CLUSTAL format seed alignment for MF_00054_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EFG2_ANADE            ------------------------------------------------------------
EFG1_DESPS            ------------------------------------------------------------
EFG1_BORBU            ------------------------------------------------------------
EFG1_BORBP            ------------------------------------------------------------
EFG2_TREDE            ------------------------------------------------------------
EFG1_TREPA            ------------------------------------------------------------
EFG1_SYNAS            ------------------------------------------------------------
EFG2_BDEBA            ------------------------------------------------------------
EFG1_MYXXD            ------------------------------------------------------------
EFGM_DICDI            -----------MTSFLTSRF-----------------------GGLALR--------NVM
D3BMN4_POLPP          -----------MASLLFSRSLVSRSSTSASANVGSVTNFMAVGGGSKLP--------TNY
EFGM_CRYNJ            -----MSAIARAAARVRQQNTTPLQRPLLLQRKPVLTHTLALHASPLKP--------SLA
EFGM_USTMA            -----MVAIPRVAA-ARSLARQLARQSLRTTSFASAPVRIAIASTPLAR--------SPS
EFGM_COPC7            --MFLGRAASRTCRHSQPLRVAARAKSTTTAVASSSWHQYGVTGGILAS--------TSS
EFGM_SCHPO            ---------------------------MLKLSFRSLTSRLPRLSTLVVR--------GYA
F4NY64_BATDJ          -----------------------------------MSCYFTQCSHHIYT--------TIS
D0NCX8_PHYIT          -----------------MRWLQLSRASAGLRRSSPTTLRMRPTSSLLSR--------SFS
EFGM1_ARATH           ---------------------------MARFPTSPAPNRLLRLFSSNKR--------SSS
EFGM2_ARATH           ---------------------------MARFPTSPAPNLLLRLFSSNKR--------ASS
D7SLS6_VITVI          ---------------------------MAPSARSPAIRLLYTLSSALK---------TTS
M1CGG0_SOLTU          ---------------------------MARSARSSTTRLFYTLCSSTKRTPLTPQHPPPT
EFGM_ORYSJ            -------------------------MAMARRSASRLLSSFRPFSLLLQP-------LDDA
I1GYK4_BRADI          -------------------------MAMARRSASHLLCSFRPFSLLLQP-------LTDA
C5WSZ1_SORBI          -------------------------MAMARRSASHLLSSFRPFSLLLQPH------LADS
A9RPB9_PHYPA          -----------------MARVTARLLALVRSSVSVAPCLPDPALSSSLWS----SGSRYS
A9SP22_PHYPA          -----------------MARVIARLLARARCSVSVAPCHPDSALASSLWS----SGPRHS
EFGM_COCIM            MSVHTVMRTQVRSLAGMPKAAMRPLGNSFCARRYLSAAPLRSIPAAPTRLPLNRRWEP-K
C0NUK7_AJECG          MRAHSVFRTQVRSLTRPSGVSTKLQCGVY--RRCITTAPLRSFATIPRSAPVIGRWQQ-V
EFGM_EMENI            MRCPSLARLPHRAVSGLTRTPVRFQSQAFLTARCASTAALRS--ATPVHQSVLNRRYQQT
EFGM_ASPFU            MRCPSLARLPNRALSGLTRSPVRLQSQNFLYQRCASTAALRSPIAGPAYQSVFHRHNLQR
EFGM_SCLS1            MSMHRVARAVASSEACAGALRGSVSRTRFL-CLNAPVQRFGARNALLGAGLGAKRHFFQS
C7YWN8_FUSV7          MRATRAARWLNCRLLFGTQQQ----------SCGSHFFNVSPAVPAWESRRAFSQT----
I1RCR5_GIBZE          MRATRAARWLNSRLILGAQQS----------SCGSHSFTISAAAPAWESRRAFSQT----
EFGM_NEUCR            MRVIRAVATLHAGRAAAVRQGVRSVSLGAC-RAAVETPSLRSAGSQFESRRLFSRSSYLR
EFGM_ASHGO            --------------------------------MLERAALLHRLRLPAHSLPFIYNGALFG
EFGM_YEAST            --------------------------------MSVQKMMWVPRKMVGGRIPFFTCSKVFS
EFGM_CANAL            ---------------------------------MASVLRGVFKTHLPRTLTRPKCARTFQ
EFGM_YARLI            ---------------------------------MIRSLRAVSR----------LGARGFS
G3QKQ5_GORGO          ------------------------------------MRLLGAAAVAA-------------
A0A2I3T1A0_PANTR      ------------------------------------MRLLGAAAVAA-------------
EFGM_HUMAN            ------------------------------------MRLLGAAAVAA-------------
G1QVZ1_NOMLE          ------------------------------------MRLLGAAAVAA-------------
EFGM_PONAB            ------------------------------------MRLLGAAAVAA-------------
F6QKI2_CALJA          ------------------------------------MRLLGTAAVSA-------------
H0UVN5_CAVPO          ------------------------------------MRVLGAATAVA-------------
G1T5N5_RABIT          ------------------------------------MKLLGAAAAVA-------------
G1M4M7_AILME          ------------------------------------MRLLGAAAAAA-------------
M3WIL3_FELCA          ------------------------------------MRLLGAAVAAA-------------
G1NTB9_MYOLU          ------------------------------------MRLLGAAFASA-------------
H0WY66_OTOGA          ------------------------------------MRLLGTAAAAA-------------
EFGM_MOUSE            ------------------------------------MRLLRVAAALG-------------
EFGM_RAT              ------------------------------------MRLLRITAGLG-------------
F7EHU0_MONDO          ------------------------------------MWLLRIRTALR-------------
G1KFW0_ANOCA          ------------------------------------------------------------
F6Q9W5_XENTR          ------------------------------------MRLLREASKLG-------------
H3AWE2_LATCH          ------------------------------------MRLLRAAVLFG-------------
H3CQL2_TETNG          ------------------------------------MRLLKTGLSLAN------------
I3J7A5_ORENI          ------------------------------------MRVLKAGMFLAK------------
G3P617_GASAC          ------------------------------------MRLLKAGLCLAK------------
EFGM_DANRE            ------------------------------------MRLLRAASSLAR------------
C3ZDC2_BRAFL          ------------------------------------MSLLRATLVLT-------------
EFGM_ANOGA            ---------------------------------MTISNLIRSRCSLA-------------
W5JI53_ANODA          ---------------------------------MTISSLIRSRCTLA-------------
EFGM_AEDAE            ---------------------------------MTISSFLRVRHSLA-------------
EFGM_DROME            ---------------------------------MSLITRLLTGNNTL-------------
EFGM_DROPS            ---------------------------------MSLITRVLQGNLT--------------
E9G149_DAPPU          -----------------------------MFPHITATCLLRSAKCALR------------
A0A087ZTR9_APIME      ---------------------------------MSIITVLRHDINLKS------------
E0VF81_PEDHC          ------------------------------------MSVIQNILKDV-------------
EFGM_NEMVE            ---------------------------------MGIITLLANRRGLH-------------
F6UKC4_CIOIN          ------------------------------MVQFSFIKLLNLSARQQ-------------
EFGM_CAEBR            ---------------------------------MSPLGRFSAVAQSR-------------
EFGM_CAEEL            ---------------------------------MSPLGRFSAVAQSR-------------
A0DGW7_PARTE          -----------------------------------MNNIFRFKSFM--------------
A0C9U4_PARTE          -----------------------------------MNNIFRFKSFM--------------
Q22AK9_TETTS          ----------------------------------MFGRLFAHQSKLIGA-----------
EFG1_ANADE            ------------------------------------------------------------
EFG2_MYXXD            ------------------------------------------------------------
