CLUSTAL format seed alignment for MF_00052_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RNH2_BORBU      ------------------------------------------------------------
RNH2_THEMA      ------------------------------------------------------------
RNH2_BACHD      MSKRLSIKEIDALLRQGDASIDETFLAMLKADERKGVQSALKRYERQLEKEKALWMEHEE
RNH2_BACSU      --MNTLTVKDIKDRLQEVKDAQDPFIAQCENDPRKSVQTLVEQWLKKQAKEKALKEQWVN
RNH2_AQUAE      ------------------------------------------------------------
RNH2_CHLMU      -----------------------------------------------MKSIVEQELLFRE
RNH2_CHLTR      -----------------------------------------------MKSTVEQAMLFEE
RNH2_CHLPN      -----------------------------------------------MNTSISEIQRFLS
RNH2_RICPR      ----------------------------------------------------------ME
RNH2_STRCO      -----------------------------------------------------MPYEPPT
RNH2_SYNY3      ------------------------------------------------------------
RNH2_BRUME      ----------------------------------------MKRSASDSPLLFDLPLAPDF
RNH2_MAGSA      --------------------------------------------------------MPDL
RNH2_ECOLI      ------------------------------------------------------------
RNH2_VIBCH      -------------------------------------------------------MAKKP
RNH2_HAEIN      ------------------------------------------------------------
RNH2_NEIMA      ------------------------------------------------------------
RNH2_NEIMB      ------------------------------------------------------------
RNH2_XYLFA      -------------------------------------------------------MVSQF
RNH2_MYCLE      ---------------------------------------MATTWPPCRIIRKSGGLRGMW
RNH2_MYCTU      ---------------------------------------MTKTWPPRTVIRKSGGLRGMR
RNH2_HELPY      ------------------------------------------------------------
RNH2_HELPJ      ------------------------------------------------------------
RNH2_CAMJE      ----------------------------------------------------------MK
                                                                            

RNH2_BORBU      --------------MICGIDEVGRGCIFGPILSAAVVFKKKPS---FIKELDDSKKLKKE
RNH2_THEMA      --MGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKE------IEGINDSKQLSPA
RNH2_BACHD      MLAYEKDLWAKGYEHVAGLDEVGRGPLAGPVVTAAVILPKDV----QLPGLTDSKKLAKE
RNH2_BACSU      MTSYERLARNKGFRLIAGVDEVGRGPLAGPVVASAVILPEEC----EILGLTDSKKLSEK
RNH2_AQUAE      MLNYELELWEKGL-LVAGVDEAGRGPLAGPVVAAAVILPPFT----EPFIKGDSKKLTKK
RNH2_CHLMU      KSVFEDQAIKQGYSRIAGVDEAGRGPLAGPVVAGACILPGGK----LFLGIDDSKKLSPK
RNH2_CHLTR      KSIFENQAIEQGYSQVAGVDEAGRGPLAGPVVAGACILPRGK----VFLGIDDSKKLTPK
RNH2_CHLPN      MIAFEKELVSEDFSVVAGIDEAGRGPLAGPVVASACILPKGK----VFPGVNDSKKLSPK
