CLUSTAL format seed alignment for MF_00050

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EFTS_COXBU      -----------------------------------------MTTITPIMVKELRERTGAA
EFTS_NITEU      -----------------------------------------MAEITASMVKELRELTGLG
EFTS_ECOLI      -----------------------------------------MAEITASLVKELRERTGAG
EFTS_XYLFT      ------------------------------------------MEITASLVKELRERTGVG
EFTS_BUCAP      -----------------------------------------MSHITALLIKELRLRTGAG
EFTS_BLOFL      ----------------------------------------MIDHVNSDLIRELRKRTSVS
EFTS_WIGBR      -----------------------------------------MVNKLSNLIKEMRNRTNLG
EFTS_BUCBP      -----------------------------------------MTNISAFLVKKLRARTGVG
EFTS_MYCPN      ------------------------------------------MATKIELIKELRKTTQAS
EFTS_MYCGA      ------------------------------------------MASITELIKQLRASTQAG
EFTS_MYCPE      ------------------------------------------MSISADKIKELRSRTQAG
EFTS_UREPA      -------------------------------------------MTKAELVKELRIRTQAS
EFTS_MYCPU      ----------------------------------------MDASQKAGLIKKLREITNSG
EFTS_SPICI      ------------------------------------------MEVTAQLVKELRDRTGAG
EFTS_LACPL      -----------------------------------------MAKISAAQVKELRDKTGVG
EFTS_LACLA      ------------------------------------------MAVTAAQVKELREKTGAG
EFTS_FUSNN      -----------------------------------------MATVTAALVKELRERTGAG
EFTS_BRADU      -----------------------------------------MATITAAMVKDLRESTGAG
EFTS_ZYMMO      -----------------------------------------MAEITAAAVKALRERTGAG
EFTS_CAUVC      -----------------------------------------MAEITAALVKELREKSGVG
EFTS_RICPR      ---------------------------------------MSEINISAVVVKELREKTGAG
EFTS_DEIRA      ---------------------------------------------MMESIKKLREMTGAG
EFTS_BACTN      ------------------------------------------MAVTMADITKLRKMTGAG
EFTS_PORGI      ------------------------------------------MAVTIQDIAKLRKMSGAG
EFTS_CAMJE      -----------------------------------------MTEITAAMVKELRESTGAG
EFTS_RHOBA      -----------------------------------------MTTISAKAVSELRKSTGAG
EFTS_CYAM1      ---------------------------------------------MKELVQQLRKDTGAG
EFTS_CYACA      ----------------------------------MSNKSSKTSKVSIDLIKQLREKTGVS
EFTS_PHATC      ----------------------------------------MKTEIDAKTVKKLRDETGAG
EFTS_GLOVI      -----------------------------------------MAEITSQMVMQLREKTQVG
EFTS_CALS4      -------------------------------------------MISAQAVKELRERTGAG
EFTS_THET8      -----------------------------------------MSQMEL--IKKLREATGAG
EFTS_CHLTE      -----------------------------------------MSQISAKDVKELRDTTGVG
EFTS_MYCLE      -----------------------------------------MANFTVADVKRLRALTGAG
EFTS_STRRA      -----------------------------------------MANYTAADVKKLRELTGAG
EFTS_BIFLO      -----------------------------------------MAAITAALIKQVREDTGAG
EFTS_TROWT      -----------------------------------------MVDISMADVRLLRERLGVG
EFTS_BORBU      -----------------------------------------MSIISPQDVKKLREETNAG
EFTS_TREPA      ------------------------------------------MEIAARDVKSLRDKTGAG
EFTS_CHLTR      -----------------------------------------MSDFSMETLKNLRQQTGVG
EFTS_HUMAN      MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
                                                                 :  :*     .

