIKKYGADTVRLFILFAAPPMQDLEWNNSGLEGAHRFI
SYL_RICRS       RVVQGRIEKMSKSKKNLIDLETMQEQYGADAIRLFVLSDSPPEKDLEWSASGIEGCSRFI
SYL_RICRO       RVVQGRIEKMSKSKKNLIDLETMQEQYGADAIRLFVLSDSPPEKDLEWSASGIEGCSRFI
SYL_RICCN       RVVQGRIEKMSKSKKNLIDLETMQEQYGADAIRLFVLSDSPPEKDLEWSASGIEGCSRFI
SYL_RICM5       RVVQGRIEKMSKSKKNLIDLETMQEQYGADAIRLFVLSDSPPEKDLEWSASGIEGCSRFI
SYL_RICFE       RVVQGRIEKMSKSKKNLIDLVTMQEQYGADAIRLFVLSDSPPEKDLEWSASGIEGCSRFI
SYL_RICAH       RVVQGRIEKMSKSKKNLIDLETMQKQYGADAIRLFVLSDSPPEKDLEWFVSGIEGCSRFI
SYL_RICCK       LVVQGRIEKMSKSKKNLIDLETMQKQYGADAIRLFVLSDSPPEKDLEWSVSGLEGCSRFI
SYL_RICBR       LVTQGRIEKMSKSKKNLIDLETMQQQYGADAIRFFVLSDSPPEKDLEWSASGIEGSARFI
SYL_RICPR       RVVQGRIEKMSKSKKNIIDLETIREQYSADAIRLFVLSDSPPEKDLEWSASGIEGCSRFI
SYL_RICTY       RVVQGRIEKMSKSKKNIIDLETIQEQYSADAIRLFVLSDSPPEKDLQWSASGIEGCSRFI
SYL_ORITB       YVTVGKLEKMSKSKKNVVDLELVLKLYGADVARMFVLSDTPPEKDLEWSTEGIEGCYKFI
SYL_WOLPM       KVQVGKVEKMSKSKKNTVDPNFIIEKYGADTARLFVLSDTPPEKDMEWSDDGVEGCSRYV
SYL_WOLTR       KIQVGKVEKMSKSKKNTVDPNFIIEKYGADTARLFVLSDTPPEKDMEWSNDGVEGCSRYI
SYL_EHRRW       YVTVGRAEKMSKSKKNVVHLDDIIDKYGADSARLFILSDTPPERDIEWLDENIEGVSRYL
SYL_EHRRG       YVTVGRAEKMSKSKKNVVHLDDIIDKYGADSARLFILSDTPPERDIEWLDENIEGVSRYL
SYL_EHRCJ       HVNVGRAEKMSKSKKNVVNLEYIIDKYGADTARLFILSDTPPDRDIEWLDDGIEGASKYL
SYL_EHRCR       HVTVGRAEKMSKSKKNVVNLEYIIDKYGADTARLFILSDTPPERDIEWLDDGIEGASRYL
SYL_ANAMM       AVQRGKVEKMSKSKKNVVDPSHIIKKYGADTVRLFMLSDTPPERDIEWSDVGVEGAWRYL
SYL_NEOSM       KVLVGKIEKMSKSKKNVVDLEEIVSKYGADAARFFILSDNPPENSFGWSDRGINASFKFL
SYL2_RHIL3      EVSIGSIEKMSKSKKNVVDPDDIIASYGADTARFFVLSDSPPERDVIWSEAGVEGAHRFT
SYL_RHIEC       EVAIGSIEKMSKSKKNVVDPDDIIASYGADTARFFVLSDSPPERDVIWSEAGVEGAHRFT
SYL_RHIME       EVAIGSIEKMSKSKKNVVDPDDIIGSYGADTARFFVLSDSPPDRDVIWSEAGVEGAHRFV
SYL_SINMW       EIAIGSIEKMSKSKKNVVDPDDIIASYGADTARFFVLSDSPPDRDVIWSEAGVEGAHRFV
SYL_AGRFC       EVKIGSIEKMSKSKKNVVDPDDIIASYGADTARFFVLSDSPPDRDVIWSEAGVEGANRFV
SYL_BRUAB       PVEIGSIEKMSKSKKNVVDPDDIIASYGADTARWFVLSDSPPERDVIWTEAGAEGAHRFV
SYL_BRUA2       PVEIGSIEKMSKSKKNVVDPDDIIASYGADTARWFVLSDSPPERDVIWTEAGAEGAHRFV
SYL_BRUSI       PVEIGSIEKMSKSKKNVVDPDDIIASYGADTARWFVLSDSPPERDVIWTEAGAEGAHRFV
SYL_BRUO2       PVEIGSIEKMSKSKKNVVDPDDIIASYGADTARWFVLSDSPPERDVIWTEAGAEGAHRFV
SYL_BRUME       PVEIGSIEKMSKSKKNVVDPDDIIASYGADTARWFVLSDSPPERDVIWTEAGAEGAHRFV
SYL_BRUSU       PVEIGSIEKMSKSKKNVVDPDDIIASYGADIARWFVLSDSPPERDVIWTEAGAEGAHRFV
SYL_BRUC2       PVEIGSIEKMSKSKKNVVDPDDIIASYGADIARWFVLSDSPPERDVIWTEAGAEGAHRFV
SYL_OCHA4       PVEIGSIEKMSKSKKNVVDPDDIIASYGADTARWFMLSDSPPERDVIWTEAGAEGAHRFV
SYL_CHESB       EVAIGPLEKMSKSKKNTVSPEDITESFGADTARWFMLSDSPPERDVEWTDDGAAGAHRFV
SYL_RHILO       EAAIGSLEKMSKSKKNTVSPEDITDGYGADTARWLMLSDSPPEGDVEWTDDGAAGAHRFM
SYL_BART1       EVTIGLIEKMSKSKKNVVDPDDIIASYGADTVRWFVLSDSPPERDVIWTESGVEGAHRFV
SYL_BARHE       EVTIGSIEKMSKSKKNVVDPDDIIASYGADTVRWFILSDSPPERDVIWTESGVEGAHRFV
SYL_BARQU       EVTIGLIEKMSKSKKNVVDPDDIIASYGADTVRWFVLSDSPPERDVIWTESGVEGAYRFV
SYL_BARBK       EVTIGSIEKMSKSKKNVVDPDDIISSYGADTARWFMLSDSPPERDVIWSESGIEGAHRFV
SYL_RHOP2       PVEIGPIEKMSKSKRNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFV
SYL_RHOPS       PIEIGPIEKMSKSKRNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFV
SYL_RHOPA       PVEIGPIEKMSKSKRNTVDPDDIIGTYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFV
SYL_RHOP5       ELEIGPIEKMSKSKRNTVDPDDIIGTYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFV
SYL_NITHX       PVEIGAVEKMSKSKRNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVQGASRFM
SYL_NITWN       PVEIGAVEKMSKSKRNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVQGAARFM
SYL_BRASB       DITIGPIEKMSKSKKNTVDPDDIIESYGADVARWFMLSDSPPDRDVIWSDERVQGAARFV
SYL_BRASO       DITIGPIEKMSKSKKNTVDPDDIIESYGADVARWFMLSDSPPDRDVIWSDERVQGAARFV
SYL_BRADU       DIQIGAIEKMSKSKKNTVDPDDIIETYGADVARWFMLSDSPPDRDVIWSDERVQGASRFV
SYL_RHOPB       PVEIGPIEKMSKSKRNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEDGVKGASRFV
SYL_AZOC5       PVTVGPPEKMSKSKKNVVPPEVVVDTYGVDAGRWFMLSDTPPERDSEWTQSGIEGAWRFV
SYL_PARL1       PVIIGSVEKMSKSKKNTVDPEDIIAKYGADTARWFMLSDSPPERDVQWTDQGAEGAWRFT
SYL_CAUVC       PIIIGDIEKMSKSKKNVVAPEDIFEAYGVDSARLFVMSDSPPERDVQWTNSGVEGSWRFT
SYL_CAUSK       PITIGDIEKMSKSKKNVVAPEDIFEAYGVDAARLFVMSDSPPERDVQWTNSGVEGSWRFT
SYL_MARMM       PVSVGAIEKMSKSKKNVVDLDAFIESYGADAVRWFVLSDSPPERDVEYTDSGVEGVWRFV
SYL_HYPNA       PVKVGAIEKMSKSKKNTVDPDAIVATYGADVARWFVLSDSPPERDVEWTQSGAEGAARFV
SYL_RUEST       RIKVIPSAKMSKSKNNVVDPLAIISTYGADTARWFVLSDSPPERDVEWTASGAEAAYKHL
SYL_RUEPO       EVEIIPSAKMSKSKNNVVDPVAIIDRFGADTARWFVLSDSPPERDVEWTDAGAEAAHKHL
SYL_ROSDO       EVEIIPSAKMSKSKKNVVDPLGIIASYGADTARWFVLSDSPPERDVEWTASGAEAAFKHL
SYL_JANSC       AVEIIPSAKMSKSKNNVVDPIEIIKQYGADTARWFVLSDSPPERDVEWTASGAEAAYKHL
SYL_DINSH       PVDIVPSAKMSKSKNNVVDPLAIIDAYGADTARWFVMSDSPPERDVEWTASGAEAAFKHL
SYL_RHOS1       PVEIIPSAKMSKSKKNVVDPMNIIRQFGADTARWFVMSDSPPERDVEWTASGAEAASKHL
SYL_RHOS4       PVEIIPSAKMSKSKKNVVDPMNIIRQFGADTARWFVMSDSPPERDVEWTASGAEAASKHL
SYL_RHOS5       KLKVIPSTKMSKSKKNVVDPMNIISQFGADTARWFVMSDSPPERDVEWTASGAEAAFKHL
SYL_PARDP       PVEVIPSAKMSKSKKNVVDPVNIVEGFGADTARWFMLSDSPPERDVEWTAAGAEAANRFL
SYL_ZYMMO       KVTVGRVEKMSKSKKNVVEPAPILDQYGADAVRWFMLSDSPPERDLAWTEAGIEGCWRFM
SYL_SPHWW       PATVGRIEKMSKSKKNVVDPAPIVEQYGADAVRWFMLSDSPPERDLEWTESGIEGCWRFV
SYL_NOVAD       PVEIGRVIKMSKSKKNVVDPDEIVAKYGADAIRWFMLSDSPPERDLPWSEAGIEGCARFV
SYL_SPHAL       PVEVGRVIKMSKSKKNVVDPDAILDQYGADAVRWFMLSDSPPERDLPWSEAGIEGAWRFV
SYL_GRABC       PVQVGRGEKMSKSKRNTVAPGEIFNRYGADAARWFILSDNPPERDMEWTDAGAVGAYRFV
SYL_GLUOX       PVQVGRSEKMSKSKRNTVSPVDIIERYGADTARWFVLSDSPPERDMEWTAAGVAAAARFG
SYL_ACICJ       KVIVGPIEKMSKSKRNTVDPSAVIARFGADTARWFVLSDNPPERDVEWTEAGAQGAFRYV
SYL_MAGSA       PVTGGRSEKMSKSKKNVVDPAGIIDGYGADTARLFMLSDSPPERDLDWTEAGIDGAWRYV
SYL_RHORT       PVSVGRSEKMSKSKMNTVDPTAILESYGADAARLFMLSDSPPDRDMDWTDSGIEGAWRYI
SYL_MAGMM       AVTVGRNEKMSKSKHNVVDPNDLIAGYGADTARLFMLFAAPADRDLEWNDSGVDGAWRFL
SYL_CAMJ8       -------AKMSKSKGNVVDPDEIIEKYGADTARLFILFAAPPAKELEWNDDAVEGAYRFI
SYL_CAMJJ       -------AKMSKSKGNVVDPDEIIEKYGADTARLFILFAAPPAKELEWNDDAVEGAYRFI
SYL_CAMJR       -------AKMSKSKGNVVDPDEIIEKYGADTARLFILFAAPPAKELEWNDDAVEGAYRFI
SYL_CAMJE       -------AKMSKSKGNVVDPDEIIEKYGADTARLFILFAAPPAKELEWNDDAVEGAYRFI
SYL_CAMJD       -------AKMSKSKGNVVDPDEIIEKYGADTARLFMLFAAPPAKELEWNDDAVEGAYRFI
SYL_CAMC1       -------KKMSKSKGNVVDPDDIINRYGADTARLFILFAAPPQKELEWNDSAVEGAFRFL
SYL_CAMC5       -------KKMSKSKGNVVDPDDIINRYGADTARLFILFAAPPQKELEWNDSAVEGAYRFL
SYL_CAMFF       -------SKMSKSKGNTVDPDDIINKFGADTARLFILFAAPPQKELEWNDSAVEGAFKFI
SYL_CAMHC       -------AKMSKSKGNVVDPDEIIEKYGADTARLFILFAAPPQKELEWNDSAVEGAYKFL