RNH2_RICPR      VNLLQYEKKYHNY-IVAGVDEAGRGSLVGPVVASAVIIDKAD----IIPGIKDSKKLSKN
RNH2_STRCO      HTVERSLRATTGAKIIAGVDEVGRGAWAGPVTVCAAITGLRR----PPVGLTDSKLLTIK
RNH2_SYNY3      ---------------MAGVDEVGRGALFGPVVAAAVLVPIEAINQLQALGVKDSKQLSPQ
RNH2_BRUME      SQEQQ--LMKRGLKHIAGIDEAGRGPLAGPVVAAAVVLDQNDLP----EGLDDSKRLTAA
RNH2_MAGSA      ALEFE--IGG----IVCGIDEVGRGPLAGPVVAAAVILDPARLPKTLLERLDDSKKLSKR
RNH2_ECOLI      MIEF----VYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARP----IAGLNDSKKLSEK
RNH2_VIBCH      SIELPPFEIPAGYALIAGVDEVGRGPLVGDVVTAAVILDPNRP----IMGLNDSKKLSEK
RNH2_HAEIN      MFEY-----PQGYKLIAGVDEVGRGPLVGAVVTAAVILDPHNP----IEGLADSKKLSEK
RNH2_NEIMA      -----------MHILTAGVDEAGRGPLVGSVFAAAVILPETFD----LPGLTDSKKLSEK
RNH2_NEIMB      -----------MHILTAGVDEAGRGPLVGSVFAAAVILPETFD----LPGLTDSKKLSEK
RNH2_XYLFA      DTQHLP---SSNTALVAGVDEAGRGPLAGPVVVAAVVFDPSQPR---INGLNDSKQLSPA
RNH2_MYCLE      TLEYELQ--RSGLGPVAGVDEVGRGACAGPLVVAACVLGPGRLE----ESLDDSKKLSAK
RNH2_MYCTU      TLESALH--RGGLGPVAGVDEVGRGACAGPLVVAACVLGPGRIAS--LAALDDSKKLSEQ
RNH2_HELPY      ---------MGCVSMTLGIDEAGRGCLAGSLFVAGVACNEKTALEFLKMGLKDSKKLSLK
RNH2_HELPJ      ---------MGCVSMTLGIDEAGRGCLAGSLFVAGVVCNEKIALEFLKMGLKDSKKLSPK
RNH2_CAMJE      TLFDTKELLNEFDINLIGIDEAGRGALAGPMMMAACKLNKQLD------GLCDSKKLSEK
                                 *:**.***   * :   .                 *** *   

RNH2_BORBU      KREYLSSLILENS--YYAFAEISNITIEKINIHNASLLAMQTAYENLKLNCSLVLVDGKF
RNH2_THEMA      KRERLLDEIMEKA--AVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKG
RNH2_BACHD      TRESFYDRIKEVA-LAWSVAIVPVTVIDEVNIYQATKQGMMSAIDQLSVNPDALLLDAMN
RNH2_BACSU      KREEYYELIMKEA-LAVGIGIVEATVIDEINIYEASKMAMVKAIQDLSDTPDYLLVDAMT
RNH2_AQUAE      EREEAYEEIKNKA-LAVGTAVVDSAVIDRVNILRATKLAMKRALKDLKYHYDIVITDYVK
RNH2_CHLMU      QRRYLYELLLEDPEVTCGVGVVSVERIDEINILEATKEAMVQAIASLRSTPDFLLVDGLF
RNH2_CHLTR      QRRYLYELLLEDPEVDCGVGVISVERIDEINILEATKEAMVQAIASLRSTPDFLLVDGLF
RNH2_CHLPN      QRAQVRDALMQDPEVCFGIGVISVERIDQVNILEATKEAMLQAISSLPISPDILLVDGLY
RNH2_RICPR      KREILYERITSN--YVWSTAIIAHTEIDNINILEATKKACAIAVANLSLKPQKILVDGNM
RNH2_STRCO      RRTELEVELRTWV-TSYALGHASPEEIDAMGMTAALRLAAVRALGTLPVRPDAVILDGKH
RNH2_SYNY3      HRSQLAQALPDYV-HSYGISFADVPTINRVNIRQASLLAMERAVQKLPVMPAWVLVDGRD
RNH2_BRUME      RREALYEIILTKA-ITVSVASLSARSIDASDIRKAALEAMRRAVIGLTLKPCHALVDGRD
RNH2_MAGSA      NREELAELVPATA-I-LGFGEASVEEIDRINILQATFLAMRRAYDALGRECAHALVDG-N
RNH2_ECOLI      RRLALYEEIKEKA-LSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEYVLIDGNR
RNH2_VIBCH      KRLALFPEIQVKA-LAWAVGRCSPQEIDELNIFQATMVAMQRAVAGLRIQPDLVLIDGNK
RNH2_HAEIN      KRLALAEEIKEKA-RAWALGRAEADEIDEINILQASLLAMTRAVKSLKIQPHFVLIDGNK