EFTS_COXBU      VMACKKALQETNGDMEAAIDLLRKAGD----AKAAKRAGKTAAEGVIVIAISK------D
EFTS_NITEU      MMECKKALVEADGDMKAAEDLLRIRSG----AKASKAAGRIAAEGVISGFVTA------D
EFTS_ECOLI      MMDCKKALTEANGDIELAIENMRKSGA----IKAAKKAGNVAADGVIKTKI--------D
EFTS_XYLFT      MMECKKALSENAGNIDASVEWLRKSGL----VKADKKAGRIAAEGRIVVVH--------D
EFTS_BUCAP      FMECKRALIEEKGDIELSIDNLRKSGQ----ARAEKKIHNITNQGLIFAKIK--------
EFTS_BLOFL      IIKCKQALIDSNGDIELAIDNMRKSGL----QTDFIQSNRLTPSGLIAIKIEP------N
EFTS_WIGBR      ILECKKALLENNENIELAIQFIKKSGT----LNIEKNVNNLSN-GIVLAKVKK------E
EFTS_BUCBP      IMDCKRALMCMKGDIDKSVDFLRKMGQ----IKAEKKQFLLTQNGSIFISFD--------
EFTS_MYCPN      MMDCKKALEQNNDDLEKAIKWLRENGI----VKSAKKLGKVAADGCI--VLHS------D
EFTS_MYCGA      FMDCKKALEATNNDIDQAIKWLRENGI----AKAAKKVDNVASEGVI--KLKL------A
EFTS_MYCPE      FMDCKKALEESDNDIEKAIAWLREKGI----SKAAKKASAIAAEGQT--TVVE------K
EFTS_UREPA      MSECIKALDASENDIEKAIVWLRENGA----IKAANKLKNAATDGVV--LAKK------I
EFTS_MYCPU      FLDCKKALEETNYDLDKAIEWLQENGK----AKAAKKSGRIAAEGLV--RASV------K
EFTS_SPICI      MLDCKKALEDTGGNIEEAITWLREKGI----TKAAKKSDRVAAEGLV--GLVT------K
EFTS_LACPL      MMDAKKALVETEGDMEKAVDVLREKGV----AKAEKKSGRVAAEGIA--AVAI------K
EFTS_LACLA      IMDAKRALVETDGNMEAAAELLREKGI----AKAAKKADRVAAEGLT--GIAV------N
EFTS_FUSNN      MLDCKKALESHDGDIEKSIDYLREKGI----AKAVKKAGRIAAEGLIFDEATP------D
EFTS_BRADU      MMDCKAALTENDGNMEAAQDWLRKKGL----SKAAKKSGRVAAEGLIGALTK--------
EFTS_ZYMMO      MMDCKKALNEANGEMEAAVDWLRAKGL----AAAAKKSGRQAAEGLVGVMID--------
EFTS_CAUVC      MMDCKKALAENNGDIEASIDWLRAKGL----SKAAKKADRAAAEGLVAIATAEQG----A
EFTS_RICPR      MMDCKKALIETSGNFEEAIDFLRKKGL----AAAVKKSGRIASEGLTAVKVD--------
EFTS_DEIRA      MMDVKKALADAEGNEDKAIALLRERGI----AKAVKKGDREAKEGIVRFAVD--------
EFTS_BACTN      MMDCKNALTEAEGDYDKAMEIIRKKGQ----AVAAKRSERDASEGCVLAKTTGD------
EFTS_PORGI      MMDCKNALEESNNDFEKAMEIIRKKGQ----AVAAKRSDREAAEGCVLSADKDG------
EFTS_CAMJE      MMDCKNALSETNGDFDKAVQLLREKGL----GKAAKKADRLAAEGLVSVKVSDDF-----
EFTS_RHOBA      MMDCKKALEESGGDLDGAMDYLRKKGQ----KVAAKRADREASEGVVAAVVEGN------
EFTS_CYAM1      VMDCKKALQEANGDVVQALNLLKKKGL----AKAEQKRTRSTTNGRVESYVHAGN-----
EFTS_CYACA      IKDCKEALRKHDGDIAKALREIQEQGS----AIAQEKHNRITVHGRIASYIHINN-----
EFTS_PHATC      MMTCKQALTENHGDYDKAIESLRLKGM----ATADKKSSRNTNEGLIYSYIHTGS-----
EFTS_GLOVI      VLDCKKALAEAEGDLEKAIELLRKKGI----MKAGKVKDKVATEGLVGSYIHTGG-----
EFTS_CALS4      MMDCKNALIEANGDIEKAIDILREKGL----AAAAKKAGRTANEGLVEAYIHGGG-----
EFTS_THET8      MMDVKRALEDAGWDEEKAVQLLRERGA----MKAAKKADREAREGIIGHYIHHNQ-----
EFTS_CHLTE      MMECKKALEETGGDMQKAVEYLRKKGA----AMAAKRADREASEGVVCILMSDDQ-----
EFTS_MYCLE      MLDCKSVLVETDGNFDKAVESLRIKGA----KDVGKRAERATAEGLVAA-----------
EFTS_STRRA      MMDCKKALDEAEGNVEKAVEALRIKGQ----KGVAKREGRSAENGAVVSIIAD------D
EFTS_BIFLO      MLDVKKALTEAEGDVARAKEIIRAKGI----AAAGKREGRKAQEGTIASKVVETA----N
EFTS_TROWT      VMDSRNALIEAGGDIERAVEILRLKGL----KSAEKREGRSVSEGLVVSRQFA-------
EFTS_BORBU      FGDCKKALSVAGGDFELAKKKLREMGI----ASAEKRLDRDAKEGRVFSYSNNI------
EFTS_TREPA      MMECKRALQECAGDALCAEKYLKERGL----AAIENRRGRATAEGVIVIKARHAEGAACG
EFTS_CHLTR      LTKCKEALEHAKGNLEDAVVYLRKLGL----ASAGKKEHRETKEGVIAARVDE-------
EFTS_HUMAN      FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEG-------
                .     .*     :   :   ::  .                  *               