SYL_ARCB4       -------AKMSKSKGNVVDPDLIIDKYGADTARLFILFAAPPTKELEWNDSAVEGAFRFI
SYL_NITSB       -------AKMSKSKGNTVDPDEIVAKFGADTARLFILFAAPPAKELEWSDSAVEGAYRFI
SYL_WOLSU       -------AKMSKSKGNVVDPDELIERFGADTARLFVLFAAPPTRELEWNDSAVEGAYRFI
SYL_HELHP       -------AKMSKSKGNIVNPNELIAHYGADTARLFVLFAAPPTRELEWNDKAVEGAHRFL
SYL_HELPY       -------AKMSKSKGNVVSPKEILKKYGADAARLFILFAAPPAKELEWNDSALEGAHRFI
SYL_HELPH       -------AKMSKSKGNVVSPKEILKKYGADAARLFILFAAPPAKELEWNDSALEGAHRFI
SYL_HELPJ       -------AKMSKSKGNVVSPKEILKKYGADAVRLFILFAAPPAKELEWNDNALEGAHRFI
SYL_HELAH       -------VKMSKSKGNVVSPKEILKKYGADAARLFILFAAPPAKELEWNDSALEGAHRFI
SYL_THEMA       --------KMSKSKGNVVSPDEMIEKYGADTLRMYILFMAPPEKDAEWSDAGIEGVHRFV
SYL_THEP1       --------KMSKSKGNVVSPDEMIEKYGADTLRMYILFMAPPEKDAEWSDAGIEGVHRFI
SYL_THEM4       --------KMSKSKGNVVSPDEMIEKYGADTLRTYILFMAPPEKDAEWSDAGIEGVNRFL
SYL_FERNB       --------KMSKSKGNVVSPDDMINKYGADTLRMYILFMAPPEKDAEWNDAGIDGVNRFI
SYL_PSELT       --------KMSKSKGNVVSPDEMIDRYGADTLRMYILFMGPPERDAEWNDAGIEGVYRFI
SYL_CALS8       --------KMSKSLGNIVSPEEIVEKYGADTARLFILFAAPPERDLEWSDQGVEGCFRFL
SYL_HUNT2       --------KMSKSLGNVVSPEEIIEKYGADTARLFILFASPPEKDLEWSDQGVEGCYRFI
SYL_DESHY       --------KMSKSKGNVVSPEEIISKYGADTARLFILFAAPPERDLEWNDQGVEGCYRFL
SYL_SYNWW       --------KMSKSKGNVVSPEEIIDTYGADTARLFILFASPPERDLEWSEQGVEGAFRFL
SYL_CARHZ       --------KMSKSKGNVVSPEEIVEKYGADTARLFILFAAPPERDLEWSDQGVEGSFRFL
SYL_PELTS       --------KMSKSRGNVVSPEDIVARYGADTARLFILFAAPPERDLEWSDQGVEGCYRFL
SYL_MOOTA       --------KMSKSKGNIVSPEEIINRYGADTARLFILFAAPPERDLEWSDQGVEGCYRFL
SYL_DESRM       --------KMSKSKGNVVSPEEIIDRYGADTARMFILFAAPPERDLEWSDRGVEGSHRFL
SYL_SYMTH       --------KMSKSKGNTVSPEEMIAKYGADAVRLFIMFAAPPERDLDWSDAGIEGAARFV
SYL_DESVH       --------KMSKSKGNVVDPTEMIARYGADTVRLFCLFAAPPERDFDWSESGIEGSYRFV
SYL_DESVV       --------KMSKSKGNVVDPTEMIARYGADTVRLFCLFAAPPERDFDWSESGIEGSYRFV
SYL_DESAG       --------KMSKSKGNVVDPTEMISRYGADTVRLFCLFAAPPERDFDWSDSGIEGASRFV
SYL_LAWIP       --------KMSKSKGNIVDPNQMINIYGADTIRLFCLFAAPPERDFDWSDSGIEGSYRFL
SYL_GEOMG       --------KMSKSKGNVVDPDALINRYGADTARLFSLFAAPPEKDLDWSDQGVDGSYRFL
SYL_GEOSL       --------KMSKSKGNVVDPDALIERYGADTARLFTLFAAPPEKDLDWSDQGVEGSFRFL
SYL_GEOUR       --------KMSKSKGNVVDPNALIDKYGADTARLFSLFAAPPEKDLDWSDQGVDGSFRFL
SYL_PELPD       --------KMSKSKGNVVDPNALIERYGADTARLFSLFAAPPEKDLDWNDQGVDGSFRFL
SYL_PELCD       --------KMSKSKKNVVDPDKLILSYGADTARLFSLFAAPPEKDLEWNEQGVEGCYRFL
SYL_SYNAS       --------KMSKSLKNVVDPDYLVRQYGADTARMFCLFAAPPEKDLEWSDQGVEGSFRFI
SYL_SYNFM       --------KMSKSKGNVVDPDDMIKAYGADTVRLFCLFASPPEKDLEWSDQGVEGSFRFL
SYL_DESPS       --------KMSKSKGNVVDPHDLISEFGADTTRLFSLFAAPPERDLEWSSEGVEGSSRFL
SYL_FUSNN       EELQVKVEKMSKSKNNGVDPEEMLDKYGADTTRLFIMFAAPPEKELEWNENGLAGAYRFL
SYL_TRIV2       EPLQRLYATMSKSKGNGVAPEDVIAKYGVDTARMFILFKAPPEKDLEWDEADVEGQFRFL
SYL_NOSS1       EPLQRLYATMSKSKGNGVAPEDVIAKYGVDTARMFILFKAPPEKDLEWDEADVEGQFRFL
SYL_ACAM1       APLEAFYEKMSKSKYNGVPPEEVTNKYGADTARLFTLFKAPPEKDLEWEGADVEGQFRFL
SYL_TRIEI       DKLEVFFEKMSKSKYNGVDPMDVMATYGADTARMFILFKAPPEKDLEWDDADVQGQFRFL
SYL_SYNY3       EPLQVFYEKMSKSKFNGVDPQEVLAKYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNE7       DRLEVFFEKMSKSKYNGVDPARVLDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNP6       DRLEVFFEKMSKSKYNGVDPARVLDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_THEEB       EALEVVYEKMSKSKYNGVAPGDVIQQYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNJB       EPLEVIYATMSKSKGNGVDPEEVLAHYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNJA       EPLQVIYATMSKSKGNGVDPEEVLANYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_GLOVI       TPLVCAMEKMSKSKYNGIDPLTVRSEYGADTARLFVLFKAPPEKELEWSDADVRGQYSFL
SYL_SYNS3       GPLEVLFEKMSKSKHNGVDPAAVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNPW       GELEVLFEKMSKSKYNGVDPAAVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_PROMM       DRLEVLFEKMSKSKYNGVDPAVVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_PROM3       DKLEILFEKMSKSKYNGVDPAVVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNSC       DKLEVLFEKMSKSKYNGVDPAAVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNS9       DKLEVLFEKMSKSKYNGVDPAAVIDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_SYNPX       EPLEVLFEKMSKSKYNGVDPAAVIDRYGADTARMFILFKAPPEKDLEWDDSDVEGQFRFL
SYL_SYNR3       EALEVFFEKMSKSKYNGVDPGAVVDRYGADTARMFILFKAPPEKDLEWDDADVEGQFRFL
SYL_PROMT       ENIEIIYEKMSKSKYNGVDPSVVIDKYGADTARMFILFKAPPEKDLEWDDSDVEGQYRFI
SYL_PROM1       ENIEIIYEKMSKSKYNGVDPSVVIDKYGADTARMFILFKAPPEKDLEWDDSDVEGQYRFI
SYL_PROMA       EPLDVLYEKMSKSKYNGVDPASVIDKYGTDTARMFILFKAPPEKDLEWDESDVEGQYRFL
SYL_PROM0       TKLEILFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFL
SYL_PROM9       SKLEVLFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQFRFL
SYL_PROMS       SKLEVLFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFL
SYL_PROM2       TKLEVLFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDTDVEGQFRFL
SYL_PROMP       SKLEVLFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQYRFL
SYL_PROM5       SKLEVLFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAPPEKDLEWGDSDVEGQYRFL
SYL_SOLUE       -------AKMSKSKGNVVGADLLADKFGADTARMFVLSNVPPEKEVDWREEGAEGTYRFL
SYL_DEIRA       -------EKMSKSRGNVVDPDDLVREYGADTVRAFLMFIAPWELGGPWDPQGINGPSKWL
SYL_DEIGD       -------EKMSKSRGNVVDPDDLVREYGADTVRTYLMFIAPWELGGPWDPSGINGPAKWL
SYL_RUBXD       -------NRMSKSRGNVVNPQEYVDRYGSDVLRCYLMFIGPWDEGGPWDPGGIEGVARWL
SYL_CLOPE       -------LKMSKSKGNTISPDDYIKEYGADVFRMYLMFGFAYTEGGAWSDDGIKSVNRFV
SYL_CLOPS       -------LKMSKSKGNTISPDDYIKEYGADVFRMYLMFGFAYTEGGAWSDDGIKSVNRFV
SYL_CLOP1       -------LKMSKSKGNTISPDDYIKEYGADVFRMYLMFGFAYTEGGAWSDDGIKSVNRFV
SYL_CLOB8       -------LKMSKSKGNTISPDDYIKEYGADVFRMYLMFGFGYTEGGAWSDDGIKSVGKFV
SYL_CLOB1       -------LKMSKSKGNTISPDDYIKEFGADVFRMYLMFGFDYTEGGAWSDDAIKSIGKFV
SYL_CLOBH       -------LKMSKSKGNTISPDDYIKEFGADVFRMYLMFGFDYTEGGAWSDDAIKSIGKFV
SYL_CLOBL       -------LKMSKSKGNTISPDDYIKEFGADVFRMYLMFGFDYTEGGAWSDDAIKSIGKFV
SYL_CLONN       -------LKMSKSKGNTIAPDDYIKEYGADVFRMYLMFGFAYSEGGAWSDDAIKSMSKFV
SYL_CLOAB       -------QKMSKSKGNTISPDDIIAEHGSDVFRMYLMFGFDYAEGGAWSDDGVKAMSKFV
SYL_CLOK5       -------QKMSKSKGNTISPDDCIQKYGSDVFRMYLMFGFDYAEGGAWNDDGIKSMSKFV
SYL_CLOTE       -------LKMSKSKGNTISPDDYIDEFGSDVFRMYLMFGFDYTEGGAWSDEGIKSVSRFV
SYL_CALS4       -------SRMSKSRGNVISPDDYIKQYGSDVFRLYLMFGFSYSEGGPWSDEGIKAIARFV
SYL_ROSCS       FTAVSGPVTMSKSAGNGIPVGPFVRQYGSDVARIVVLFAAPPENSMEWTDEGVAGAQRFL
SYL_ROSS1       LTAVSGPVTMSKSAGNGIPVGPFVRQYGSDVARIVVLFAAPPENSMEWTDEGVAGAQRFL
SYL_THEFY       -------KAMSKSLGNGVDLGQEIDRYGVDAVRLTMVFAGPPEEDIDWADVSPGASVKFL