EFG_KORVE             ------------------------------------------------------------
EFG_SOLUE             ------------------------------------------------------------
EFG2_GEOSL            ------------------------------------------------------------
EFG2_PELCD            ------------------------------------------------------------
EFG_MAGMM             ------------------------------------------------------------
EFG_CHLAA             ------------------------------------------------------------
EFG_HERA2             ------------------------------------------------------------
EFG_DEHM1             ------------------------------------------------------------
EFG_GLOVI             ------------------------------------------------------------
EFG2_SYNY3            ------------------------------------------------------------
EFG_DEIRA             ------------------------------------------------------------
EFG_ENTFA             ------------------------------------------------------------
EFG_OENOB             ------------------------------------------------------------
EFG_MESFL             ------------------------------------------------------------
EFG_MYCPN             ------------------------------------------------------------
EFG_MYCA5             ------------------------------------------------------------
EFG_CLOAB             ------------------------------------------------------------
EFG_LACP7             ------------------------------------------------------------
EFG_FINM2             ------------------------------------------------------------
EFG_MOOTA             ------------------------------------------------------------
EFG_ECOLI             ------------------------------------------------------------
EFG_WIGBR             ------------------------------------------------------------
EFG_HYDCU             ------------------------------------------------------------
EFG_FUSNN             ------------------------------------------------------------
EFG_SULSY             ------------------------------------------------------------
EFG_PARUW             ------------------------------------------------------------
EFG_ENDTX             ------------------------------------------------------------
EFG_CUTAK             ------------------------------------------------------------
EFG1_STRCO            ------------------------------------------------------------
EFG_BIFAA             ------------------------------------------------------------
EFG_DESAG             ------------------------------------------------------------
EFG_PARD8             ------------------------------------------------------------
EFG_SULMW             ------------------------------------------------------------
EFG_SALRD             ------------------------------------------------------------
EFG_CHLT3             ------------------------------------------------------------
EFG_GLUOX             ------------------------------------------------------------
EFG2_HAHCH            ------------------------------------------------------------
EFG1_METCA            ------------------------------------------------------------
EFG1_SYNY3            ------------------------------------------------------------
EFG_HYPNA             ------------------------------------------------------------
EFG_RHORT             ------------------------------------------------------------
EFG_NEOSM             ------------------------------------------------------------
EFG_PSELT             ------------------------------------------------------------
EFG_THEMA             ------------------------------------------------------------
EFG_PETMO             ------------------------------------------------------------
EFG1_SYNWW            ------------------------------------------------------------
EFG2_SYNWW            ------------------------------------------------------------
EFG1_BDEBA            ------------------------------------------------------------
EFG2_DESPS            ------------------------------------------------------------
EFG1_GEOSL            ------------------------------------------------------------
EFG1_PELCD            ------------------------------------------------------------
EFG2_SYNAS            ------------------------------------------------------------
EFG3_MYXXD            ------------------------------------------------------------
EFG2_STRCO            ------------------------------------------------------------
EFG2_BORBU            ------------------------------------------------------------
EFG2_BORAP            ------------------------------------------------------------
EFG2_BORBP            ------------------------------------------------------------
EFG1_TREDE            ------------------------------------------------------------
EFG2_TREPA            ------------------------------------------------------------
EFG_CARRP             ------------------------------------------------------------
EFG_RHOBA             ------------------------------------------------------------
K2LYN2_TRYCR          ------------------------------------------------------------
Q38BA0_TRYB2          ------------------------------------------------------------
A4ICS8_LEIIN          ------------------------------------------------------------
Q4Q219_LEIMA          ------------------------------------------------------------
A4HNR7_LEIBR          ------------------------------------------------------------
Q7RFK0_PLAYO          ----------------------------------------------------------MM
A5K8J4_PLAVS          -----------------------------------------------------------M
A0A1Y3DJ13_PLAKN      -----------------------------------------------------------M
A7AM19_BABBO          ------------------------------------------------------MCTAYG
Q4MYM5_THEPA          ---------------------------------------MLRCGNAVIYRNFLILPKISQ
                                                                                  

EFG2_ANADE            ----------------------------------------------MYTDFSKLRNIGIS
EFG1_DESPS            ----------------------------------------------MSKDLSKVRNIGIS
EFG1_BORBU            ------------------------------------------------MDYNKLRNIGIS
EFG1_BORBP            ------------------------------------------------MDYNKLRNIGIS
EFG2_TREDE            ----------------------------------------------MGNDISKMRNIGIS
EFG1_TREPA            ----------------------------------------------MSRGISTFRNIGIS
EFG1_SYNAS            ----------------------------------------------MKNDIKKVRNIGIS