EFTS_COXBU      QKKGFMAEVNSETDFVARDTNFMAFASKVAERGLAEGVSDVAATLALPIEPNSSSTIEDE
EFTS_NITEU      GKQGALVEVNCETDFVAKNEDFINFAGNLARLMADKNISDTALLEDMSIA--EGETVESV
EFTS_ECOLI      GNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKA---------QFEEE
EFTS_XYLFT      GCKAVLVEINSETDFVAKDSHFLAFAEAVAQAALVAGAADVEALKHVKLP--SGETVEET
EFTS_BUCAP      NKIGAMVELNCQTDFVAKDTLFYSLGKEIILTALSKKIKNIDDIRN---------VFEIK
EFTS_BLOFL      KQKGLMIEINCETDFVSRNSMFREFINTVMVTALNESINNINALKT---------RFEEQ
EFTS_WIGBR      KKYGALIELNSETDFVAKNKQFQNFGKEIISIILKEKISDIDILRK---------FMKEK
EFTS_BUCBP      HNLGVMLELSSETDFVSKHKDFLCLGEKILDYVLTHPMESIEFIRK---------HFEDL
EFTS_MYCPN      HHKAVMVEINSQTDFVARSQELTDFAQLMISEVFKKATPTTTIEEVTQYELQGKEKVAER
EFTS_MYCGA      DQKATILEINSQTDFVTKNDQFVAFSNELVDLVHKHET--TDVAKIEQLKLASGSTVAET
EFTS_MYCPE      GDNCVVLEVNSQTDFVSKNADFVKFVKDVAEVILKNK----SADNVDSLVLPNKKTVADT
EFTS_UREPA      NNKAILIEVNCQTDFVAKNENFLAYANQILEEALAKVE---NKEDFDKLII-NGKPIAES
EFTS_MYCPU      GKSAVIFELNSETDFVARNKEFLDLMDNISEALVENSF--QSMESAENIFMENDLTILEA
EFTS_SPICI      GDKQIIFEVNSETDFVAKNKQFKDLMATVGETLINNDP--KTVEDVLKVSVNGE-PLETV
EFTS_LACPL      DNKAAIVEINCETDSVASTDKFKNLVTEVADKIAEEEP--ASVDDALALKTANG-TVKDD
EFTS_LACLA      GNVAAIVELNSETDFVAKNDQFVALVKETAELIASKKP--ATNEEALALETASGITLEAE
EFTS_FUSNN      HKKAVILEFNSETDFVAKNEEFKEFGRKLVKIALERNV--HQLEELNEAQVEGDKKVSEA
EFTS_BRADU      GTKGVVVEVNSETDFVARNGQFQGLVKMIAQVAFDVGADVEKI-KAAKVG---DVTIETA
EFTS_ZYMMO      GTKGAVLEVNSETDFVAKNEKFQDFVKGVTALVLEHGSDIDTLSKAPHPA---GGSVNDV
EFTS_CAUVC      GETATAVEVNAETDFVSRNDLFQGAARQIAGAALGTDGSVDAITAAKLAG---GETVQDH
EFTS_RICPR      GLISAVIEVNSETDFVARNKQFQDLVKDIVNLAI-IAQNIDTLKISKMQS---GKSVEEE
EFTS_DEIRA      GNRAAMVEVNSETDFVARNADFQATVEKLAQAALQAKTNDVEEFKNFTVD---GETVGNM
EFTS_BACTN      --YAVVIALKCETDFVAQNADFVKLTQDILDLAVANKCKTLDEVKALPMG--NG-TVQDA
EFTS_PORGI      --FAAIVALKCETDFVAKNAEFIELTQNILNTAMDKKPANKEELLALPLA--DGRTIADH
EFTS_CAMJE      -TSATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTIN--GV-KFEEY
EFTS_RHOBA      --KGLLLSLGCETDFVAKNEAFIELTNTIAKMAFDADCKTIDDVNALEID--GT-TVKER
EFTS_CYAM1      -RLGVLLELNCETDFVAKSEPF--------------------------------------
EFTS_CYACA      -RMGSLVEINCETDSAANSEEF--------------------------------------
EFTS_PHATC      -KLGILLEINCETDFVARREEF--------------------------------------
EFTS_GLOVI      -RIGVLVEVNCQTDFVAKGEEF--------------------------------------
EFTS_CALS4      -RIGVLVEVNCETDFVANTEEF--------------------------------------
EFTS_THET8      -RVGVLVELNCETDFVARNELF--------------------------------------
EFTS_CHLTE      -KTGVILELNCETDFVARGEVFTGFANELATLALSNNCESREDLLGIKLG--EAYGNETV
EFTS_MYCLE      -KDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAKIVDVDALKGASV---GDKTVEQA
EFTS_STRRA      NSSGVLVELKCETDFVAKGEKFQNVATAIAEHVAKAAPADLDALLASEIE--AGKTVQAF
EFTS_BIFLO      GETGYAVELNSETDFVAKTPKFVEFTEEVLGYAVDADANSADELLEAKA---GDTTVKLA
EFTS_TROWT      -THAVLAELCCETDFVAKSDRFLALSEKVADLVSDADSLETALRVRCDE-----GSVADL
EFTS_BORBU      --YAGLLLVSCETDFVALNHNFVNFGNSLIKELVESGIDSLTT------------SQELE
EFTS_TREPA      ASAVAMVELVCETDFVAKNAEFIALAERIAQAVLEHAYTEVNQ------------VLRDM
EFTS_CHLTR      -RGAALVEVNVETDFVANNNVFRAFVTSLLSDLLDHELSDVDALALVMSSQEPSLSVEEL
EFTS_HUMAN      -NTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQ-----------------TLKDQ
                        .  :** .:    :                                      