SYL_ACIC1       -------KAMSKSLGNGVDLGEQLATYGVDAVRLTMVFAGPPEEDIDWADMNPGALGKFL
SYL_ARTS2       -------KAMSKSLGNGVDLGEQLDKYGVDAVRLTMIFASPPEDDVDWADVSPSGSAKFL
SYL_PAEAT       -------KAMSKSLGNGVDLGEQLDKFGVDAVRLTMVFASPPEDDVDWADVSPSGSAKFL
SYL_RENSM       -------KAMSKSLGNGVDLSQQLDRFGVDAVRLTMVFASPPEDDVDWADVSPSGSAKFL
SYL_CLAMS       -------SKMSKSKG-GVDLGSEMDRHGVDAIRLTMAFAGPPEDDIDWEDVSPSGSAKFL
SYL_CLAM3       -------SKMSKSKG-GVDLGSEMDRHGVDAIRLTMAFAGPPEDDIDWEDVSPSGSAKFL
SYL_LEIXX       -------SAMSKSRGNLVKLSDQLDAHGVDAVRLTMSFAGPPEDDIDWADVSPSGSAKFL
SYL_KINRD       -------SAMSKSKGNIVRLSDQLEEHGVDAIRLTMAFAGPPEDDIDWADVSPSGSAKFL
SYL_NOCSJ       -------KKMSKSLGNGVSLGDQLAEFGVDAVRVTLVFAGPPEDDIDWADVSPAGALRFL
SYL_TROW8       -------AKMSKSKGNIVEFSKEVSQHGVDVIRFALIFSGPPEEDIDWKDVSMTGAARFL
SYL_TROWT       -------AKMSKSKGNIVEFSKEVSQHGVDVIRFALIFSGPPEEDIDWKDVSMTGAARFL
SYL_MYCPA       IEVFQEFGKIGKSLKNSISPDEICDDYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFL
SYL_MYCA1       IEVFQEFGKIGKSLKNSISPDEICDDYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFL
SYL_MYCLE       IEVFQEFGKIGKSLKNSVSPDEICDEYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFL
SYL_MYCTA       VEVFQEFGKIGKSLKNSVSPDEICDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFL
SYL_MYCBO       VEVFQEFGKIGKSLKNSVSPDEICDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFL
SYL_MYCTU       VEVFQEFGKIGKSLKNSVSPDEICDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFL
SYL_MYCBP       VEVFQEFGKIGKSLKNSVSPDEICDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFL
SYL_MYCUA       IEVFQEFGKIGKSLKNSISPDEICDDYGADTLRVYEMSMGPIEASRPWATKDVIGAHRFL
SYL_MYCSS       -EVFQEFGKIGKSLKNSVSPDEICDNYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFL
SYL_MYCSK       -EVFQEFGKIGKSLKNSVSPDEICDNYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFL
SYL_MYCSJ       -EVFQEFGKIGKSLKNSVSPDEICDNYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFL
SYL_MYCS2       IEVNQEFGKIGKSLKNSVSPDEICDNYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFL
SYL_MYCVP       IEVNQEFGKIGKSLKNSVSPDEICDDYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFL
SYL_MYCGI       TEVNQEFGKIGKSLKNSVSPDEICDNYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFL
SYL_NOCFA       IEVSQEYGKIGKSLKNAISPDEVCDQFGADTFRFYEMSMGPLDTSRPWSTKDVVGAHRFL
SYL_RHOJR       VEVNREYGKMGKSLKNSVSPDEICEEYGADTLRVYEMSMGPLDTSRPWATKDVVGAQRFL
SYL_SACEN       -EVRREYGKMGKSLKNSVSPDEMADAYGADTLRLYEMAMGPLDASRPWATKDVVGSHRFL
SYL_CORGB       EEVNQEYGKMGKSLKNAVAPDDICNNFGADTLRVYEMAMGPLDTSRPWATKDVVGAQRFL
SYL_CORGL       EEVNQEYGKMGKSLKNAVAPDDICNNFGADTLRVYEMAMGPLDTSRPWATKDVVGAQRFL
SYL_COREF       EEVTQEYGKMGKSLKNAVAPDDICNNYGADTLRVYEMSMGPLDTSRPWATKDVVGAQRFL
SYL_CORDI       EEVNQEYGKMGKSLKNAVAPDDICRDFGADTLRVYEMAMGPLDTSRPWSTKDVIGAHRFL
SYL_CORJK       EEVFQEYGKMGKSLKNAVSPDEICDDYGADTLRVYEMAMGPLDTSRPWATKDVVGAQRFL
SYL_STRCO       -KVSRLLGKMGKSLKNAVTPDEICAEYGADTLRLYEMAMGPLDVSRPWDTRAVVGQFRLL
SYL_STRAW       -KVSRLLGKMGKSLKNAVTPDEICAEYGADTLRLYEMAMGPLDVSRPWDTRAVVGQFRLL
SYL_SALAI       -EVSREYGKMGKSLRNVVTPDEMCAAYGADTFRVYEMSMGPLEVSRPWETRAVVGSFRFL
SYL_BIFAA       QHANREFGKMGKSLKNIITPDDMYENYGADTFRLYEMGMGPLAESRPWNTRNVVGSMRFL
SYL_BIFLO       EHANREFGKMGKSLKNIVTPDYMYENYGADTFRLYEMSMGPLDESRPWNTRNVVGGMRFL
SYL_FRACC       -PVNRRSGKMGKSLKNSVSPDEMYDRFGADTLRVYEMAMGPLDADRPWHTDDIVGSHRFL
SYL_FRAAA       -PVDRRSGKMGKSLKNSVSPDEMYERFGADTLRVYEMAMGPLDADRPWHTDDIVGSHRFL
                         :.*:              . *  *              :      .     

SYL_GEOKA       DRVWRLFVTENGE-----LNPNIVDEPA--------------------------------
SYL_GEOTN       ERVWRLFVTEDGQ-----LNPNIVDEPA--------------------------------
SYL_BACCZ       DRVWRLFVQDNGE-----LSEKITDAP---------------------------------
SYL_BACAH       DRVWRLFVQDNGE-----LSEKITDAP---------------------------------
SYL_BACAN       DRVWRLFVQDNGE-----LSEKITDAP---------------------------------
SYL_BACHK       DRVWRLFVQDNGE-----LSEKITDAP---------------------------------
SYL_BACC1       DRVWRLFVQDNGE-----LSEKITDAP---------------------------------
SYL_BACCR       DRVWRLFVQDNGE-----LSEKITDAP---------------------------------
SYL_BACCN       DRVWRLFVQENGE-----LSEKITDAP---------------------------------
SYL_BACSU       DRVWRLFIEDSGE-----LNGKIVEGA---------------------------------
SYL_BACVZ       DRVWRLFIEENGE-----LTGKVTEGA---------------------------------
SYL_BACLD       DRVWRLFIDDNGG-----LNEKIVEGA---------------------------------
SYL_BACP2       DRVWRLFTNEDGT-----ISDKVTEQT---------------------------------
SYL_BACHD       DRVWRLLVDENTEE----KSSKIVNGEG--------------------------------
SYL_BACSK       ERVWRLIVNEETGK----LNSNVKDVEG--------------------------------
SYL_OCEIH       DRVWRLYVGDDGS-----LTDKIIDDE---------------------------------
SYL_STAES       DRVWRLIITDENS-----INKKIVDSN---------------------------------
SYL_STAEQ       DRVWRLIITDENS-----INKKIVDSN---------------------------------
SYL_STAAW       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAS       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAN       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAA1       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAM       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAA9       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAA2       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAA3       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAC       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAA8       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAT       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAE       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAB       DRVWRLIVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAAR       DRVWRLMVNEDGT-----LSSKIVTTN---------------------------------
SYL_STAHJ       DRVWRLFINEDGS-----LSNKIVENN---------------------------------
SYL_STAS1       DRIWRLLITEDGS-----ISNKVVNNH---------------------------------
SYL_LISMF       DRIWRLLVTEEG-----TLAEKVTTDA---------------------------------
SYL_LISMO       DRIWRLLVTEEG-----TLAEKVTTDA---------------------------------
SYL_LISIN       DRIWRLLVTEEG-----TLAEKVTTDA---------------------------------
SYL_LISW6       DRIWRLFVTEEG-----ILAEKVTTTA---------------------------------
SYL_ENTFA       DRVWRLIVDEEG-----KMRDRITTIN---------------------------------
SYL_STRTD       DRVYRLITSKE-----------IVAEN---------------------------------
SYL_STRT2       DRVYRLITSKE-----------IVAEN---------------------------------
SYL_STRT1       DRVYRLITSKE-----------IVAEN---------------------------------