EFG2_BDEBA            --------------------------------------------MSKKWNIDMVRNIGIS
EFG1_MYXXD            --------------------------------------------MAANAPIEKIRNIGIS
EFGM_DICDI            N---------------------NKNGINS-----------FGLRCFSTNSVSGLRNIGIS
D3BMN4_POLPP          L---------------------FSNGIRSGM--------VNSIRPYSTNDIQKMRNIGIS
EFGM_CRYNJ            TSITSPNFQQSFQRRWASASATAEEGAKEEV---WPQRKLPELTETDKLRLRRQRNVGIS
EFGM_USTMA            SFRSLSSSTRRSAAAAAAAAAAKATPAHDDS---HTP--MAVLTEADLGRLVRQRNVGIS
EFGM_COPC7            SSRTVVNPAKQRRWVRMASTATATKPTEEASSSDQPPAPAHKLTDNDVKRLTFQRNIGIS
EFGM_SCHPO            S---------------VANTGIEASNTSENN-----LNIQEQLNDNDKKRLKQIRNIGIS
F4NY64_BATDJ          K----------------------------------------SLNPCQVIRFQHLRNIGIS
D0NCX8_PHYIT          A----------------AMSDADVPPFAPGF-------------PVPEGYMNNLRNIGIS
EFGM1_ARATH           PTAALLTGDFQLIRHFSAGTAARVAKDEKE--------------PWWKESMDKLRNIGIS
EFGM2_ARATH           PTAALLTGDFHLIRHFSAGTAARAVKDEKE--------------PWWKESMDKLRNIGIS
D7SLS6_VITVI          --SPLLTG---HRRTFSAGNPARVEA------------------TWWKESMERLRNIGIS
M1CGG0_SOLTU          PVAALLAGNF-QLRHYAAGSATARVREEKD--------------AVWRESLEKVRNIGIS
EFGM_ORYSJ            PSLSAAAAAASARRGMSSASALRAR-DEKEV-------------ARWRESMDRMRNIGIS
I1GYK4_BRADI          PTPAAAAAAASARRAMSSASALRARGDDKEL-------------ARWRESMDRMRNIGIS
C5WSZ1_SORBI          PSPAAAAAAASARRAMSAASALRAR-DEKDV-------------ARWRESMARMRNIGIS
A9RPB9_PHYPA          IRPCFDFTPYGLLRRHLAGLASPVETREQS----------------WRENMEKIRNIGIS
A9SP22_PHYPA          IRPCFDSTPHGLLRRHLAGVANPVEVREQL----------------WRENMEKIRNIGIS
EFGM_COCIM            RHSSSATAAAVLEQAAAQPETLSQDAIIESMD------------PAEAARISKVRNIGIA
C0NUK7_AJECG          RYSSAA--ASVLEQAAADPTTLTQSAIIENMD------------EAEMNRLSKVRNIGIA
EFGM_EMENI            RNASG-TAAAVLEAAAQTPDSLSQEAIIENLD------------PVEAERLSRVRNIGIA
EFGM_ASPFU            RNASAATTAAVLEAAASNPDGLSQEAIIDNLD------------PAEAIRLSRLRNIGIA
EFGM_SCLS1            PIIRSGVAQAVLEKAAADPSALTQEAIVDNLN------------AAERDRLRRVRNIGIA
C7YWN8_FUSV7          KRTRSAAQDALKKAQEDAAS-LTPEYVAANMD------------PEEAKRLSRVRNIGIA
I1RCR5_GIBZE          KRVCNAAQEALKKAQEDAAS-LTPEYVAANMS------------TEEAKRLSRVRNIGIA
EFGM_NEUCR            NANMTAAEIALKQAKELAASNMTPEAAAARMT------------PEEAKRLARVRNIGIA
EFGM_ASHGO            GAKRS--FSATSKRCTYEEEKAVLDELKPQLT------------ADDLKHSKLLRNIGVS
EFGM_YEAST            GFSRRSFHESPLARSTYEEEKVLVDEIKQKLT------------PDDIGRCNKLRNIGIS
EFGM_CANAL            TTTFLR-NEQVKLPQTYDEEKVIIDEINKSLK------------PDDLQASTRLRNIGIS
EFGM_YARLI            SFAAAR-QENTTVGTTYQEELDVVNQLKGSVT------------ADDVTRLARMRNIGIS
G3QKQ5_GORGO          ----LGRG---RAPASLGWQRKQVNWKACRWS------------SSGVIPNEKIRNIGIS
A0A2I3T1A0_PANTR      ----LGRG---RAPASLGWQRKQVNWKACRWS------------SSGVIPNEKIRNIGIS
EFGM_HUMAN            ----LGRG---RAPASLGWQRKQVNWKACRWS------------SSGVIPNEKIRNIGIS
G1QVZ1_NOMLE          ----LGRG---RAHASLGWQRKQVNWKACRWS------------SSGVIPNEKIRNIGIS
EFGM_PONAB            ----LGRG---RAPASLGWQRKQVNWKACRWS------------SSGVIPNEKIRNIGIS
F6QKI2_CALJA          ----LGLG---RAPTFLGWQRKQVNWKACRWS------------SSGVIPNEKIRNIGIS
H0UVN5_CAVPO          ----LGHRPLFRVPAALGWQRKQISWKFCRWC------------SSGIIPNEKIRNIGIS
G1T5N5_RABIT          ----LGRGPLSRVPAVLGWQKLQINWRTCRWC------------SSGIIPNEKIRNIGIS
G1M4M7_AILME          ----LGRGPLPRVSATLP-QGKQVNWKVRRWC------------SSGVIPNEKIRNIGIS
M3WIL3_FELCA          ----LGRGPLPRVPASLGWQGKQVNWKVCRWC------------SSGVIPNEKIRNIGIS
G1NTB9_MYOLU          ----VGRGPLPRVPAALGWRGKQVNWKVCRWC------------SSGKIPNERIRNIGIS
H0WY66_OTOGA          ----VGRGPLPRVPAALGWQGKQVNWKSCRWC------------SSGVVPNEKIRNIGIS
EFGM_MOUSE            ------RGPFPRVPAVLGWQGKQADWKTRRWC------------SSGPVPNEKIRNIGIS
EFGM_RAT              ------RGPLPRVPAILGWQGKQANWKTYRWC------------SSGSIPNEKIRNIGIS
F7EHU0_MONDO          -----GRGP---------RFGRQVSWKSCRWC------------SA-VVPNEKIRNIGIS
G1KFW0_ANOCA          -------MLRWRRLWGSVLPGQQLYLDSCRWC------------SSGITPNEKIRNIGIS
F6Q9W5_XENTR          -----SQALRDCGALTSWKSSSILPLTFCRYC------------SSGIVPNERIRNIGIS
H3AWE2_LATCH          -----------------RANWLPVLLNSCRSC------------SSGIVPNEKIRNIGIS
H3CQL2_TETNG          ----T------HLLSTGSVTIKKVLINSCRTC------------SSGVFPNERIRNIGIS
I3J7A5_ORENI          ----T------HLSARGSVTLKKVLINSCRSC------------SSGVFPSERIRNIGIS
G3P617_GASAC          ----T------PLLARGSVTLKQVLINSCRTC------------SSGIFPNERIRNIGIS
EFGM_DANRE            ------------LHRPGHSTLQQVLI-SCRSC------------SNGITPNERIRNIGIS
C3ZDC2_BRAFL          ------SQQCKLARRAQTQLAPAVLRLYTTDE------------KSKALDVSRIRNIGIS
EFGM_ANOGA            --------------AAKSFLE-NVKSFSSHAT------------FAEHKQLEKIRNIGIS
W5JI53_ANODA          --------------AARTFLEQNARSFSSPTA------------LAEHKPLEKIRNIGIS
EFGM_AEDAE            --------------AAKCVLENAKQSFSSHAA------------FAEHAKLERIRNIGIS
EFGM_DROME            --------------RLRALKSLGKAGYSSHAK------------FSEHKPIERIRNIGIS
EFGM_DROPS            --------------RKNALQTLTRCGYSSHAK------------FAEHRPIEKIRNIGIS
E9G149_DAPPU          ----H-------ARSSILYRKTISRSYAAVAK------------FSEHKELEKIRNIGIS
A0A087ZTR9_APIME      ----F-------ITCYSYFSKNNLQSLSSFAK------------YAEHKSLEKIRNIGIS
E0VF81_PEDHC          ----------------TNPRLLETVGNEAHLK------------YAQHKDIEHIRNIGIS
EFGM_NEMVE            ----------------AILSNAQRIVGCRFVS------------SSIIPDASRLRNIGIS
F6UKC4_CIOIN          ----NVKILASFSRTNKLRWFKATSSLYSTKS------------TNPNDELKRMRNIGIA
EFGM_CAEBR            ------------RQLNNVFRRFTSNEAPS-VI------------VPGVRPIERIRNIGIS
EFGM_CAEEL            ------------RQLNNVLRRFASNEAPSSVV------------VPGVRPIERIRNIGIS
A0DGW7_PARTE          --------------------------RTPMFW-------------FSQPIHKLIRNIGVS
A0C9U4_PARTE          --------------------------RTPMFW-------------FSQPIHKLIRNIGVS
Q22AK9_TETTS          -------------AQKYQHSNIQFANKFNALS-------------FNPYYNFCLRNIGIS
EFG1_ANADE            ------------------------------------------MAR--TTPLERYRNFGIM
EFG2_MYXXD            ------------------------------------------MAR--EYPLDRYRNIGIM
EFG_KORVE             ------------------------------------------MAR--QVPLERCRNIGIM
EFG_SOLUE             ------------------------------------------MAR--TTPLERMRNIGIA
EFG2_GEOSL            ------------------------------------------MAR--QVSLEKTRNIGIM
EFG2_PELCD            ------------------------------------------MAR--QVSLEKTRNIGIM
EFG_MAGMM             ------------------------------------------MAR--EIALDHVRNIGIM
EFG_CHLAA             ------------------------------------------MPR--QIELDKVRNIGII
EFG_HERA2             ------------------------------------------MPR--STPLDRVRNIGII
EFG_DEHM1             -----------------------------------------MSDR--KYPLERVRNIGII