EFTS_COXBU      RKALVNRIGENIQIRRVASLSSDG----VVGHYSHGGRIGVLLALD-VPNPE--------
EFTS_NITEU      RKALVMKLGENISIRRGISYQTKD----HLAMYLHGSRIGVMIDYA-GGDEA--------
EFTS_ECOLI      RVALVAKIGENINIRRVAALEGD-----VLGSYQHGARIGVLVAAK-GADEE--------
EFTS_XYLFT      RAAVIAKIGENVRVRRLARIDSAN----NVAAYVHGGRIGVLVEVK-GGDVE--------
EFTS_BUCAP      KTELIVKTGENIKINRFSFIEGD-----NIISYIHSGRIGVLVSAS-NLNQE--------
EFTS_BLOFL      RLFLMNKIGENIKIRRFFVLIGN-----FLSSYIHRSRIGVLVSASGKINED--------
EFTS_WIGBR      ISYFSLTFKEKINIKRIKLFYGK-----NLFNYIHLKRIGVIVDIK-NSTED--------
EFTS_BUCBP      RTSLVMQVNENIVIRRIQTLNKK-----YITGYLHGRRIGVLVQTS-SINNH--------
EFTS_MYCPN      LALVASKTDEKIVLRRL-MVFESK----TNHIFSYLHANKRIGVILEVEGKF--------
EFTS_MYCGA      QIHLTAIIGEKISLRRVAFVKEEA----NSSLATYLHSNSRIGVIVKTSKTD--------
EFTS_MYCPE      AIDLTATIGEKISVRRAQLLTKKK----GQSFGVYQHFNGRISAAVLIDGEV--------
EFTS_UREPA      GLDLTAYIGEKIVFRRGEILKAND----DQTLGVYTHNNNRVAAIILVDGKV--------
EFTS_MYCPU      TTKATATIGEKISFRRAKKFDLLE----DQTIGAYTHANGRIASLFLVRGK---------
EFTS_SPICI      IVHAIATIGEKITLRRFKTVHLKT----DQSLGVYLHSNNRIATVLIFSGKI--------
EFTS_LACPL      VIETTQVTGEKISLRRFQVVEKGA----DQSFGSYIHNGGQIAALVVLDGA---------
EFTS_LACLA      LVQATATIGEKITFRRFAVIEKTD----AQHFGAYQHNGGKIGVVSVVEGA---------
EFTS_FUSNN      LTDLIAKIGENMSLRRLAVVVA-K----DGFVQTYSHLGGKLGVIVEMSGEPTEA-----
EFTS_BRADU      INDAIATIGENMTLRRAASLEVSQG---VVSHYVHGAVIDGAGKMGVIVALESPG-KADE
EFTS_ZYMMO      LTANIATIGENQALRRAALLEVENG---VVVPYIHNQVAPGVGKIGVLVALESEA-PSDF
EFTS_CAUVC      LTNLIATIGENMMVRRAAKWTVENG---VVASYIHNATAPDLGRIGVLVAVESTG-DKAA
EFTS_RICPR      IIDNIAIIGENLTLRRMDILEISNG---AIGSYVHNEVVPHLGKISVLVGLESNAKDKVK
EFTS_DEIRA      VAATAGKIGENIVLNRVAYLEGQQ-------VAGYVHSNGKIGVLVDLAGGD--------
EFTS_BACTN      VVDRSGITGEKMELDGYMTVEGTST------AVYNHMNRNGLCTIVAFNKNVDDQ---LA
EFTS_PORGI      ITDRIGVTGEKMELGAYEYISGASS------ISYIHPG-NKLATVAAFNEAIEHQ---MA
EFTS_CAMJE      LKSQIATIGENLVVRRFATLKAGAN---GVVNGYIHTNGRVGVVIAAACDSAEVA---SK
EFTS_RHOBA      LVNETGKVGEKIEVTNLEVVE-GEN-----LASYIHAGAKIGVLVSYKDGAKDDA---DQ
EFTS_CYAM1      ------------------------------------------------------------
EFTS_CYACA      ------------------------------------------------------------
EFTS_PHATC      ------------------------------------------------------------
EFTS_GLOVI      ------------------------------------------------------------
EFTS_CALS4      ------------------------------------------------------------
EFTS_THET8      ------------------------------------------------------------
EFTS_CHLTE      EEALKSMTGKVGEKLELKRMARLTA---EAGVLESYIHPGSQLGALIAIDTDKPA---EA
EFTS_MYCLE      IAELAAKIGEKLKLRRAAIF-NGTV---ATYLHKRAADLPPAVGVLVEYGAGTDA---AN
EFTS_STRRA      VDEANANLGEKIVLDRFAQFADGYV---LAYMHRTMPDLPPQIGVLVELDK--------P
EFTS_BIFLO      VEEAAALFGEHVKVGQFAKISGEHV---EVYAHKKSAEMPPSIVAMIATDK--------A
EFTS_TROWT      IALEAAVLGENVALRRFARVEGSRF---SVYMHRTSSDLPPQVGVILAYEG--------H
EFTS_BORBU      LKNLAATIKENIQVKKIFITKIQS---NEFVKIYLHGEQSKIGVLVKLKVNDFSKTEDKI
EFTS_TREPA      VVDLATRVRENMSLTRLALLRAGSAGAGQYLSHYVHPDK-KTGVVLSFSSDAPDVFLRSD
EFTS_CHLTR      KAVTMQTVGENIRISRAFYTPVNSG----QSVGIYSHGNGKAVAIAFLSGSE-------N
EFTS_HUMAN      PSAYSKGFLNSSELSGLPAGPDREG----SLKDQLALAIGKLGENMILKRAAWVKVPSGF
                                                                            