RNH2_NEIMA      KRDALAEMIKNQA-VAWHVAAAGPEEIASLNILHATMLAMKRAVDGLAVRPEKIFIDGNR
RNH2_NEIMB      KRDALAEMIKNQA-VEWHVAAASPEEIASLNILHATMLAMKRAVDGLAVRPEKIFIDGNR
RNH2_XYLFA      CRERLYAHIVERA-LAYKVVMIDSTQIDTLNIYQATMLGMRLAVEGVAHVAKSARIDGNR
RNH2_MYCLE      GREMLFPLICRYA-LAYHVVFIPSVEVDRHGVQVANIEGMRRAVAGLSVRPGYVLSDGFR
RNH2_MYCTU      AREKLFPLICRYA-VAYHVVFIPSAEVDRRGVHVANIEGMRRAVAGLAVRPGYVLSDGFR
RNH2_HELPY      KRFFLEYKIKTHGEVGFFVVKKSANEIDSLGLGACLKLAVQEILENGCSLVDEIKIDGNT
RNH2_HELPJ      KRFFLEDKIKTHGEVGFFVVKKSANEIDHLGLGACLKLAIEEIVENGCSLANEIKIDGNT
RNH2_CAMJE      KREELYEIIIKNSN--YLILAFSSEQIDALGLSTCLKKGLK-LIKKHFKTENNFLYDGNT
                 *      :                 :   .:  .   .                 *   

RNH2_BORBU      VPKIT--AKNVKAIIKGDSIIDEIKAASIIAKVKRDKLMDKYDKIYPLYLLKKNKGYPTK
RNH2_THEMA      IELSV--PGT--CLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATK
RNH2_BACHD      LPL----SLPQQSLIKGDQKSLSIAASSVLAKVTRDRYMADLANRYPEYGFERHVGYGTE
RNH2_BACSU      LPL----DTAQASIIKGDAKSVSIAAGACIAKVTRDRMMSAYAETYPMYGFEKNKGYGTK
RNH2_AQUAE      LEG----EN-CMPLVKGDEKSLNCACASIIAKVIRDKIMEIYHKIYPDFNFASNKGYPSK
RNH2_CHLMU      LPH----EIPCLKIIKGDSRSVSIAAASIIAKEYRDELMRKLHSEYPEYGFDKHKGYGTV
RNH2_CHLTR      LPH----KVPSLKIIKGDARSVSIAAASIIAKEYRDELMRKLHVEYPEYGFDKHKGYGTA
RNH2_CHLPN      LPH----DIPCKKIIQGDAKSASIAAASILAKEHRDDLMLQLHRLYPEYGFDRHKGYGTS
RNH2_RICPR      KFS----DIRFISIINGDNLSLSIAAASIIAKVTRDRLMLELSAEFPQYLWHKNYGYGTR
RNH2_STRCO      DYLGA--PWRVRTVIKGDQSCIAVAAASVLAKVQRDKMMAELGVDHADFGFADNAGYPSP
RNH2_SYNY3      TLPHI--AMAQMAVTGGDRKSLLISAASILAKVWRDTLITRLAERFPGYDLASNKGYGTA
RNH2_BRUME      VPPGL--PCPGSALVKGDQRSVSIAAASIVAKVTRDRMMIRAGAAHPPYGLEIHAGYATQ
RNH2_MAGSA      RPPGL--PCPVRCVVGGDGISLSIAAASVVAKVRRDAMMADLARAHPEFGWERNAGYGTA
RNH2_ECOLI      CPK-L--PMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHKGYPTA
RNH2_VIBCH      IPK-L--PMEAQAVVKGDLRVAQISAASIIAKVIRDQEMEALDKQYPQFGFAKHKGYPTA
RNH2_HAEIN      IPKDL--AIPAQAVVKGDSLVAEISAASILAKVARDQEMEELDKQYPEYAFAQHKGYPTK
RNH2_NEIMA      IPEHL--NIPAEAVVKGDSKIIEISAASVLAKTARDAEMYALAQRHPQYGFDKHKGYGTK
RNH2_NEIMB      IPEHL--NIPAEAVVKGDSKIIEISAASVLAKTARDAEMYALAQRHPQYGFDKHKGYGTK
RNH2_XYLFA      LPKNL--PCPAEALVGGDARDRTIMAASILAKVTRDRHMVELHLQYPHYGFDKHKGYGTP
RNH2_MYCLE      VPG-L--SVPSLPVVGGDAVVACIAAASVLAKVSRDRLMVAMDADYPGYGFAAHKGYCTR
RNH2_MYCTU      VPG-L--PMPSLPVIGGDAAAACIAAASVLAKVSRDRVMVALDADHPGYGFAEHKGYSTP
RNH2_HELPY      AFGLNKRYPHIQTIIKGDETIAQIAMASVLAKAFKDREMLELHALFKEYGWDKNCGYGTK
RNH2_HELPJ      AFGLNKRYPNIQTIIKGDETIAQIAMASVLAKASKDREMLELHALFKEYGWDKNCGYGTK
RNH2_CAMJE      NLGIN----GIKTQIKADTSILQVSAASILAKVSKDRVMNFLAKDFPCYEFEKNKAYGTK
                                .*        .: :**  :*  :      .  :    : .* : 