SYL_STRP2       DRVYRLITSKE-----------ILAEN---------------------------------
SYL_STRR6       DRVYRLITSKE-----------ILAEN---------------------------------
SYL_STRPN       DRVYRLITSKE-----------ILAEN---------------------------------
SYL_STRSV       DRVYRLFNSKE-----------LVTEN---------------------------------
SYL_STRGC       DRVYRLLNTKE-----------LVTEN---------------------------------
SYL_STRS2       DRVYRLLTTKE-----------LVAEN---------------------------------
SYL_STRSY       DRVYRLLTTKE-----------LVAEN---------------------------------
SYL_STRPD       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRPG       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRP6       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRPM       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRPF       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRPB       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRPC       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRP3       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRP1       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRP8       DRVYRLVTTKE-----------IVAEN---------------------------------
SYL_STRA3       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRA5       DRVYRLITTKE-----------ITEEN---------------------------------
SYL_STRA1       DRVYRLITTKE-----------ITKEN---------------------------------
SYL_STRMU       DRVYRLITTKE-----------IAAKN---------------------------------
SYL_LACLM       DRAVRMIENSE-----------IKAEN---------------------------------
SYL_LACLA       DRAVRMIENSE-----------IKAEN---------------------------------
SYL_LACLS       DRVVRMIDNSE-----------ISDKN---------------------------------
SYL_LACSS       DRVWRLYTEEDTDE-NDQLSSKIVADN---------------------------------
SYL_LACDA       DRVWRTFVNDLDL--DPIPSEKITDKN---------------------------------
SYL_LACDB       DRVWRTFVNDLDL--DPIPSEKITDKN---------------------------------
SYL_LACP3       DRVWSAFIDD-----EGKLRDRITTIN---------------------------------
SYL_LACPL       ERVWRLMIDENNR-----VRDRITTIN---------------------------------
SYL_LACBA       DRVWRLLIDDNNR-----LRDRVTMIN---------------------------------
SYL_PEDPA       DRVWRLMIDDENQ-----LRDHIVTEN---------------------------------
SYL_LACS1       NRVWNLLIDENDN-----LRDRVTTIN---------------------------------
SYL_LACRD       QRVWRLLMDDNNH-----LRDRVSTFN---------------------------------
SYL_LEUMM       DRVWRLLVDEEDK-----LRDHVTTVN---------------------------------
SYL_OENOB       DRVWRIFTSDGDG-----INPIIVSEN---------------------------------
SYL_SALRD       NRIWRLVVDADSG------GLAVSDEEP--------------------------------
SYL1_RHIL3      ERAWRIVCDESDG-----LSPVVLEAAP--------------------------------
SYL_RHOBA       DRVWRMIIDEPED--ELKVSDAVVDTAC--------------------------------
SYL_PELLD       NRVWRLVHPDTE-----GPAAVLDEAAM--------------------------------
SYL_CHLPM       SRVWRLVWPEPE-----GTRADLSTLAP--------------------------------
SYL_CHLCH       GKVWRFVYPEHS-----EAATQPSNEPL--------------------------------
SYL_CHLTE       NKVWRLVWDENT-----ETQKTTEDKP---------------------------------
SYL_CHLPD       GKVWRLVYPDSENPDQRDQAAVLDENPL--------------------------------
SYL_LEPBL       NRVWRLFHTGEG------ESFRLDEIEP--------------------------------
SYL_LEPBJ       NRVWRLFHTGEG------ESFRLDEIEP--------------------------------
SYL_LEPIC       NRIWRLFHSGSQ------ESFRLDDVEP--------------------------------
SYL_LEPIN       NRIWRLFHSGSQ------ESFRLDDVEP--------------------------------
SYL_BACTN       RKFWSLFYSRTDE-------YLVKDEPA--------------------------------
SYL_BACV8       KKLWNLFYSRTDE-------FLPVEGEP--------------------------------
SYL_BACFR       KKFWSLFYDRNGE-------YLVKDEPA--------------------------------
SYL_BACFN       KKFWSLFYDRNGE-------YLVKDEPA--------------------------------
SYL_PARD8       KKLWGLFFGNTDT-------LQVTDAEP--------------------------------
SYL_PORGI       KKFWALYY-NTDG-------IRVTDTAP--------------------------------
SYL_FLAPJ       KKLWRLYFDDNG--------LIVTNNEP--------------------------------
SYL_FLAJ1       KKLWRLYFDDNG--------LIVNNDEP--------------------------------
SYL_GRAFK       KKLWKLYYDGEE--------FFVSDEKA--------------------------------
SYL_CYTH3       NRFWRLFHDTAGN-------FAVSDAQP--------------------------------
SYL_BDEBA       DRITRLVVNDDGQ-------LVATSEAL--------------------------------
SYL_SORC5       DRVFATCTRPL-------------SDAM--------------------------------
SYL_TREDE       EKIWNLSDREIYK-------TPVNDTSTPETK----------------------------
SYL_TREPA       EKIWVLAGRVAAA-------NGIPQDSRAEPPGDLHAQKKSCS-----------------
SYL_BORAP       NKIWNLREKELSK-------DNPPKEI---------------------------------
SYL_BORBP       NKIWNLREKELSK-------DNPPKEI---------------------------------
SYL_BORBU       NKIWNLREKELSK-------ENPPREI---------------------------------
SYL_CHLTR       NRFYEMVSSDRVK-------EDNNFEG---------------------------------
SYL_CHLTA       NRFYEMVSSDRVK-------EDNNFEG---------------------------------
SYL_CHLMU       NRFYEMATSSRVK-------DEDIFEG---------------------------------
SYL_CHLFF       NRFYELVTSSLVQ-------DIDDPKG---------------------------------
SYL_CHLCV       NRFYEMATSASVQ-------DVDDPKG---------------------------------
SYL_CHLAB       NRFYELATSSAVQ-------DIDDPKG---------------------------------
SYL_CHLPN       NRFYDLVTSSEVQ-------DIEDRDG---------------------------------
SYL_PARUW       NRFYEMAFSDKVT-------NETSEEG---------------------------------
SYL_ALKOO       DRIWKLQEILVDS-------QEMTKEL---------------------------------
SYL_UREP2       DRVYRLYHNLSEL-----EVVEDLNKLN--------------------------------
SYL_UREPA       DRVYRLYHNLSEL-----EVVEDLNKLN--------------------------------
SYL_MYCPU       ERVYRLFEMFFDG-----QKTIEKSNED--------------------------------
SYL_MYCPE       QRVYRLFE----------TKQIDKNFND--------------------------------
SYL_MYCGA       ERVYNLFD----------RVEINDSIN---------------------------------
SYL_MYCGE       DRVYNFFF----------NHAVVTDQVS--------------------------------
SYL_MYCPN       DRVHNFFH----------KENIIKETVD--------------------------------
SYL_MYCCT       NRCYRMIN-----------KIEFSNTNN--------------------------------
SYL_MYCMS       NRCYRMIN-----------KIEFSNTNN--------------------------------
SYL_MESFL       HRAYRMVM-----------TTELTDVND--------------------------------
SYL_ACHLI       DRVWRMF------------DFEITQQPV--------------------------------
SYL_PSEA6       KRVWKLTQDHI---DALDGDTAPAIDKTA-------------------------------
SYL_COLP3       KRVYKLAHEFV---ESTNNSAVVDIAELT-------------------------------
SYL_IDILO       RRLWKLTYEL--------NNAGGACSGQS-------------------------------