EFTS_COXBU      ---LAKGLAMHVAAFNP------------------------------------------Q
EFTS_NITEU      ---LGKDLAMHIAASKP------------------------------------------V
EFTS_ECOLI      ---LVKHIAMHVAASKP------------------------------------------E
EFTS_XYLFT      ---LARGIAMHVAAMNP------------------------------------------P
EFTS_BUCAP      ---TLKNIAMHIAASKP------------------------------------------E
EFTS_BLOFL      ---IIKHVAMHIAARNP------------------------------------------K
EFTS_WIGBR      ---MSKKIAMHIAASNP------------------------------------------K
EFTS_BUCBP      ---LAKEIAMHIAASNP------------------------------------------K
EFTS_MYCPN      DEQDGKHLAMHIAANSP------------------------------------------Q
EFTS_MYCGA      DKEFLKHLAMHIAASNP------------------------------------------K
EFTS_MYCPE      SSEVGKDVAMQVASMNP------------------------------------------K
EFTS_UREPA      EDEVVRNVAMHAAAMRP------------------------------------------R
EFTS_MYCPU      NEEVAKNVAMHIAAMNP------------------------------------------E
EFTS_SPICI      DETIGKQLAMHVSAMRP------------------------------------------Q
EFTS_LACPL      DSATAKDVAMHVAAINP------------------------------------------E
EFTS_LACLA      DETLAKQVSMHIAAMNPTVLSADELDSEFVKAELAQMNHKIDEDNASRVLVNKPELPHHE
EFTS_FUSNN      NLEKAKNIAMHVAAMDP------------------------------------------K
EFTS_BRADU      LAALGRQIAMHVAAANP------------------------------------------L
EFTS_ZYMMO      LESLGKQIAMHVAAATP------------------------------------------L
EFTS_CAUVC      LRELGRKIAMHVAATSP------------------------------------------L
EFTS_RICPR      LEALAKQIAVHVAGNNP------------------------------------------Q
EFTS_DEIRA      -EAKAKDVALHVAAERP------------------------------------------Q
EFTS_BACTN      -----KQVAMQIAAM-N-----------------------------------------PI
EFTS_PORGI      -----RDIAMQIAAM-N-----------------------------------------PV
EFTS_CAMJE      SRDLLRQICMHIAAM-R-----------------------------------------PS
EFTS_RHOBA      ---FFRGVSMHIAAM-K-----------------------------------------PS
EFTS_CYAM1      -QLLAKNLAMQIAACEQ-----------------------------------------VR
EFTS_CYACA      -AKLCQHIAMQIVACPE-----------------------------------------IK
EFTS_PHATC      -TDLAKNISMQIASNPE-----------------------------------------IQ
EFTS_GLOVI      -QQLVRDIAMQIAASPN-----------------------------------------VE
EFTS_CALS4      -RNFVKEICMQIAAA-N-----------------------------------------PK
EFTS_THET8      -QNLAKDLAMHIAMM-N-----------------------------------------PR
EFTS_CHLTE      -KALAKDLAMQVAAA-A-----------------------------------------PI
EFTS_MYCLE      STAAAHAAALQIAAL-K-----------------------------------------AR
EFTS_STRRA      NAEVAKGVAQHIAAF-A-----------------------------------------PK
EFTS_BIFLO      GAAVAHEAALQISAM-G-----------------------------------------AK
EFTS_TROWT      DDATARFIAQHIAFA-A-----------------------------------------PE
EFTS_BORBU      FKNFAMDLALHVAAFAP------------------------------------------V
EFTS_TREPA      VRAFAYDCCLHAAAYTP------------------------------------------R
EFTS_CHLTR      QEALAKDIAMHIVASQP------------------------------------------Q
EFTS_HUMAN      YVGSYVHGAMQSPSLHK------------------------------------------L
                        . :                                                 