EFG_GLOVI             ------------------------------------------MAR--NIPLERVRNIGIA
EFG2_SYNY3            ------------------------------------------MAR--TVPLERIRNIGIA
EFG_DEIRA             ---------------------------------------MTITKS--QQYLTHFRNIGIA
EFG_ENTFA             ------------------------------------------MAR--EFSLEKTRNIGIM
EFG_OENOB             -----------------------------------------MDTR--EFPLDRTRNIGIM
EFG_MESFL             ------------------------------------------MPR--EFSLENTRNLGIM
EFG_MYCPN             ------------------------------------------MAR--TVDLINFRNFGIM
EFG_MYCA5             ------------------------------------------MAR--EYKLEDYRNIGIM
EFG_CLOAB             ------------------------------------------MAR--KYPLEKFRNIGIM
EFG_LACP7             -----------------------------------------MAGR--EYPLERTRNIGIM
EFG_FINM2             ------------------------------------------MAR--QVSLKDTRNIGIM
EFG_MOOTA             ------------------------------------------MAR--EYPLEKTRNIGIM
EFG_ECOLI             ------------------------------------------MAR--TTPIARYRNIGIS
EFG_WIGBR             ------------------------------------------MPR--LTPIVNYRNIGIS
EFG_HYDCU             ------------------------------------------MAR--KTPIERYRNIGIM
EFG_FUSNN             ------------------------------------------MAR--KISLDMTRNVGIM
EFG_SULSY             ------------------------------------------MPR--QVPIEKLRNIGIV
EFG_PARUW             ------------------------------------------MARPAKEHLKNLRNIGIM
EFG_ENDTX             ------------------------------------------MAR--EYPLNKVRNFGIA
EFG_CUTAK             ---------------------------------------------MAKTDLSKVRNIGIM
EFG1_STRCO            -------------------------------------------MATTSLDLAKVRNIGIM
EFG_BIFAA             ------------------------------------------MALDVLNDLNQIRNIGIM
EFG_DESAG             --------------------------------------------MSRKVAIPQQRNIGIM
EFG_PARD8             -------------------------------------------MANNDKQLMFTRNIGIM
EFG_SULMW             -------------------------------------------MKNN---LKYTRNIGIA
EFG_SALRD             ----------------------------------------MATQTNESFPLEKTRNIGIM
EFG_CHLT3             --------------------------------------------MPRQIPLEKVRNIGIM
EFG_GLUOX             ---------------------------------------MSESVQEAKSALSKIRNIGIT
EFG2_HAHCH            ------------------------------------------------MKLQKLRNIGII
EFG1_METCA            -----------------------------------------------MTDLSRYRNIGIF
EFG1_SYNY3            ----------------------------------------------MEKDLTRYRNIGIF
EFG_HYPNA             --------------------------------------------MAREYPLERYRNFGII
EFG_RHORT             --------------------------------------------MKRETPLDRYRNIGIM
EFG_NEOSM             -------------------------------------------MSASSVELEKIRNIGIM
EFG_PSELT             ----------------------------------------MLEIEALYVPLSKLRNIGIM
EFG_THEMA             -------------------------------------------MEARYVDLDKLRNIGIM
EFG_PETMO             -------------------------------------------MKERLYPIEKIRNIGIV
EFG1_SYNWW            -------------------------------------------------MLKELRNIGII
EFG2_SYNWW            --------------------------------------------MADSYDLTAIRNIGIM
EFG1_BDEBA            ---------------------------------------MSAKDPKVVADLKYTRNIGIM
EFG2_DESPS            ---------------------------------------MVAQ-----INLKDVRNIGIM
EFG1_GEOSL            ---------------------------------------------MARPPLDQVRTIGII
EFG1_PELCD            ---------------------------------------------MTCPDLKNLRNIGII
EFG2_SYNAS            --------------------------------------------MPPKSRLSRIRNIGII
EFG3_MYXXD            --------------------------------------------MSRHTRIERYRNIGIM
EFG2_STRCO            ---------------------------------------------MRTNPLTTVRNLGIL
EFG2_BORBU            ---------------------------------------------------MSIRNIGIM
EFG2_BORAP            ---------------------------------------------------MGIRNIGIM
EFG2_BORBP            ---------------------------------------------------MSIRNIGIM
EFG1_TREDE            -------------------------------------------------MLDKMRNIGIM
EFG2_TREPA            ------------------------------------------------MRQQQMRNIGIM
EFG_CARRP             -----------------------------------------------MNDIKNIRNIGII
EFG_RHOBA             ------------------------------------------------MNLEKVRNIGIS
K2LYN2_TRYCR          -------------------------MRRFCIISLRQFNAVRFATPQFAKSVHRLRNVGIS
Q38BA0_TRYB2          -------------------------MRRFCDVVFYPNRFYRLASSAFLKNIDKLRNIGIS
A4ICS8_LEIIN          -------------------------MRRSGLAYMLRSSVPLLATPAFLSNVRHMRNIGIS
Q4Q219_LEIMA          -------------------------MRRSGLAYMLRSSVPLLATPAFLANVKHMRNIGIS
A4HNR7_LEIBR          -------------------------MRRSALAYVLRSSIPLLATPAFLEYVKHMRNIGIS
Q7RFK0_PLAYO          TRHCVFLLKRNLYRIKKVVPSRTVLFMNS-------------SCNFSSICIDNLRNIGIS
A5K8J4_PLAVS          MAYGARALRRHTCAL----PKRKRALPRPH---------SAG-RTFSSICVDNLRNIGIS
A0A1Y3DJ13_PLAKN      IAYGSPALRRHMCVLAKRIPKRKKVFLYLN---------SGGWRAFSSICVDNLRNIGIS
A7AM19_BABBO          ANSQAFGI-NRYPYRKIMIPRLIEMLIYG---------------SDGGYRIERIRNIGIS
Q4MYM5_THEPA          INTNLLNISNITNFTSFYQINNVKLLISGINYVKSFSTSSTVTRDSNVYNIERIRNIGIS
                                                                            *..*: 

EFG2_ANADE            AHIDSGKTTLTERILFYTKRIHAIHEVKGKDGVGATMDSMELERERGITIASAATHCEWK
EFG1_DESPS            AHIDSGKTTLTERILFYTDRIHAIHEVRGKDGVGAKMDSMELEKERGITIQSAATFCNWK
EFG1_BORBU            AHIDSGKTTLTERILFYCNKIHAIHEVKGKDGVGATMDSMELERERGITIASAATHVEWK
EFG1_BORBP            AHIDSGKTTLTERILFYCNKIHAIHEVKGKDGVGATMDSMELERERGITIASAATHVEWK
EFG2_TREDE            AHIDSGKTTLSERILFYCDRIHALHEVRGKDGVGATMDNMELEKERGITIQSASTQVKWK
EFG1_TREPA            AHIDSGKTTLSERILFYCDRIHAIHEVRGKDGVGATMDNMELERERGITIQSASTQVQWK
EFG1_SYNAS            AHIDSGKTTLTERILFYTKRIHAMHDVKGKDGVGATMDSMELERERGITISSAATFCTWG
EFG2_BDEBA            AHIDSGKTTTSERILFYGGRIHAIHEVRGKDGVGATMDSMDLEREKGITIQSAATQVQWK
EFG1_MYXXD            AHIDSGKTTLSERILFYTGRIHEIHEVRGKDGVGAIMDNMDLEREKGITIQSAATFAMWG
EFGM_DICDI            AHIDSGKTTLTERILYYTGRIKEIHEVRGKDGVGAKMDSMDLEREKGITIQSAATYCKWG
D3BMN4_POLPP          AHIDSGKTTLTERILYYTGRIKEMHDVRGKDGVGAKMDSMDLEREKGITIQSAATYAKWG
EFGM_CRYNJ            AHIDSGKTTLTERVLYYTGRIRDIHEVRGRDAVGAKMDSMELEREKGITIQSAATFADWV
EFGM_USTMA            AHIDSGKTTLTERVLFYTGRIKDIHEVRGRDAVGAKMDHMELEREKGITIQSAATYCSWK
EFGM_COPC7            AHIDSGKTTLSERILFYTGKIREIHEVRGRDAVGAKMDNMDLEREKGITIQSAATFCDWE
EFGM_SCHPO            AHIDSGKTTFTERVLYYTGRIKDIHEVRGKDNVGAKMDFMELEREKGITIQSAATHCTWE