SYL_PSEHT       KRVWKYAVDV-------KTVGFQPLNKTA-------------------------------
SYL_PSYIN       KRLWKIAFDH------LALGAVADLDLKS-------------------------------
SYL_SALCH       KRVWKLVYEHT------AKGPVAALNVDA-------------------------------
SYL_SALTI       KRVWKLVYEHT------AKGPVAALNVDA-------------------------------
SYL_SALTY       KRVWKLVYEHT------AKGPVAALNVDA-------------------------------
SYL_SALPB       KRVWKLVYEHT------AKGSVAALNVDA-------------------------------
SYL_SALPA       KRVWKLVYEHT------AKGPVAALNVDA-------------------------------
SYL_CITK8       KRVWKLVYEHT------AKGEVAALNVDA-------------------------------
SYL_SALAR       KRVWKLVYEHT------AKGSVAALNVDT-------------------------------
SYL_SHIFL       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_SHIF8       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_SHIBS       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECOL6       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECOL5       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECO57       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_SHISS       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECOLI       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECOLC       KRIWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_SHIDS       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECOHS       KRVWKLVYEHT------AKGDVATLNVDA-------------------------------
SYL_ECOUT       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECOK1       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_ECO24       KRVWKLVYEHT------AKGDVAALNVDA-------------------------------
SYL_KLEP7       KRVWKLVYEHT------TKGEVAALNVAA-------------------------------
SYL_CROS8       KRVWRLVYEHT------SLGDAPALNVDA-------------------------------
SYL_ENT38       KRVWKLVYEHT------SQGEAPALNVGA-------------------------------
SYL_YERPA       KRVWRLAFDHT------AKGAVKPLDIAS-------------------------------
SYL_YERP3       KRVWRLAFDHT------AKGAVKPLDIAS-------------------------------
SYL_YERPE       KRVWRLAFDHT------AKGAVKPLDIAS-------------------------------
SYL_YERPN       KRVWRLAFDHT------AKGAVKPLDIAS-------------------------------
SYL_YERPS       KRVWRLAFDHT------AKGAVKPLDIAS-------------------------------
SYL_YERPP       KRVWRLAFDHT------AKGAVKPLDIAS-------------------------------
SYL_YERE8       KRVWRLAYDHT------AKGATAPLDVAN-------------------------------
SYL_SERP5       KRVWKLSYEHL------EKGAVQPLNVAT-------------------------------
SYL_PECAS       KRVWRQAFEHT------GKGAVTALDITT-------------------------------
SYL_SODGM       KRVWKLAYEHP------QQGPVGALDIDA-------------------------------
SYL_PHOLL       KRVWRLVYEHS------SKGATQPLDITN-------------------------------
SYL_MANSM       GRLWNLVFEYN------KNPVKTAPNPTA-------------------------------
SYL_ACTSZ       GRLWNLVFEYN------KNPAKTALNPTA-------------------------------
SYL_HAES1       RRLWNLVFEYN------QNPAQTALDPTA-------------------------------
SYL_HISS2       RRLWNLVFEYN------QNPAQTALDPTA-------------------------------
SYL_PASMU       GRLWNLVFEYN------KHPAETTVEPTA-------------------------------
SYL_HAEIG       GRVWNLVYQYQ------QNPAKTSLDITA-------------------------------
SYL_HAEIN       GRVWNLVYQYQ------QNPAKTSLDLTA-------------------------------
SYL_HAEI8       GRVWNLVYQYQ------QNPAKTSLDITA-------------------------------
SYL_HAEIE       GRVWNLVYQYQ------QNPAKTSLDLTA-------------------------------
SYL_ACTP2       GRVWNLVYEYS------QNPATAALDVAA-------------------------------
SYL_HAEDU       GRVWNLVYEYV------QQPATQALNALE-------------------------------
SYL_SHESA       KRLWKLASDYV------AQDNSEALDVSK-------------------------------
SYL_SHESM       KRLWKLASDYV------AQDNSEALDVSK-------------------------------
SYL_SHESR       KRLWKLASDYV------AQDNSEALDVSK-------------------------------
SYL_SHEON       KRLWKLASEYV------AQDNSEALDVSK-------------------------------
SYL_SHEB9       KRLWKLANEHV------NQDNSEALDASK-------------------------------
SYL_SHEB5       KRLWKLANEHV------NQDNSEALDVST-------------------------------
SYL_SHEB8       KRLWKLANEHV------NQANSEALDVST-------------------------------
SYL_SHESW       KRLWKLASEYI------AQDNSEALDVSK-------------------------------
SYL_SHEPC       KRLWKLASEYI------AQDNSEALDVSK-------------------------------
SYL_SHEAM       KRLWKLASEYS------AAPATEALDVSA-------------------------------
SYL_SHEHH       KRLWKTAHDHI------ATGPTAELDVKS-------------------------------
SYL_SHEPA       KRLWKTAHDHI------ANGTTAELDVKS-------------------------------
SYL_SHELP       KRLWKLAHDHV------SQGPTVALNVAS-------------------------------
SYL_SHESH       KRLWKVAHDHV------AKGATAPLDVKT-------------------------------
SYL_SHEDO       KRLWKLASDHV------AAGPTEALDVSK-------------------------------
SYL_SHEFN       KRFWKLASDHV------AAGKTEALDTSK-------------------------------
SYL_VIBPA       KRVWKLVKEHA------EKGAAEAVDTAA-------------------------------
SYL_VIBCB       KRVWKLVNEHT------SKGAAEAVDAAA-------------------------------
SYL_VIBVU       KRVWKLVNEHT------SKGAAEAVDAAA-------------------------------
SYL_VIBVY       KRVWKLVNEHT------SKGAAEAVNAAA-------------------------------
SYL_VIBCH       RRVWKLVREHT------ELGQAPALDASA-------------------------------
SYL_VIBC3       RRVWKLVREHT------ELGQAPALDASA-------------------------------
SYL_ALIF1       KRVWKLVHEHT------NKGTTEALDTSS-------------------------------
SYL_PHOPR       KRVWKLVHEHT------NKGTVEALDVAA-------------------------------
SYL_AERS4       RRLWRLTFEHV------SAGAVPALDVAA-------------------------------
SYL_AERHH       RRLWRITFEHV------SAGVAPALNVAA-------------------------------
SYL_MARHV       KRLWRMVNEHT------AGGDAPAVDPAN-------------------------------
SYL_HAHCH       RRLWKLVHTHV------EKKGAAPLNVAE-------------------------------
SYL_SACD2       KKLWKAVASHL------EAGSAGEIDANS-------------------------------
SYL_MARMS       RRLWALSYRHT------NAGKVGELNIAE-------------------------------
SYL_ALCBS       KRLWRLVAEHV------EAGNTGTLDVNA-------------------------------
SYL_PSEAB       RRVWRLAHAH--VS-AG---LPGALDVAA-------------------------------
SYL_PSEAE       RRVWRLAHAH--VS-AG---LPGALDVAA-------------------------------
SYL_PSEA7       RRVWRLAHAH--VS-AG---LPGALDGAS-------------------------------
SYL_PSEU5       RRVWRLAHAH--VS-AG---LPGALDVAA-------------------------------
SYL_PSEMY       RRVWRLAHGH--VS-AG---LPGKLDVAS-------------------------------
SYL_PSEP1       RRVWRLAQAH--VS-QG---LPGKLDVAA-------------------------------
SYL_PSEPK       RRVWRLAQAH--VS-QG---LPGKLDVAA-------------------------------