EFTS_COXBU      AVSANQVSTEFVEKEKEIFLARAQET----------------------------------
EFTS_NITEU      CVSSDQVPADALERERQIFTAQAAES----------------------------------
EFTS_ECOLI      FIKPEDVSAEVVEKEYQVQLDIAMQS----------------------------------
EFTS_XYLFT      YNKVADVSAEFLEKEKEIELSKMSEKDK--------------------------------
EFTS_BUCAP      YLSPNDISDSVFKREYEIQLELAKKQ----------------------------------
EFTS_BLOFL      YVGVSNISEDIMIRERHIQMDIAKKF----------------------------------
EFTS_WIGBR      YISVKSIPNIIKENEKMIYIKSALKN----------------------------------
EFTS_BUCBP      YLRSDLVPKSIMEREYEIQLELAMQS----------------------------------
EFTS_MYCPN      FIDQDNVDQTWLANETSIIKSQAKLEVQD-------------------------------
EFTS_MYCGA      FVSQKDVSADFIAKEREIAAAQAQSENK--------------------------------
EFTS_MYCPE      FVNSSQVDKKWKDEEEKLLIQKTIEEGK--------------------------------
EFTS_UREPA      YLNEKVVDKLWLAKEREIIVNQLEHEGK--------------------------------
EFTS_MYCPU      YMSANEVPQEKIEK----LKAEFLKSPAL-------------------------------
EFTS_SPICI      FISRDDISVDFLNSEKPILTAEAKNDPKN-------------------------------
EFTS_LACPL      YVNREQVPADRLAHEKDVLVKEALNEGK--------------------------------
EFTS_LACLA      FGSKSQLTEEVLAAAKASFEEELKAEGK--------------------------------
EFTS_FUSNN      YLSEEEVTASDLEHEKEIARKQLEEEGK--------------------------------
EFTS_BRADU      ALDPSGLDPAVVKREKDVLADKYRQQ----------------------------------
EFTS_ZYMMO      ALDEDSLDDAAVERERAIAQEKAAES----------------------------------
EFTS_CAUVC      SLSPDDLDPAAIEREKAVFTEQALES----------------------------------
EFTS_RICPR      SIDTLSLDKSLIEREKKVFFEKSKEE----------------------------------
EFTS_DEIRA      FLTRDEVESGDIEKEREILTNKALAE----------------------------------
EFTS_BACTN      AIDEDGVSEEVKEKEIAVAIEKTKAEQVQKAVEAALKKANINPAHVDSEEHMESNMAKGW
EFTS_PORGI      AVLPEQVDQHIIDQELQIAREK--------ALEAGK------------------------
EFTS_CAMJE      YLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHKIPQFASRKQ---------
EFTS_RHOBA      ILHPNEFDEEFVQKETEALQAQINAENELNEKE-NLGKPMKNVPQFASRRQ---------
EFTS_CYAM1      YIEWEQIPSSVIESVKSQVAEQL-------------------------------------
EFTS_CYACA      YVKFEDIPEEIKNHYIEVESQS--------------------------------------
EFTS_PHATC      VVSLDDISDLTKIEVRKFENAK--------------------------------------
EFTS_GLOVI      FVSVDDVDQEVKDRELAIEVQR--------------------------------------
EFTS_CALS4      YISKEDVPQEVLEKEKEILRAQ--------------------------------------
EFTS_THET8      YVSAEEIPAEELEKERQIYIQA--------------------------------------
EFTS_CHLTE      EVSRDAVSTELVEKEKEIYRQQ--------------------------------------
EFTS_MYCLE      FLSRDDVPEDVLASERRIAEETA-------------------------------------
EFTS_STRRA      YLSKEDVRPDVVESERRIAEETT-------------------------------------
EFTS_BIFLO      WLTREDVPADVVESERRVATEKS-------------------------------------
EFTS_TROWT      YLSVGDIPQGILQRERDLLTEIS-------------------------------------
EFTS_BORBU      YLRNDDVCPNYIKEQEEIFTKQLESS----------------------------------
EFTS_TREPA      YVRAEDVPAEYVREQREVFQAHVASL----------------------------------
EFTS_CHLTR      FLSKESVPQEVLEREREVFSSQVAG-----------------------------------
EFTS_HUMAN      VLGKYGALVICETSEQKTNLEDVGRR----------------------------------
                                                                            