F4NY64_BATDJ          AHIDSGKTTLTERILFYTGRIDTIHEVRGKDNVGAKMDSMELEREKGITIQSAATYTSWK
D0NCX8_PHYIT          AHIDSGKTTLTERILFYTGRINAIHDVRGKDGVGAKMDSMELEREKGITIQSAATYCSWK
EFGM1_ARATH           AHIDSGKTTLTERVLFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATYCTWK
EFGM2_ARATH           AHIDSGKTTLTERVLFYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATYCTWK
D7SLS6_VITVI          AHIDSGKTTLTERILYYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATYCTWK
M1CGG0_SOLTU          AHIDSGKTTLTERVLFYTGRIHEIHEVRGKDGVGAKMDSMDLEREKGITIQSAATYCTWK
EFGM_ORYSJ            AHIDSGKTTLTERVLYYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATYCTWN
I1GYK4_BRADI          AHIDSGKTTLTERVLYYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATYCTWN
C5WSZ1_SORBI          AHIDSGKTTLTERVLYYTGRIHEIHEVRGRDGVGAKMDSMDLEREKGITIQSAATYCTWK
A9RPB9_PHYPA          AHIDSGKTTLTERVLFYTGRIHEIHEVRGKDGVGAKMDSMDLEREKGITIQSAATHCTWG
A9SP22_PHYPA          AHIDSGKTTLTERVLFYTGRIHEIHEVRGKDGVGAKMDSMDLEREKGITIQSAATYCTWG
EFGM_COCIM            AHIDSGKTTSTERVLFYTGRIQAIHEVRGRDSVGAKMDSMDLEREKGITIQSAATFCDWV
C0NUK7_AJECG          AHIDSGKTTSTERILYYTGRIAAIHEVRGRDSVGAKMDSMDLEREKGITIQSAATFCDWV
EFGM_EMENI            AHIDSGKTTCTERVLFYTGRIKAIHEVRGRDSVGAKMDSMDLEREKGITIQSAATFCDWV
EFGM_ASPFU            AHIDSGKTTCTERVLFYTGRIKAIHEVRGRDNVGAKMDSMDLEREKGITIQSAATFCDWI
EFGM_SCLS1            AHIDSGKTTATERVLFYTGRINAIHEVRGKDAVGAKMDSMELEREKGITIQSAATFCDWM
C7YWN8_FUSV7          AHIDSGKTTVSERVLFYTGRINAIHEVRGKDAVGAKMDSMELEREKGITIQSAATFADWK
I1RCR5_GIBZE          AHIDSGKTTVSERVLFYTGRINSIHEVRGKDSVGAKMDSMELEREKGITIQSAATFADWK
EFGM_NEUCR            AHIDSGKTTVTERILFYTGRVKAIHEVRGRDGVGAKMDSMELERERGITIQSAATFADWK
EFGM_ASHGO            AHIDSGKTTFTERVLYYTGRIKAIHEVRGRDSVGAKMDHMDLEREKGITIQSAATYCSWD
EFGM_YEAST            AHIDSGKTTFTERVLYYTKRIKAIHEVRGRDNVGAKMDSMDLEREKGITIQSAATYCSWD
EFGM_CANAL            AHIDSGKTTFTERVLFYTGRIKAIHEVRGKDSVGAKMDHMDLEREKGITIQSAATYCSWD
EFGM_YARLI            AHIDSGKTTFSERILFYTGRTKEIHEVRGKDGVGAKMDHMDLEREKGITIQSAATYATWI
G3QKQ5_GORGO          AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
A0A2I3T1A0_PANTR      AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
EFGM_HUMAN            AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
G1QVZ1_NOMLE          AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
EFGM_PONAB            AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
F6QKI2_CALJA          AHIDSGKTTLTERVLYYTGRIEKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTLWK
H0UVN5_CAVPO          AHIDSGKTTLTERVLYYTGRIAQMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
G1T5N5_RABIT          AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
G1M4M7_AILME          AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
M3WIL3_FELCA          AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
G1NTB9_MYOLU          AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
H0WY66_OTOGA          AHIDSGKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
EFGM_MOUSE            AHIDSGKTTLTERVLYYTGRIATMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
EFGM_RAT              AHIDSGKTTLTERVLYYTGRIATMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWR
F7EHU0_MONDO          AHIDSGKTTLTERVLYYTGRIAQMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
G1KFW0_ANOCA          AHIDSGKTTLTERILFYTGRIAQMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
F6Q9W5_XENTR          AHIDSGKTTLTERVLYYTGRIAQMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWK
H3AWE2_LATCH          AHIDSGKTTLTERILFYTGRITEMHEVKGKDGVGAIMDSMELERQRGITIQSAATYTMWK
H3CQL2_TETNG          AHIDSGKTTLTERILYYTGRIAEIHEVKGKDGVGATMDSMELERQRGITIQSAATYTVWK
I3J7A5_ORENI          AHIDSGKTTLTERVLYYTGRIAEIHEVKGKDGVGATMDSMELERQRGITIQSAATYTVWK
G3P617_GASAC          AHIDSGKTTLTERVLFYTGKIAHIHEVKGKDGVGATMDSMELERQRGITIQSAATYTVWK
EFGM_DANRE            AHIDSGKTTLTERVLYYTGRIAEMHEVRGKDGVGAIMDSMELERQRGITIQSAATYTMWK
C3ZDC2_BRAFL          AHIDSGKTTLTERVLYYTGRIEAMHEVKGKDQVGATMDFMELERQRGITIQSAATYTEWK
EFGM_ANOGA            AHIDSGKTTLTERILFYTGRIKEMHEVKGKDNVGATMDSMELERQRGITIQSAATYTIWK
W5JI53_ANODA          AHIDSGKTTLTERILFYTGRIKEMHEVKGKDNVGATMDSMELERQRGITIQSAATYTIWK
EFGM_AEDAE            AHIDSGKTTLTERILFYTGRIKQMHEVKGKDNVGATMDSMELERQRGITIQSAATYTMWK
EFGM_DROME            AHIDSGKTTLTERILFYTGRIAEMHEVRGKDNVGATMDSMELERQRGITIQSAATYTLWK
EFGM_DROPS            AHIDSGKTTLTERILFYTGRIAEMHEVRGKDNVGATMDSMELERQRGITIQSAATYTMWK
E9G149_DAPPU          AHIDSGKTTLTERVLFYTGRIEEMHEVKGKDSVGAVMDSMELERQRGITIQSAATYTVWK
A0A087ZTR9_APIME      AHIDSGKTTLTERILFYTGRITKMHEVRGKDNVGATMDSMELEKQRGITIQSAATYTLWK
E0VF81_PEDHC          AHIDSGKTTLTERILYYTGRIEKMHEVRGKDNVGAVMDSMELERQRGITIQSAATYTLWK
EFGM_NEMVE            AHIDSGKTTLTERLLFYTGRISHMHEVKGKDNVGATMDSMELERQRGITIQSAATYVNWK
F6UKC4_CIOIN          AHIDSGKTTVTERLLYYTGRISQMHEVKGKDKVGATMDSMDLERERGITIQSAATHVTWK
EFGM_CAEBR            AHIDSGKTTVTERILYYAGRIDSMHEVRGKDDVGATMDFMELERQRGITIQSAATYVDWH
EFGM_CAEEL            AHIDSGKTTVTERILYYAGRIDSMHEVRGKDDVGATMDFMDLERQRGITIQSAATYVDWH
A0DGW7_PARTE          AHIDSGKTTFSERVLYYGGRIHEIHEVKGADSAGATMDFMELEKEKGITIQSAATHLKWR
A0C9U4_PARTE          AHIDSGKTTFSERVLYYGGRIHEIHEVKGADSAGATMDFMELEKEKGITIQSAATHLKWR
Q22AK9_TETTS          AHIDSGKTTFTERVLFYAGKINAIHDVKGTDGVGATMDFMDLEREKGITIQSAATHLKWG
EFG1_ANADE            AHIDAGKTTTTERILFYTGVTHKIGEVHEGT---TVMDWMEQERERGITITSAATTAFWR
EFG2_MYXXD            AHIDAGKTTTTERILFYTGAIHRMGEVHEGN---TTTDWMVQERERGITITSAAISAFWA
EFG_KORVE             AHIDAGKTTTTERVLFYTGRTHRIGEVHEGT---ATMDWMAQEQERGITITSAATTCTWR
EFG_SOLUE             AHIDAGKTTTTERILFYTGKSHKIGEVHEGT---AVMDWMEQEQERGITITSAATTCEWR
EFG2_GEOSL            AHIDAGKTTTTERILYYTGVTHKIGEVHEGA---ATMDWMEQEQERGITITSAATTCFWG
EFG2_PELCD            AHIDAGKTTTTERVLYYTGVSHKIGEVHDGA---ATMDWMEQEQERGITITSAATTCFWR
EFG_MAGMM             AHIDAGKTTVTERILYYTGRSHKIGEVHEGA---ATMDWMEQEQERGITITSAATTCFWK
EFG_CHLAA             AHIDAGKTTTTERILFYTGRTYKIGEVHEGT---ATMDWMPQEQERGITITAAATTAPWR
EFG_HERA2             AHIDAGKTTTTERILFYTGRNYKIGEVHEGA---ATMDWMEQERERGITITAAATTAHWE
EFG_DEHM1             AHIDAGKTTTTERILYLTKRTHKIGNIDDGT---TVMDWMEQEKARGITITSVATSAYWN
EFG_GLOVI             AHIDAGKTTTTERILFYSGVIHKIGEVHEGN---TVTDWMAQERERGITITAAAITTAWT
EFG2_SYNY3            AHIDAGKTTTTERILFYSGVVHKIGEVHEGT---AVTDWMAQERERGITITAAAISTDW-
EFG_DEIRA             AHIDAGKTTTTERILFFTGRIRNLGETHEGA---SQMDWMEQERERGITITAAATTAHWT
EFG_ENTFA             AHVDAGKTTTTERILYYTGKIHKIGETHEGA---SQMDWMEQEQERGITITSAATTAQWK
EFG_OENOB             AHIDAGKTTTTERILYYTGKIHKIGETHDGA---SQMDFMDQEKERGITIQSAATTAIWH
EFG_MESFL             AHIDAGKTTTTERILFHTGKIHKIGETHEGA---SQMDWMAQEQERGITITSAATTAFWK