SYL_PSEPG       RRVWRLAQAH--VS-QG---LPGKLDVAT-------------------------------
SYL_PSEE4       RRVWRLAQAH--VA-QG---LPGQLDIAA-------------------------------
SYL_PSEU2       RRVWRLAQAH--VT-QG---PSTGLDVAA-------------------------------
SYL_PSE14       RRVWRLAQAH--VA-QG---ASTGLDIAA-------------------------------
SYL_PSESM       RRVWRLAQAH--VG-QG---ASGSLDIAA-------------------------------
SYL_NEIMB       RRLWRTVYEY--LK-QGEAVKAFAGSQDG-------------------------------
SYL_NEIMF       RRLWRTVYEY--LK-QGEAVKAFAGSQDG-------------------------------
SYL_NEIG1       RRLWRTVYEY--LK-QGGAVKAFAGNQDG-------------------------------
SYL_NEIM0       RRLWRTVYEY--LK-QGGAVKAFAGNQDG-------------------------------
SYL_NEIMA       RRLWRTVYEY--LK-QGEAVNAFAGSQDG-------------------------------
SYL_CHRVO       KRLWKTAREH--VE-AG-VVAPYASGE---------------------------------
SYL_THIDA       RRLWKTVY----EH-VQAGPVVTRAGG-A-------------------------------
SYL_DECAR       RRLWKTTY----DH-LQAGLVAASTSNDG-------------------------------
SYL_AZOSB       RRVWNFGHAFASEF-RAALPAARALAAGT-------------------------------
SYL_CUPMC       RRVWNYGY----AN-AQAIRDGAGTA----------------------------------
SYL_CUPPJ       RRVWNYGF----AN-AAAVRDGAGAA----------------------------------
SYL_RALSO       RRAWNFGV----AH-AESIRAGHGNGVVNG------------------------------
SYL_JANMA       RRVWAYGY----NQ-AARVANASAFDFAT-------------------------------
SYL_HERAR       RRVWTYAY----NQ-SARIAAATASDFSK-------------------------------
SYL_BURCH       RRVWSFGY----GN-REALAARAGFDAAT-------------------------------
SYL_BURCA       RRVWSFGY----GN-REALAARAGFDAAT-------------------------------
SYL_BURL3       RRVWSFGA----AN-REALAARAGFDAAA-------------------------------
SYL_BURCM       RRVWSFGA----TN-REALATRAGFDAAA-------------------------------
SYL_BURVG       RRVWSFGA----GN-REALAARAGFDAAS-------------------------------
SYL_BURP0       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURPS       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURP6       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURP1       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURM7       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURM9       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURMA       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURMS       RRVWAFGF----AN-REALAVRAPFDAAQ-------------------------------
SYL_BURTA       RRVWAFGF----AN-REALAVRAPFDVAQ-------------------------------
SYL_PARXL       RRVWSFSQ----AN-EAALRQGGTFDAAQ-------------------------------
SYL_POLAQ       RRVWMYSS----SQ-ASAIKDAQDALPST-------------------------------
SYL_BORBR       RRLWALGYAQREAV-GRGLATGADWAQAP-------------------------------
SYL_BORPA       RRLWALGYAQREAV-GRGLATGADWAQAP-------------------------------
SYL_BORPE       RRLWALGYAQREAV-GRGLATGADWAQAP-------------------------------
SYL_BORPD       RRLWSHCHAHRDAV-ARGLAAGADWAQAP-------------------------------
SYL_BORA1       RRLWALAYDRRAAV-ARGLASGYAWQDAP-------------------------------
SYL_METPP       RRLWAFATKQREAV-Q---AAGTDFADAS-------------------------------
SYL_ACISJ       RRVWNFGVKLSAID-KDAALASVAGAASLKD-----------------------------
SYL_ACIAC       RRVWNFGVKLAGID-AAATEAAIQGAQSLQD-----------------------------
SYL_RHOFT       RRVWNFGIKLSTID-MIAVDESTTGATALND-----------------------------
SYL_VEREI       RRVWNFGLQLHAAG-MTAASASLAGAGAPQT-----------------------------
SYL_POLNA       RRVWNFGVKLNAMN-SGANGADAACAKGL-------------------------------
SYL_POLSJ       RRVWNFGVKLSAAK-TAAAAAQAAGFVAE-------------------------------
SYL_METCA       KRLWTRAAF---SV-NTAFSQYGRDELRVTD-----------------------------
SYL_DICNV       RRLWAYCY----EF-RHSIAKPSEVVPLN-------------------------------
SYL_PSYCK       KKVWRIASEHIQAL-TDANLSLESLNS---------------------------------
SYL_PSYA2       KKVWRIASEHMQAL-TAANLSLDTLNNGTLNN----------------------------
SYL_PSYWF       KKVWRETQSHLEAT-QELGLQVANLPAA--------------------------------
SYL_ACIAD       KRVWRLATGFLEKG-YA-------------------------------------------
SYL_NITEU       KRLWRQVYLHRQLD-GEAAATTTLVPHQE-------------------------------
SYL_NITEC       KRLWRQVYLHRQ-Q-GSDMSATDAIPHLE-------------------------------
SYL_NITMU       KRLWKQVYDHLQ----QSGVANGPIPVAG-------------------------------
SYL_METFK       KRVWTAVANHVE------SGIVAAFTMGD-------------------------------
SYL_HYDCU       NRVWRQVQTH--VS-TGVVAACTSNDD---------------------------------
SYL_XYLFA       RRLWTQVH-----H-HAAHGPATALDI---------------------------------
SYL_XYLFT       RRLWTQVH-----H-HASHGPATALDI---------------------------------
SYL_XANC8       RRLWVQVH-----K-HVGEGAAALDV----------------------------------
SYL_XANCP       RRLWVQVH-----K-HVGEGAAALDV----------------------------------
SYL_XANCB       RRLWVQVH-----K-HVGEGIDDELTKIVAL-----------------------------
SYL_XANC5       RRLWVQVH-----K-HVGEGAAVALDV---------------------------------
SYL_XANAC       RRLWAQVH-----K-HVGEGTAVALDV---------------------------------
SYL_XANOR       RRLWAQVH-----K-HVGEGAAVALDV---------------------------------
SYL_XANOM       RRLWAQVH-----K-HVGEGAAVALDV---------------------------------
SYL_NITOC       KRLWRIVA-----A-HVEQDPKAALTLKV-------------------------------
SYL_ALKEH       RRYYGLVR-----D-HVAAGPVPALDV---------------------------------
SYL_HALHL       RRLHGLVR-----D-HVAAGPAPALDP---------------------------------
SYL_CHRSD       KRLWKLVA-----D-HLDAGTPAALDA---------------------------------
SYL_BUCAI       KKLWMLIFNY-----IDIKNTHKKINFDF-------------------------------
SYL_BUCAP       KKIWKLVFNH-----IEVKKINKKVNFDI-------------------------------
SYL_BUCCC       KKIWNFVF-------IIIKKKKEKIKKID-------------------------------
SYL_BUCBP       KKLWVLSYNH-----IKLYNHKIKLRINL-------------------------------
SYL_WIGBR       KKLWKITYNY-----LNLKKNNNYVFYKK-------------------------------
SYL_BLOPB       KRIWNLIYHH-----IQDG-PVDALSVVI-------------------------------
SYL_BLOFL       KRLWNITYQH-----IQNG-LIHQLNMYK-------------------------------
SYL_BAUCH       KRLWKLTYDH-----IQRG-KVIKLDLAA-------------------------------
SYL_COXBU       KKLWGFSYRIKDALLAINQQKERSN--YQWE-----------------------------
SYL_COXBR       KKLWGFSYRIKDALLAINQQKERSN--YQWE-----------------------------
SYL_COXBN       KKLWGFSYRIKDALLAVNQQKERSN--YQWE-----------------------------
SYL_LEGPH       KRVWAFSHQHRDMLIDINDSILSGNGHVDWK-----------------------------
SYL_LEGPC       KRVWAFSHQHRDMLIDINDSILSGNGHVDWK-----------------------------
SYL_LEGPA       KRVWAFSHQHRDMLIDINDSILSGNGHVDWK-----------------------------