EFTS_COXBU      ----------------------GKPANIIEKMVKGQVEKLL---KEVSLEGQS-------
EFTS_NITEU      ----------------------GKPANIIEKMVEGRIAKYL---AEVTLLGQP-------
EFTS_ECOLI      ----------------------GKPKEIAEKMVEGRMKKFT---GEVSLTGQP-------
EFTS_XYLFT      ----------------------SKPADILEKIISGKINKIV---KEVTLYGQP-------
EFTS_BUCAP      ----------------------NKSSEILKKIVQGRMNKFV---NDISLVGQK-------
EFTS_BLOFL      ----------------------KKDPEILEKIVEGRMEKFM---SEIVLEKQD-------
EFTS_WIGBR      ----------------------GKTKEIAEKISNGKMKKFF---EKIALEEQF-------
EFTS_BUCBP      ----------------------KKSKPILEKIIKGRMIKFA---NEISLLGQN-------
EFTS_MYCPN      ---------------------NPKKAAFLDKTIAGRVNKLL---IDICLVNQK-------
EFTS_MYCGA      ----------------------PK--EFIDRIVDGRINKVL---EEVCLVNQK-------
EFTS_MYCPE      ----------------------PK--EFAEKIVAGRMVKML---AEVCLEEQP-------
EFTS_UREPA      ----------------------PA--AFAAKIIDGRLNKIL---KENCLVDQS-------
EFTS_MYCPU      ---------------------AGKPEKIQQSILSGMLNKAL---AEFVLLNQP-------
EFTS_SPICI      ---------------------AGKPDNILEKMVEGRLNKQL---AEISFLDQV-------
EFTS_LACPL      ----------------------PE--KIVEKMVEGRLNKWL---SEISLDDQE-------
EFTS_LACLA      ----------------------PE--KIWDKILPGKMAKFI---VDNTKVDQQFALLAQL
EFTS_FUSNN      ----------------------PA--NIIEKILTGKMHKFY---EENCLVDQI-------
EFTS_BRADU      ----------------------GKPENVIEKIVESGLKTYY---KEVCLLEQA-------
EFTS_ZYMMO      ----------------------GKPAEIVTRMVEGAVAKYR---KENALLSQI-------
EFTS_CAUVC      ----------------------GKPAAVVEKMIEGRIRKFL---EEVVLLKQA-------
EFTS_RICPR      ----------------------GKPNHIIEKMVEGRIRKFF---SEVVLLHQN-------
EFTS_DEIRA      ----------------------GKPQQIVEKIVEGQIGKFY---QERVLPEQT-------
EFTS_BACTN      ITAEDIAKAKEIIATVSAEKAAHLPEQMIQNIAKGRLGKFL---KEVCLLNQE-------
EFTS_PORGI      ------------------------PENLLDRIAQGALQKYY---KENTLLQQE-------
EFTS_CAMJE      --LSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFI---ADNSQLDSKLTLMGQF
EFTS_RHOBA      --LTPEVLAATEEAIKEELKAEGKPEKIWDKIVPGKLERFI---ADNTLLDQERCLLSQF
EFTS_CYAM1      -----------------VEQLANKPVQLRSQIVEAKVKKQL---QKQCLLDQP-------
EFTS_CYACA      ------------------KDLQDKPAQSKNKIIRGRIDKKL---RRMCLLDQA-------
EFTS_PHATC      ------------------DDLQNKPEEIKNKIVEGRVEKSL---KKQVLLEQE-------
EFTS_GLOVI      ------------------EDLLSKPEKIRAQIAQGRVDKLF---KERALLEQP-------
EFTS_CALS4      ------------------ALNEGKPANVIDRIVEGRLEKFY---KENCLLEQE-------
EFTS_THET8      ------------------ALNEGKPQQIAEKIAEGRLKKYL---EEVVLLEQP-------
EFTS_CHLTE      ------------------ALAEGKKEEFVDKIVMGRLNKYY---QEVVLTEQT-------
EFTS_MYCLE      -------------------KAAGKPEQSLPKIVEGRLNGFF---KDSVLLEQP-------
EFTS_STRRA      -------------------RAEGKPEAAIAKIVEGRVNGFF---KDATLLGQP-------
EFTS_BIFLO      -------------------LAEGKPEKIVPKIVEGRLNAFF---KEVVLLEQP-------
EFTS_TROWT      -------------------RGEGKPEEVLPQIVEGRLVKLY---KQNVLLEQD-------
EFTS_BORBU      ----------------------GKPESIIKGIVAGKIKKHL---AEISLLEQS-------
EFTS_TREPA      ----------------------QKPAHVKESIVQGKLEKHL---AEICFLKQP-------
EFTS_CHLTR      -----------------------KPQEVVEKITQGKFRAFF---QEACLLEQA-------
EFTS_HUMAN      ---------------------LGQHVVGMAPLSVGSLDDEPGGEAETKMLSQP-------
                                                  . .              .        