EFG_MYCPN             AHIDAGKTTTSERILFHSGRIHKIGETHDGE---SVMDWMEQEKERGITITSAATSVSWK
EFG_MYCA5             AHIDAGKTTTTERVLFHTGKIHKIGETHEGE---SQMDWMVQEQERGITITSAATTAYWG
EFG_CLOAB             AHIDAGKTTTTERILFYTGKTHKIGEVHEGA---ATMDWMVQEQERGITITSAATTCYWK
EFG_LACP7             AHIDAGKTTLSERILYYTGVNYKIGDTHEGT---ATMDWMEQEQERGITITSAATTCHWT
EFG_FINM2             AHIDAGKTTVTERILYYSGKIHKIGDTHDGA---AQMDWMVQEQERGITITSAATTCFWK
EFG_MOOTA             AHIDAGKTTTTERILFYTGRVHRMGEVHDGN---ATMDWMIQEQERGITITSAATTCFWR
EFG_ECOLI             AHIDAGKTTTTERILFYTGVNHKIGEVHDGA---ATMDWMEQEQERGITITSAATTAFWS
EFG_WIGBR             AHIDAGKTTTTERILFYTGVNHKLGEVHHGS---ATMDWMAQEQERGITITSAATTCFWS
EFG_HYDCU             AHIDAGKTTTTERILFYTGVSHKIGEVHDGG---ATMDWMEQEQERGITITSAATTTHWS
EFG_FUSNN             AHIDAGKTTTTERILFYTGVERKLKEVHEGQ---ATMDWMEQEQERGITITSAATTCFWK
EFG_SULSY             AHIDAGKTTTTERILFYTGKTYKIGEVHEGA---ATMDWMEQEKERGITITSATTAAYWK
EFG_PARUW             AHIDAGKTTTTERILYYSGRSHKIGEVHEGA---ATMDWMAQEQERGITITSAATTVFWK
EFG_ENDTX             AHIDAGKTTTTERILYYTGRTHKIGEVHEGA---ATMDWMEQEKERGITITSAATYCRWQ
EFG_CUTAK             AHIDAGKTTTTERILYYTGKSYKIGEVHDGA---ATMDWMEQEQERGITITSAATTTFW-
EFG1_STRCO            AHIDAGKTTTTERILFYTGVSYKIGEVHDGA---ATMDWMEQEQERGITITSAATTCHWP
EFG_BIFAA             AHIDAGKTTTTERILFYTGKNYKIGETHDGA---STMDFMAQEQERGITIQSAATTCFWN
EFG_DESAG             AHIDAGKTTTTERILFYTGVSHKIGETHEGQ---ATMDWMEQEQERGITITSAATTCFW-
EFG_PARD8             AHIDAGKTTTSERILFYTGLTHKIGETHDGT---ATMDWMAQEQERGITITSAATTTFWN
EFG_SULMW             AHIDAGKTTTTERILFYTGINHKIGEVHDGT---ATMDWMEQEQERGITITSAATKCEWL
EFG_SALRD             AHIDAGKTTLTERILFYTGRLHRMGEVHEGA---ATMDFMEQEKERGITITSAATTCYW-
EFG_CHLT3             AHIDAGKTTTTERILYYTGRVHRLGEVHDGA---ATMDWMEQEKERGITITSAATTCFWQ
EFG_GLUOX             AHIDAGKTTTTERILYYTGVSHKIGEVHEGN---TTTDYMAQERERGITITSAAVTCEWN
EFG2_HAHCH            AHVDAGKTTLTERLLHFTGALHSMGEVHHGG---TVTDHMVQERQRGITIASAAVTVGWR
EFG1_METCA            AHVDAGKTTTTERILKLTGKIHKIGEVHDGA---ATTDFMEQEQERGITIQSAATTCFWK
EFG1_SYNY3            AHVDAGKTTTTERILKLTGRIHKLGEVHEGE---STMDFMEQEAERGITIQSAATSCFWK
EFG_HYPNA             AHIDAGKTTTTERVLYYTGKSHKIGEVHDGA---ATMDWMEQEQERGITITSAATTTFWE
EFG_RHORT             AHIDAGKTTTTERILCYTGKSHKIGEVHDGA---ATMDWMEQEQERGITITSAATTAFWR
EFG_NEOSM             AHIDAGKTTTTERILLYTGVNRTVGEVHEGA---ATMDWMEQEKERGITITSAATTCWWK
EFG_PSELT             AHIDAGKTTTTERILYYTGRKHVLGSVDEGT---ATMDWMEQEKERGITIKAAATTCFWK
EFG_THEMA             AHIDAGKTTTTERILYYTGRKHFIGDVDEGN---TTTDWMPQEKERGITIQSAATTCFWK
EFG_PETMO             AHIDAGKTTTTERILFYTGTKHKLGNVDEGT---TETDWMEQEKERGITITSAATSAFWK
EFG1_SYNWW            AHIDAGKTTTTERILYYTGLTHKMGETHDGD---SIMDFLPWEKERGITVASAATRCFWK
EFG2_SYNWW            AHIDAGKTTTTERILFYSGRVHKMGEVDKGT---ATMDWMSQEQERGITITSAATACKWK
EFG1_BDEBA            AHIDAGKTTTTERILYYTGKSHKIGEVHDGD---ATMDWMVQEQERGITITSAATMAFWK
EFG2_DESPS            AHIDAGKTTTTERILYYTGRSHKIGEVHDGN---AVMDWMEQEQERGITITSAATTCIWK
EFG1_GEOSL            SHIDAGKTTVSERILFYTGETHKMGEVHDGE---AVMDWMPQEQERGITITSTATVCTW-
EFG1_PELCD            SHIDAGKTTVSERVLFYTGESHRIGEVHDGN---AVMDWMEQEQERGITITATTTCCHW-
EFG2_SYNAS            AHIDAGKTTVSERILYYTGKSYKIGEVHDGE---AVMDWMPQEQERGITISSAVTTCNW-
EFG3_MYXXD            AHIDAGKTTLTERVLFFTGRIHSVGEVHDGA---TEMDWLPQEKQRGITITSAATTAFWQ
EFG2_STRCO            AHVDAGKTTVTERILYLTGTTHKRGEVHDGT---TVTDFDPQERDRGITIFAAAVSCAW-
EFG2_BORBU            AHIDAGKTTTTERIIYYTGKSHKMGDVDSGN---TITDWMPQEQERGITISSAAITCHWK
EFG2_BORAP            AHIDAGKTTTTERIIYYTGKSHKMGDVDSGN---TITDWMPQEQERGITISSAAITCHWK
EFG2_BORBP            AHIDAGKTTTTERIIYYTGKSHKIGDVDSGN---TITDWMPQEQERGITISSAAITCHWK
EFG1_TREDE            AHIDAGKTTTTERILFYTGKIHKIGEIDDGQ---ATMDWMAQEQDRGITIQSAATTTYWK
EFG2_TREPA            AHVDAGKTTTTERMLFYTGKIHRMGEIDDGA---TTMDWMVQEQERGITIQSAATTVRWR
EFG_CARRP             AHVDAGKTTTTERILFFSGFSHKIGEVHTGN---TITDWMKQEQERGITITSASVTFFWK
EFG_RHOBA             AHIDSGKTTLSERILFYSGRIHKIEDVRGGGDG-ATMDHMELEKERGITITSAATSVTHN
K2LYN2_TRYCR          AHIDSGKTTLTERILYYTGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATHCKWN
Q38BA0_TRYB2          AHIDSGKTTVTERILFYTGRIDKIHEVKGGSEVGATMDSMELEKERGITIRSAATQCKWG
A4ICS8_LEIIN          AHIDSGKTTLSERILFYSGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATQCRWK
Q4Q219_LEIMA          AHIDSGKTTLSERILFYSGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATQCRWK
A4HNR7_LEIBR          AHIDSGKTTLSERILFYSGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATQCRWK
Q7RFK0_PLAYO          AHIDAGKTTLTERILYYTGKIKSIHEVRGTDGVGATMDSMDLEREKGITIQSAATHCVWN
A5K8J4_PLAVS          AHIDAGKTTLTERILYYTGKIKSIHEVRGSDGVGATMDSMDLEREKGITIQSAATNCNWH
A0A1Y3DJ13_PLAKN      AHIDAGKTTLTERILYYTGKIKSIHEVRGSDGVGATMDSMDLEREKGITIQSAATNCNWD
A7AM19_BABBO          AHIDSGKTTMSERILFYSGRIASIHEVRGNDGVGAKMDSMDLERERGITIQSAVTNFKWS
Q4MYM5_THEPA          AHIDSGKTTLTERILFYAGKIDSIHEVRGTDGVGAKMDSMDLEREKGITIQSAVTNISWN
                      :*:*:**** :**::          .        :  *    *  :***: :.       

EFG2_ANADE            GL---------------------------------HLNIIDTPGHVDFTIEVERSLRVLD
EFG1_DESPS            GT---------------------------------DINIIDTPGHVDFTVEVERALRVLD
EFG1_BORBU            DF---------------------------------PINIIDTPGHVDFTIEVERSLRVLD
EFG1_BORBP            DF---------------------------------PINIIDTPGHVDFTIEVERSLRVLD
EFG2_TREDE            DY---------------------------------TVNVIDTPGHVDFTIEVERSLRVLD
EFG1_TREPA            GH---------------------------------TINVIDTPGHVDFTIEVERSLRVLD
EFG1_SYNAS            DH---------------------------------EVNIIDTPGHVDFTIEVERALRVLD
EFG2_BDEBA            DY---------------------------------TINLIDTPGHVDFTVEVERSLRVLD
EFG1_MYXXD            EY---------------------------------NINLIDTPGHVDFTIEVERSLRVLD
EFGM_DICDI            EN---------------------------------HINIIDTPGHVDFTIEVERALRVLD
D3BMN4_POLPP          DQ---------------------------------HINIIDTPGHVDFTIEVERALRVLD
EFGM_CRYNJ            APKPPTELKEGETVGNTD-------------KQKFAINIIDTPGHVDFTIEVERALRVLD
EFGM_USTMA            ATPPTEKASVSGDAANVESKE------LMEKKQDFHINIIDTPGHVDFTIEVERALRVLD
EFGM_COPC7            ATNPEDGS-----------------------KQKYSINVIDTPGHVDFTIEVERALRVLD
EFGM_SCHPO            RTVDQIEANEKQK---------------TDFEKSYNINIIDTPGHIDFTIEVERALRVLD
F4NY64_BATDJ          S---------------------------------HAINIIDTPGHVDFTIEVERALRVLD
D0NCX8_PHYIT          DS---------------------------------NINIIDTPGHVDFTIEVERALRVLD
EFGM1_ARATH           DY---------------------------------KVNIIDTPGHVDFTIEVERALRVLD
EFGM2_ARATH           DY---------------------------------KVNIIDTPGHVDFTIEVERALRVLD
D7SLS6_VITVI          DY---------------------------------QVNIIDTPGHVDFTIEVERALRVLD