SYL_LEGPL       KRVWAFSHQHRDMLIDINDSILSGNGHVDWK-----------------------------
SYL_FRATT       RKVFNYA--------ELNKVIFAKNITLESQ-----------------------------
SYL_FRAT1       RKVFNYA--------ELNKVIFAKNITLESQ-----------------------------
SYL_FRATW       RKVFNYA--------ELNKVIFAKNITLESQ-----------------------------
SYL_FRATF       RKVFNYA--------ELNKVIFAKNITLESQ-----------------------------
SYL_FRATH       RKVFNYA--------ELNKVIFAKNITLESQ-----------------------------
SYL_FRATO       RKVFNYA--------ELNKVIFAKNITLESQ-----------------------------
SYL_FRATN       RKVFNYA--------ELNKDIFAKNITLESQ-----------------------------
SYL_FRAP2       RKVYNYA--------YTNKEILAKNITIDVT-----------------------------
SYL_RUTMC       NKVYRLI------MDFIQDHKSHAIGTLNN------------------------------
SYL_VESOH       KKVYRLV------SIYINDSKDYIVNHLNIN-----------------------------
SYL_RICRS       NKLEYMFKAIDSLKDDVNSE----------------------------------------
SYL_RICRO       NKLEYMFKAIDSLKDDVNSE----------------------------------------
SYL_RICCN       NKLEYMFKAIDSLKDDVNSE----------------------------------------
SYL_RICM5       NKLEYMFKAIDSLKDDVNSE----------------------------------------
SYL_RICFE       NKLEHMFEAIASLIDDVNSE----------------------------------------
SYL_RICAH       NKLEQMFEAIKFLYNEANKEEFEGNTERSTAAYTLVREDASTGS----------------
SYL_RICCK       NKLEHMFKVIASLKDDVTGI----------------------------------------
SYL_RICBR       NKLEQMQETIIKLSDNKNTN----------------------------------------
SYL_RICPR       NKLENMFEAIFSLKDDMKSE----------------------------------------
SYL_RICTY       HKLDNMFEVISSLKDDMNNE----------------------------------------
SYL_ORITB       QKLYNFALKLKNINLTDNKI----------------------------------------
SYL_WOLPM       NKLWRMVMQLRPVNIHYD------------------------------------------
SYL_WOLTR       NKLWRMVMQFKPVVILNQSP------VKQVADTEIQKEDMLSHA----------------
SYL_EHRRW       NKLWKMIVDYDQLEQNFV------------------------------------------
SYL_EHRRG       NKLWKMIVDYDQIEQNFV------------------------------------------
SYL_EHRCJ       SKLWRMIVSYDQINLNFN------------------------------------------
SYL_EHRCR       SKLWRVIISYDKFNLNFN------------------------------------------
SYL_ANAMM       ERLWRLFEDNSSIGADFD------------------------------------------
SYL_NEOSM       QRIKNLVERYLSSKNSGE------------------------------------------
SYL2_RHIL3      QRLWRLISEAADALSAVAP-----------------------------------------
SYL_RHIEC       QRLWRLISEAADCLSAVAP-----------------------------------------
SYL_RHIME       QRVWRLLTEAAERLRAVDA-----------------------------------------
SYL_SINMW       QRVWRLLSEAAEGLSAAEA-----------------------------------------
SYL_AGRFC       QRVWRIIGEAAEQLKGVKP-----------------------------------------
SYL_BRUAB       QRIWRLVAEAAPALKDVAP-----------------------------------------
SYL_BRUA2       QRIWRLVAEAAPALKDVAP-----------------------------------------
SYL_BRUSI       QRIWRLVAEAAPALKDVAP-----------------------------------------
SYL_BRUO2       QRIWRLVAEAAPALKDVAP-----------------------------------------
SYL_BRUME       QRIWRLVAEAAPALKDVAP-----------------------------------------
SYL_BRUSU       QRIWRLVAEAAPALKDVAP-----------------------------------------
SYL_BRUC2       QRIWRLVAEAAPALKDVAP-----------------------------------------
SYL_OCHA4       QRVWRLVAEAAEHLKDVAP-----------------------------------------
SYL_CHESB       QRAWRLITEAAPAIGDITP-----------------------------------------
SYL_RHILO       QRIWRLVSTAAETLAGVKP-----------------------------------------
SYL_BART1       QRVWRHVALSAAVLKDVAP-----------------------------------------
SYL_BARHE       QRVWRCVALSAPVLRDVVP-----------------------------------------
SYL_BARQU       QRVWRCVVLSAPVLKEVIP-----------------------------------------
SYL_BARBK       QRVWRCVALSAPILSTIEP-----------------------------------------
SYL_RHOP2       QRLWRMVNDAAAIARSAPAE----------------------------------------
SYL_RHOPS       QRLWRMINDAAEIAKAAPAA----------------------------------------
SYL_RHOPA       QRLWRMVNDAAPIAASAPAE----------------------------------------
SYL_RHOP5       QRLWRIANDAAEIAKLAPAD----------------------------------------
SYL_NITHX       QRLWRLVNESAEAGKAAPRD----------------------------------------
SYL_NITWN       QRLWRLVNEAADAGKAAPQD----------------------------------------
SYL_BRASB       QRLWRLVNESVAAGQEAPSS----------------------------------------
SYL_BRASO       QRLWRLVNESVAASAEAPSS----------------------------------------
SYL_BRADU       QRLWRLVNDSVELGKAAPAA----------------------------------------
SYL_RHOPB       QRVWRLVSAMAPQLPAPGTR----------------------------------------
SYL_AZOC5       QRVWRQVQEAIELGAPKGAD----------------------------------------
SYL_PARL1       QRLWRMVTERQEDLAPTGTP----------------------------------------
SYL_CAUVC       HRLWNEFDSQPAGDFAHD------------------------------------------
SYL_CAUSK       HRVWNEFESQPAGDFAHD------------------------------------------
SYL_MARMM       QRLWSTVTSLPEGAPGPLT-----------------------------------------
SYL_HYPNA       QRVWSFVDSLPETGPFPAP-----------------------------------------
SYL_RUEST       NRVWNLCDRIGEMDPD--------------------------------------------
SYL_RUEPO       NRVWNLCDRIAAMDSA--------------------------------------------
SYL_ROSDO       TRVWTLSERIGKMDKD--------------------------------------------
SYL_JANSC       GRVWALCDRISEAARSVSEE----------------------------------------
SYL_DINSH       GRVWRLAEDLRRNAEEA-------------------------------------------
SYL_RHOS1       HRVWRLADEISRADGE--------------------------------------------
SYL_RHOS4       HRVWRLADEISRADGE--------------------------------------------
SYL_RHOS5       GRVWRLADEIARAEGA--------------------------------------------
SYL_PARDP       ARVWRLADEIPE------------------------------------------------
SYL_ZYMMO       QRLWRVAAIASE------------------------------------------------
SYL_SPHWW       NRLWRITDVS--------------------------------------------------
SYL_NOVAD       QRLWRLFGQYDA------------------------------------------------
SYL_SPHAL       QRLWRLFGETEN------------------------------------------------
SYL_GRABC       QRLYRLAEAVARIAKEETN-----------------------------------------
SYL_GLUOX       QRLHRLVASVAARDAADS------------------------------------------
SYL_ACICJ       QRLYRLARSVAADRADDVA-----------------------------------------
SYL_MAGSA       NRLWRMVATAELPP--AGAP----------------------------------------
SYL_RHORT       GRLWRMALQPQIDPGAVGAP----------------------------------------
SYL_MAGMM       GRVWRLVLAAIERCGERQAC----------------------------------------
SYL_CAMJ8       CKLYDRAQNVKK---GELVELKQEN-----------------------------------