EFTS_COXBU      FVKDPEKLVGDLLK------AEKAKVLAFLRFEVGEGVEKE-SQNFADEVMAQVQGNR
EFTS_NITEU      FVKDPDQTIEKLLK------TKSAKVSGFTLYIVGEGIEKK-SDDFAAEVMAQVTQSK
EFTS_ECOLI      FVMEPSKTVGQLLK------EHNAEVTGFIRFEVGEGIEKV-ETDFAAEVAAMSKQS-
EFTS_XYLFT      YVLNPDQSVEQVVK------AAGADVIGFQRMEVGEGIEKI-VEDYASEVMKQAGLS-
EFTS_BUCAP      FIMDNTKTVGALLN------EYNARIISFIRFEIGDKIFN------------------
EFTS_BLOFL      FVMDINRTVGSILD------EYCIKINNFVRFEIGDNN--------------------
EFTS_WIGBR      FIFDDTKKIKNIIN------ERNIYIKKFIRFEVGENFYPV-I---------------
EFTS_BUCBP      FIFDPHRKVSEVIL------KNNIDVISFVRYEVGEKYI-------------------
EFTS_MYCPN      YLVDESKTVGQFLK------EKNSKVIHFVRFEVGEGIVKE-AVDFASEVSAQMKK--
EFTS_MYCGA      FLVNQEQTVQQAAQ------AKKVEILSFIRYEVGEGIEKQ-VSNFADEVKAQMK---
EFTS_MYCPE      FIKDNGITIIKYLKQ-----NKANKVLEMVRFEVGEGIEKQ-EANFADEVKAQMKK--
EFTS_UREPA      YFKQPELTIEKYLKN-----NNAVAV-GYFSYEVGEGIEKAPQMSFADEVAAQMKK--
EFTS_MYCPU      FVMESSLSVEQYLK------NNKSEALEMIRYEVGEGIEKK-AVDFASEVAAQMKK--
EFTS_SPICI      FVVNPDQKISDVIK------ANNVNVVDMIRYEVGEGIEKE-ELDFASEVMAQVLK--
EFTS_LACPL      FVKDSDQTVAHFVE------SKGGKVSSFIRFEVGEGIEKK-ADNFIDEVMNQIKD--
EFTS_LACLA      YIMDDSKTVEAFLE------SKGAKAIAFTRFEVGEGIEKA-ETDFAAEVEAAKAGL-
EFTS_FUSNN      YVRAENK--ETVKQY-----AGDIKVLSFERFKVGDGIEKR-EEDFAAEVAAQING--
EFTS_BRADU      FIHDTGKSVAQAVKEAEGKVGGAVKIAGFVRYALGEGIEKQ-ESDFAAEVAAASGKK-
EFTS_ZYMMO      FVVDGKTRVSDVVSKAAKETGKPITLKQFVRFQLGEGIEKQ-ETDFAAEVAAAAGV--
EFTS_CAUVC      FVMNPDQTVEQLVAETAKTLGAPVAVKGFTRLALGEGVEKK-QDDFAAEVASMTGQA-
EFTS_RICPR      FLFEPKLTVAEVIKNAEQELSAEIKITKFIRYALGEGIEHA-EKNFADEVAAITQC--
EFTS_DEIRA      FVKDNSLTVAKYLG--------DASVNKFVRFEIGA----------------------
EFTS_BACTN      DIMDAKKTVREVL----AAADPELKVLDFKRFTLKAE---------------------
EFTS_PORGI      FVKDSKLTIEQYL----HTGSKTLTVVGFKRFTLNAD---------------------
EFTS_CAMJE      YVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL-----
EFTS_RHOBA      YALDDTKTVEAAI----KEFHPEAEVVAFKRISVN-----------------------
EFTS_CYAM1      FIKDEQLTVDEVIRTTIAQVGENIRLKRFARFVLGEETGEETGEETND----------
EFTS_CYACA      NIKDDKVTVNDLIKEKINKFKENIQINRFARFTIGEKI--------------------
EFTS_PHATC      YIRDPNITVTEYIKQVVSILGENIRVQRFTRYVLGEID--------------------
EFTS_GLOVI      FIKDQSISVGELITQKIAKIGENIKVRRFARFVLGEGLEKEEKNFAEEVAAQTGSV--
EFTS_CALS4      YIRDPEKTVKDLLNEMIAKLGENIVIRRFARFERGEGIEK------------------
EFTS_THET8      FVKDDKVKVKELIQQAIAKIGENIVVRRFCRFELGA----------------------
EFTS_CHLTE      FIKDQNTKVSGVLDDFMKKNQAQVKVKAFVRYQLGA----------------------
EFTS_MYCLE      SVFDNKKTVKVLLD------EAGVTVTRFVRFEVGQA---------------------
EFTS_STRRA      YALDNKKSVQKVLD------EAGVTLKRFTRIKVGI----------------------
EFTS_BIFLO      FVKDPSKTVGDLFK------EVGGNATAFARVEVGKGEEE------------------
EFTS_TROWT      YVRDNKVTISKVLE------ATGLRVISFARFRVGT----------------------
EFTS_BORBU      FVKNDKITVKEMLEEISKAISSKVEMVEFKYLRIG-----------------------
EFTS_TREPA      FVKDDKLSVEKKMAEVGARAGGALRFTQALIYQLGVQ---------------------
EFTS_CHLTR      FIKDPEVTIQGLIDRAAKASGEPLKVEHFVFWKMGA----------------------
EFTS_HUMAN      YLLDPSITLGQYVQ------PQGVSVVDFVRFECGEGEEAAETE--------------