RNH2_BORBU      EHKNAIKKYGVLSL-HRKNFKLI-------------------------------------
RNH2_THEMA      EHLNEIRKNGVLPI-HRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVV
RNH2_BACHD      EHLAALNAHGITPE-HRRSFRPVQETAATRQTS---------------------------
RNH2_BACSU      EHLEALAAYGPTEL-HRKTFAPVQSFR---------------------------------
RNH2_AQUAE      THLEKVEKGEYTEI-HRKSFSPLKKKLF--------------------------------
RNH2_CHLMU      AHLQALKQFGPCVY-HRKSFSPVKESIREGICQ---------------------------
RNH2_CHLTR      AHLQALKHFGPCVY-HRKSFSPVKESIQEGVCQ---------------------------
RNH2_CHLPN      LHVEAIRRYGPSPC-HRKSFSPIKQMCAIV------------------------------
RNH2_RICPR      EHIEAIKTHGLSSY-HRRSFKSC-------------------------------------
RNH2_STRCO      VHKAALEERGPTPH-HRLSWAYLDALPQWRHLKKVRSWVEGSVPEIEGQLGFDF------
RNH2_SYNY3      KHRQGLRQYGATPL-HRPLFCRKIIENPD-------------------------------
RNH2_BRUME      KHRAAIESEGPVPGLHRYTFAPIKGRFDC-------------------------------
RNH2_MAGSA      EHLDALKRLGPTPH-HRRSFAPVAQYMLF-------------------------------
RNH2_ECOLI      FHLEKLAEHGATEH-HRRSFGPVKRALGLAS-----------------------------
RNH2_VIBCH      AHFAAIEQHGVIEQ-HRKSFGPVKRALGIE------------------------------
RNH2_HAEIN      LHLEKLAELGALPQ-HRRSFAPVKKALEQF------------------------------
RNH2_NEIMA      QHLEALEKYGVLPE-HRRDFAPVRNLLAQQALF---------------------------
RNH2_NEIMB      QHLEALEKYGVLPE-HRRDFAPVRNLLAQQALF---------------------------
RNH2_XYLFA      AHLAALAEHGPCLE-HRRSFAPVRKMLTLEAIHARQSTHQHNENSPTKAAFNMLLERDD-
RNH2_MYCLE      AHSLALTQLGPCPE-HRYSFINVRRIVTRSNTRAVAGFTPAPPAEHGECR----------
RNH2_MYCTU      AHSRALARLGPCPQ-HRYSFINVRRVASGSNTAEVADGQPDPRDGTAQTGEGRWSKSSHP
RNH2_HELPY      QHIEAIIKLGATPF-HRHSFTLKNRILNPKLLEVEQRLI---------------------
RNH2_HELPJ      QHIEAINKLGATPF-HRHSFTLKNRILNPKLLEVEQRLV---------------------
RNH2_CAMJE      AHKEFIAKFGICKL-HRKSFKLL-------------------------------------
                 *   :         **  :                                        

RNH2_BORBU      -------------
RNH2_THEMA      FRKERTNHNLPLF
RNH2_BACHD      -------------
RNH2_BACSU      -------------
RNH2_AQUAE      -------------
RNH2_CHLMU      -------------
RNH2_CHLTR      -------------
RNH2_CHLPN      -------------
RNH2_RICPR      -------------
RNH2_STRCO      -------------
RNH2_SYNY3      -------------
RNH2_BRUME      -------------
RNH2_MAGSA      -------------
RNH2_ECOLI      -------------
RNH2_VIBCH      -------------
RNH2_HAEIN      -------------
RNH2_NEIMA      -------------
RNH2_NEIMB      -------------
RNH2_XYLFA      -------------
RNH2_MYCLE      -------------
RNH2_MYCTU      ATMRATGRAQGT-
RNH2_HELPY      -------------
RNH2_HELPJ      -------------
RNH2_CAMJE      -------------