SYL_CAMJJ       CKLYDRAQNVKK---GELVELKQEN-----------------------------------
SYL_CAMJR       CKLYDRAQNVKK---GELVELKQEN-----------------------------------
SYL_CAMJE       CKLYDRAQNVKK---GELVELKQEN-----------------------------------
SYL_CAMJD       CKLYDRAQNIKK---GELVELKQEN-----------------------------------
SYL_CAMC1       NRLWEKSQTIKKI--DKLPEIDHES-----------------------------------
SYL_CAMC5       NRLWDKAKTIKKS--EILPAIEHAN-----------------------------------
SYL_CAMFF       NRLYDRSDNAYKT--EILPQINHSN-----------------------------------
SYL_CAMHC       NRLYERSQNVQKT--REIPKIDQSS-----------------------------------
SYL_ARCB4       KKFFERAENVNQNGLDNFKSIDHSA-----------------------------------
SYL_NITSB       KRFFERSQNAYKT--KSLPKIDQKS-----------------------------------
SYL_WOLSU       KRLCDKTQFVQKV--SSLPQIETAT-----------------------------------
SYL_HELHP       KRLWERAEHIESC--TQKPHINHKT-----------------------------------
SYL_HELPY       KRLYDKANAINPT--TSKPEFKEVS-----------------------------------
SYL_HELPH       KRLYDKANAITPT--TSKPEFKGVI-----------------------------------
SYL_HELPJ       KRLYDKANAITPT--TSKPEFKEVG-----------------------------------
SYL_HELAH       KRLYDKANAINPT--TYKPEFKEAN-----------------------------------
SYL_THEMA       KRLWNTFYTVLPFVKEENTENLVLKNST--------------------------------
SYL_THEP1       KRLWNTFYTVLPFVKEENTENLVLKNST--------------------------------
SYL_THEM4       KRLWNNIYSILPRIKDVKVEKIELKNKQ--------------------------------
SYL_FERNB       KRLWNNYYKILDIINSNDTKNENEFGKE--------------------------------
SYL_PSELT       RRAWSLMDQIISLPDNQNQ----VFAEE--------------------------------
SYL_CALS8       NRLWRLYIELKDKLSDS-----SLPGQ---------------------------------
SYL_HUNT2       NRVWRIVNEFADAVKEGGN--IDTSTF---------------------------------
SYL_DESHY       NRVWRLAAQYEEVLKTTGAGANEFGEL---------------------------------
SYL_SYNWW       NRVWRLVSELAEGIKDLPA-AEHFPEL---------------------------------
SYL_CARHZ       NRVWRLIYQTKDRISDELREFSAK------------------------------------
SYL_PELTS       NRVWRLVMPLAGLLKEAPAAVSGKL-----------------------------------
SYL_MOOTA       NRVWRLVGSYADAVRRAGGSLEIR------------------------------------
SYL_DESRM       NRVWRLVYSLKDEVAGAPAISSVNAY----------------------------------
SYL_SYMTH       NRFYRMVVSALPAYQHARSLLPINPADPASVMGALSEAEIAEG-----------------
SYL_DESVH       GRVWRLVEELREHLLAVGACSSTAEDAK--------------------------------
SYL_DESVV       GRVWRLVEELREHLLAVGACSSTAEDAK--------------------------------
SYL_DESAG       NRVWRLVEDLPAGMAPMAPCSSSSDDCT--------------------------------
SYL_LAWIP       HRVWRLFIDVQPHIHTTHAGNSTVIETT--------------------------------
SYL_GEOMG       SRVWRLVCDLLPFVGKGGAVD-SASLSD--------------------------------
SYL_GEOSL       NRVWRLVFEVLPFIGSAGKPD-PAALGD--------------------------------
SYL_GEOUR       NRVWKLVYDTLPIIGGAGALD-PAGLTN--------------------------------
SYL_PELPD       NRVWKLVNDRLELISGAAPLD-VPGLTG--------------------------------
SYL_PELCD       HRVWRAVYDNLEMISGVAV---PASVDG--------------------------------
SYL_SYNAS       GRTWRIVVDYLDDLQGIAPFAGDGELEG--------------------------------
SYL_SYNFM       SRIWRLVSDNLDALRSAPRHNGGGALPE--------------------------------
SYL_DESPS       NRIYRFITANFEALTAGEAFPKKLSEED--------------------------------
SYL_FUSNN       TRVWRLVFENSELVKNANDEIDYNK-----------------------------------
SYL_TRIV2       NRVWRLVTDYVASGVNPKNKSGE-------------------------------------
SYL_NOSS1       NRVWRLVTDYVASGVNPKNKSGE-------------------------------------
SYL_ACAM1       NRVWRLVSEHAAQAKGKKAKVNK-------------------------------------
SYL_TRIEI       NRVWSMVMEFLANHSFSELKAKHHGITQADLKDLGWSRYLITEITKNISAFKLRNVVKVY
SYL_SYNY3       NRVWRLVTDYIGDPAGIRFAVRPETLVT--------------------------------
SYL_SYNE7       NRVWRLVQTASQV-----EATTA-------------------------------------
SYL_SYNP6       NRVWRLVQTASQV-----EATTA-------------------------------------
SYL_THEEB       NRVWRLVQTFKAKGGRLGQPLPA-------------------------------------
SYL_SYNJB       NRVWRQVYEFVVRGGGTESWRGRVSELLPAKVE---------------------------
SYL_SYNJA       NRVWRQVYEFVVRGSGTESLQGKAAELLQAKVE---------------------------
SYL_GLOVI       GRVWRTVYEFVSGEKPDRPVGEAQ------------------------------------
SYL_SYNS3       QRLWRLVDSEV---NHDG------------------------------------------
SYL_SYNPW       QRLWRLIESVR---SDDQDQLLGDP-----------------------------------
SYL_PROMM       QRLIRLIDSFAWPKTDGENASISSA-----------------------------------
SYL_PROM3       QRLIRLIDSFVWPKTDEDNASISSA-----------------------------------
SYL_SYNSC       QRLWRLVEAGSARIDSLE------------------------------------------
SYL_SYNS9       QRLWRLVENASSTLTDLN------------------------------------------
SYL_SYNPX       QRIWRLVESADSRIDSLE------------------------------------------
SYL_SYNR3       QRIWRLCDGAKASGLQLQ------------------------------------------
SYL_PROMT       QRLWKFVINTFKLTN----NNSRSN-----------------------------------
SYL_PROM1       QRLWKFVINTFKLTN----NNSRSN-----------------------------------
SYL_PROMA       NRLWRIVIYSIETKDINISNCTQEI-----------------------------------
SYL_PROM0       SRIWKLYINCAKNVN----IKSNSY-----------------------------------
SYL_PROM9       SRIWKLYISCSKDIN----SKSKSY-----------------------------------
SYL_PROMS       SRIWKLYINCAKNIN----SKSNSH-----------------------------------
SYL_PROM2       NRIWKLYINCAKDIN----SKSNSY-----------------------------------
SYL_PROMP       CRIWKLFLDYSNNDI----THEADK-----------------------------------
SYL_PROM5       CRIWKLFLDYRNNES----WDNQKN-----------------------------------
SYL_SOLUE       GRVYRFTTRNVPAQ----------------------------------------------
SYL_DEIRA       SRVWNVFFEEKVSGPEEKMQ----------------------------------------
SYL_DEIGD       SRVWALYFDEKAAGPEEKIG----------------------------------------
SYL_RUBXD       RRAFTLVAGGDVS--EAEAD----------------------------------------
SYL_CLOPE       ERIERIIDTAREAISKGENNKT--------------------------------------
SYL_CLOPS       ERIERIIDTAREAISKGENNKT--------------------------------------
SYL_CLOP1       ERIERIIDTAREAISKGENNKT--------------------------------------
SYL_CLOB8       DRIERILENCRNIINSNESTKD--------------------------------------
SYL_CLOB1       DRVERILENAREEIKNSKDNKS--------------------------------------
SYL_CLOBH       DRVERILENAREEIKNSKDNKS--------------------------------------
SYL_CLOBL       DRVERILENAREEIKNSKDNKS--------------------------------------
SYL_CLONN       DKVERILADSRTQMADSKNTKT--------------------------------------
SYL_CLOAB       DRFSRMIETAKEEINNPKNSKT--------------------------------------
SYL_CLOK5