M1CGG0_SOLTU          DY---------------------------------QVNIIDTPGHVDFTIEVERALRVLD
EFGM_ORYSJ            GY---------------------------------QVNIIDTPGHVDFTIEVERALRVLD
I1GYK4_BRADI          DY---------------------------------QVNIIDTPGHVDFTIEVERALRVLD
C5WSZ1_SORBI          DY---------------------------------QINIIDTPGHVDFTIEVERALRVLD
A9RPB9_PHYPA          DN---------------------------------QINIIDTPGHVDFTIEVERALRVLD
A9SP22_PHYPA          DN---------------------------------QINIIDTPGHVDFTIEVERALRVLD
EFGM_COCIM            KK-------------------------ENGKDEKYHINLIDTPGHIDFTIEVERALRVLD
C0NUK7_AJECG          KR-------------------------ENGKEEKYHINLIDTPGHIDFTIEVERALRVLD
EFGM_EMENI            KKD------------------------EDGKEQKYHMNLIDTPGHIDFTIEVERALRVLD
EFGM_ASPFU            KKG------------------------DDGKEEKYHINLIDTPGHIDFTIEVERALRVLD
EFGM_SCLS1            KV-------------------------ENGKEEKYHINLIDTPGHIDFTIEVERALRVLD
C7YWN8_FUSV7          KT-------------------------ENGKEETYHFNLIDTPGHIDFTIEVERALRVLD
I1RCR5_GIBZE          KT-------------------------ENGKEETYHFNLIDTPGHIDFTIEVERALRVLD
EFGM_NEUCR            KK-------------------------EKGVEETYHINLIDTPGHIDFTIEVERAMRVLD
EFGM_ASHGO            KD-----------------------------QESYHFNLIDTPGHIDFTIEVERALRVLD
EFGM_YEAST            KE-----------------------------GKNYHFNLIDTPGHIDFTIEVERALRVLD
EFGM_CANAL            KD-----------------------------DKSYHFNLIDTPGHIDFTIEVERALRVLD
EFGM_YARLI            KE-----------------------------NQDYHFNVIDTPGHIDFTIEVERALRVLD
G3QKQ5_GORGO          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
A0A2I3T1A0_PANTR      DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
EFGM_HUMAN            DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
G1QVZ1_NOMLE          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
EFGM_PONAB            DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
F6QKI2_CALJA          DV---------------------------------NINIIDTPGHVDFTIEVERSLRVLD
H0UVN5_CAVPO          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
G1T5N5_RABIT          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
G1M4M7_AILME          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
M3WIL3_FELCA          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
G1NTB9_MYOLU          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
H0WY66_OTOGA          DI---------------------------------NINIIDTPGHVDFTIEVERALRVLD
EFGM_MOUSE            DI---------------------------------NINIIDTPGHVDFTIEVERALRVLD
EFGM_RAT              DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
F7EHU0_MONDO          DV---------------------------------NINIIDTPGHVDFTIEVERALRVLD
G1KFW0_ANOCA          DT---------------------------------NINIIDTPGHVDFTIEVERALRVLD
F6Q9W5_XENTR          DT---------------------------------NINIIDTPGHVDFTIEVERALRVLD
H3AWE2_LATCH          EM---------------------------------NVNIIDTPGHVDFTIEVERALRVLD
H3CQL2_TETNG          NH---------------------------------NINIIDTPGHVDFTIEVERALRVLD
I3J7A5_ORENI          DH---------------------------------NINIIDTPGHVDFTIEVERALRVLD
G3P617_GASAC          DH---------------------------------NINIIDTPGHVDFTIEVERALRVLD
EFGM_DANRE            NH---------------------------------NINIIDTPGHVDFTIEVERSLRVLD
C3ZDC2_BRAFL          DY---------------------------------NINIIDTPGHVDFTIEVERALRVLD
EFGM_ANOGA            DH---------------------------------NINIIDTPGHVDFTVEVERALRVLD
W5JI53_ANODA          DH---------------------------------NINIIDTPGHVDFTVEVERALRVLD
EFGM_AEDAE            DH---------------------------------NINIIDTPGHVDFTVEVERALRVLD
EFGM_DROME            DT---------------------------------NINIIDTPGHVDFTVEVERALRVLD
EFGM_DROPS            DT---------------------------------NVNIIDTPGHVDFTVEVERALRVLD
E9G149_DAPPU          DH---------------------------------NVNIIDTPGHVDFTVEVERALRVLD
A0A087ZTR9_APIME      DH---------------------------------NINIIDTPGHVDFTVEVERSLRVLD
E0VF81_PEDHC          NH---------------------------------NINIIDTPGHVDFTVEVERALRVLD
EFGM_NEMVE            DH---------------------------------NINIIDTPGHVDFTVEVERALRVLD
F6UKC4_CIOIN          DH---------------------------------LINIIDTPGHVDFTVEVERSLRVLD
EFGM_CAEBR            GT---------------------------------NINIIDTPGHVDFTVEVERALRVLD
EFGM_CAEEL            GT---------------------------------NINIIDTPGHVDFTVEVERALRVLD
A0DGW7_PARTE          GH---------------------------------QVNLIDTPGHVDFTIEVERALRVLD
A0C9U4_PARTE          GH---------------------------------QVNLIDTPGHVDFTIEVERALRVLD
Q22AK9_TETTS          NT---------------------------------SINVIDTPGHVDFTIEVERALRVLD
EFG1_ANADE            DH---------------------------------RLNIIDTPGHVDFTIEVERSLRVLD
EFG2_MYXXD            RHDQ-----------------------------RYRVNIIDTPGHVDFTIEVERSLRVLD
EFG_KORVE             DE---------------------------------RINIIDTPGHVDFTAEVERSLRVLD
EFG_SOLUE             DI---------------------------------QINIIDTPGHVDFTAEVERSLRVLD
EFG2_GEOSL            DH---------------------------------RVNIIDTPGHVDFTIEVERSLRVLD
EFG2_PELCD            DH---------------------------------RVNIIDTPGHVDFTVEVERSLRVLD
EFG_MAGMM             EH---------------------------------RINIIDTPGHVDFTIEVERSLRVLD
EFG_CHLAA             LDGV-----------------------------EYRINIIDTPGHVDFTVEVERSLRVLD
EFG_HERA2             YAEQ-----------------------------RYQINIIDTPGHVDFTAEVERSLRVLD
EFG_DEHM1             ---------------------------------GHHLNVIDTPGHVDFTVEVERSLRVLD
EFG_GLOVI             RRDPENPTQPL------------------PGALEHKINIIDTPGHVDFTIEVERSMRVLD
EFG2_SYNY3            --------------------------------LGHHINIIDTPGHVDFTIEVERSMRVLD
EFG_DEIRA             HTET---------------------------GEDYTVNIIDTPGHVDFTIEVERSMRVLD
EFG_ENTFA             G---------------------------------YRVNIIDTPGHVDFTIEVQRSLRVLD
EFG_OENOB             GFHEQWK------------------------DTPYRVNIIDTPGHVDFTIEVERSLRVLD
EFG_MESFL             N---------------------------------NRFNIIDTPGHVDFTVEVERSLRVLD
EFG_MYCPN             N---------------------------------CSLNLIDTPGHVDFTVEVERSLRVLD
EFG_MYCA5             G---------------------------------KRLNIIDTPGHVDFTVEVERSLRVLD
EFG_CLOAB             ---------------------------------DHEINIIDTPGHVDFTVEVERSLRVLD
EFG_LACP7             LELEHKKA---------------------PGALEHRINLIDTPGHVDFTVEVERSLRVLD
EFG_FINM2             ---------------------------------GNRINIIDTPGHVDFTVEVERSLRVLD
EFG_MOOTA             ---------------------------------NHRINIIDTPGHVDFTVEVERSLRVLD
EFG_ECOLI             GMAKQYE--------------------------PHRINIIDTPGHVDFTIEVERSMRVLD
EFG_WIGBR             GMSNQFS--------------------------SHRINIIDTPGHVDFTIEVERSMRILD
EFG_HYDCU             GMAQQFP--------------------------EHRINIIDTPGHVDFTIEVERSLRVLD
EFG_FUSNN             G---------------------------------HRINIIDTPGHVDFTVEVERSLRVLD
EFG_SULSY             G---------------------------------YQLNIIDTPGHVDFGVEVVRSMKALD
EFG_PARUW             DA---------------------------------KINIIDTPGHVDFTIEVERSLRVLD
EFG_ENDTX             DM---------------------------------QFNIIDTPGHVDFTAEVERSLRVLD
EFG_CUTAK             ----HD----------------------------TQINIIDTPGHVDFTVEVERSLRVLD
EFG1_STRCO            -LEDND----------------------------YTINIIDTPGHVDFTVEVERSLRVLD
EFG_BIFAA             -RQTHDEK------------------------QKFQINIIDTPGHVDFTAEVERSLRVLD
EFG_DESAG             ----KD----------------------------CRINIIDTPGHVDFTIEVERALRVLD
EFG_PARD8             -----YLG------------------------NRYKINLIDTPGHVDFTVEVERSLRVLD
EFG_SULMW             -----YNN------------------------NIYKINIIDTPGHVDFTVEVERSLRVLD
EFG_SALRD             --------------------------------DDHRVNIIDTPGHVDFTVEVERSLRVLD
EFG_CHLT3             PRYGLLKD------------------------VRHRVNIIDTPGHVDFTVEVERSLRVLD
EFG_GLUOX             DH---------------------------------RINIIDTPGHIDFNIEVNRSLRVLD
EFG2_HAHCH            DH---------------------------------RINIIDTPGHIDFNIEVNRSLRVLD
EFG1_METCA            DH---------------------------------RFNIIDTPGHVDFTIEVYRSLKVLD
EFG1_SYNY3            DH---------------------------------QLNVIDTPGHVDFTIEVYRSLKVLD
EFG_HYPNA             RTEDGSTAL----------------------SPKYRFNIIDTPGHVDFTIEVERSLAVLD
EFG_RHORT             EN---------------------------------RVNIIDTPGHVDFTIEVERSLRVLD
EFG_NEOSM             GA---------------------------------KINIIDTPGHVDFTIEVERSLRVLD
EFG_PSELT             EH---------------------------------RINIIDTPGHVDFTVEVERALRVLD
EFG_THEMA             GY---------------------------------RINIIDTPGHVDFTAEVERALRVLD
EFG_PETMO             DH---------------------------------RINIIDTPGHVDFTVEVERSLRVLD
EFG1_SYNWW            GN---------------------------------TINIIDTPGHVDFTAEVERSLRILD
EFG2_SYNWW            GY---------------------------------FVNIIDTPGHVDFTVEVERSLRVLD
EFG1_BDEBA            DH---------------------------------RINIIDTPGHVDFTIEVERSLRVLD
EFG2_DESPS            GK---------------------------------KINIIDTPGHVDFTVEVERSLRVLD
EFG1_GEOSL            --------------------------------RNHRLNLVDTPGHIDFTIEVERSLRVLD
EFG1_PELCD            --------------------------------RDVRINLIDTPGHIDFTIEVERSLRVLD
EFG2_SYNAS            --------------------------------ANHEIHIIDTPGHVDFTIEVERSLRVLD
EFG3_MYXXD            PRQGMGAG------------------------VPHRINVLDTPGHVDFTIEVERSLRVLD
EFG2_STRCO            --------------------------------AGHRINLIDTPGHVDFADEVERSLRVLD
EFG2_BORBU            ---------------------------------DCQINIIDTPGHVDFTAEVERSLRVLD
EFG2_BORAP            ---------------------------------EHQINIIDTPGHVDFTAEVERSLRVLD
EFG2_BORBP            ---------------------------------DCQINIIDTPGHVDFTAEVERSLRVLD
EFG1_TREDE            ---------------------------------NFQINIIDTPGHVDFTAEVERSLRVLD
EFG2_TREPA            ---------------------------------EVDITIIDTPGHVDFTAEVERALRVLD
EFG_CARRP             TNFY-----------------------------NSSINLIDTPGHVDFTIEVERSLRVLD
EFG_RHOBA             GY---------------------------------HINLIDTPGHVDFTVEVERSLRVLD
K2LYN2_TRYCR          DY---------------------------------FINVIDTPGHVDFTIEVERALRVLD
Q38BA0_TRYB2          DH---------------------------------LINIIDTPGHVDFTIEVERALRVLD
A4ICS8_LEIIN          NS---------------------------------TINIIDTPGHVDFTIEVERALRVLD
Q4Q219_LEIMA          NS---------------------------------TINIIDTPGHVDFTIEVERALRVLD
A4HNR7_LEIBR          SS---------------------------------TINIIDTPGHVDFTIEVERALRVLD
Q7RFK0_PLAYO          VN-----------------------------NQKYDINIIDTPGHVDFTIEVERSLRVLD
A5K8J4_PLAVS          FN-----------------------------NSSYTINIIDTPGHVDFTIEVERSLRVLD
A0A1Y3DJ13_PLAKN      FN-----------------------------NKKFTINIIDTPGHVDFTIEVERSLRVLD
A7AM19_BABBO          T-----------------------RRTPTEAPKDYMINIIDTPGHVDFTIEVERALRVLD
Q4MYM5_THEPA          TDISWNTNTPWNTNVTGVQRLQNSHSVGVSDPVDYSINIIDTPGHVDFTIEVERSLRVLD
                                                          . ::*****:**  ** *::  **

EFG2_ANADE            GAILVLCSVAGVQSQSLTVDRQMRRYNVPRLAFVNKCDRSGANPIRVKDQLREKLQHNPV
EFG1_DESPS            GAVLVLCSVGGVQSQSITVNRQMTRYNVPRIAFINKCDRTGANPAKVTGQLQEKLQLNAH
EFG1_BORBU            GAILVLDSVAGVQSQSITVDRQLKRYSVPRLAFVNKCDKTGANPYNVKDQLRSKLDLNSV
EFG1_BORBP            GAILVLDSVAGVQSQSITVDRQLKRYSVPRLAFVNKCDKTGANPYNVRDQLRSKLDLNSV
EFG2_TREDE            GAILVLCSVGGVQSQSITVDRQLKRYHVPRIAFVNKCDRTGANPFKVRMQLREKLGLNAY
EFG1_TREPA            GAVLVLCSVAGVQSQSITVDRQLRRYHVPRISFINKCDRTGANPFKVCAQLREKLSLNAH
EFG1_SYNAS            GAILVLCAVGGVQSQSITVDAQMKRYKVPCVAFVNKCDRSGANPARVVEQLKTRLGHNAL
EFG2_BDEBA            GAILLLCGVAGVQSQSITVDRQMKRYNVPRLAFVNKLDRQGANPYRVTDALIEKLRLNAV
EFG1_MYXXD            GAILVLCSVAGVQSQSITVDRQMKRYRVPRIAFVNKMDRSGANYDRVAAQLKEKLNHHPV
EFGM_DICDI            GAVLVMCGVSGVQSQTITVDRQMRRYNVPRVVFINKLDRTGANPWNVIEQLRKKLNLNAI
D3BMN4_POLPP          GAVLVMCGVSGVQSQTITVDRQMRRYNVPRVTFINKLDRVGADPWKVIDQLRSKLSLNAA
EFGM_CRYNJ            GAVLVLCAVSGVQSQTITVDRQMRRYNVPRLAFINKMDRAGSNPFRVIGQLRGKLKMNAA
EFGM_USTMA            GAVLVLCAVSGVQSQTITVDRQMRRYSVPRISFINKMDRAGANPWRVIGQIRNKLKMPAA
EFGM_COPC7            GAILVLCAVAGVQSQTTTVDRQMRRYNVPRISFINKMDRPGANPWRIVNQIRTKLRMPAA
EFGM_SCHPO            GAVLVLCAVSGVQSQTITVDRQMRRYNVPRISFVNKMDRMGADPWKVIQQINTKLKIPAA
F4NY64_BATDJ          GAILVLCAVGGVQSQTITVDRQMKRYNIPRICFINKMDRAGANPYRVIDQIRTKLRINAV
D0NCX8_PHYIT          GGVLVLCGVSGVQSQSLTVDKQMKRYGVPRIAFINKLDRMGANPWKVIGDLRTQLKLNAW
EFGM1_ARATH           GAILVLCSVGGVQSQSITVDRQMRRYEVPRVAFINKLDRMGADPWKVLNQARAKLRHHSA
EFGM2_ARATH           GAILVLCSVGGVQSQSITVDRQMRRYEVPRVAFINKLDRMGADPWKVLNQARAKLRHHSA
D7SLS6_VITVI          GAILVLCSVGGVQSQSITVDRQMRRYDVPRVAFINKLDRMGADPWKVLSQARSKLRHHSA
M1CGG0_SOLTU          GAILVLCSVGGVQSQSITVDRQMRRYDVPRLAFINKLDRMGADPWKVLNQARSKLRHHSA
EFGM_ORYSJ            GAILVLCSVGGVQSQSITVDRQMRRYEIPRVAFINKLDRMGADPWKVLNQARSKLRHHNA
I1GYK4_BRADI          GAILVLCSVGGVQSQSITVDRQMKRYEIPRVAFINKLDRMGADPWKVLNQARSKLRHHSA
C5WSZ1_SORBI          GAILVLCSVGGVQSQSITVDRQMRRYDIPRVAFINKLDRMGADPWKVLNQARSKLRHHNA
A9RPB9_PHYPA          GAVLVLCSVGGVQSQSITVDRQMRRYNVPRVAFINKLDRSGADPWKVIDQVRKKLKHNCA
A9SP22_PHYPA          GAVLVLCSVGGVQSQSITVDRQMRRYNVPRVAFINKLDRSGADPWKVIDQVRKKLKHNCA
EFGM_COCIM            GAVLILCAVSGVQSQTITVDRQMRRYNVPRISFINKMDRMGSNPFRAIEQINQKLKMHAA
C0NUK7_AJECG          GAVLIACAVSGVQSQTMTVDRQMRRYNVPRISFINKMDRMGANPFKAIEQINQKLKIAAA
EFGM_EMENI            GAVMILCAVSGVQSQTITVDRQMRRYNVPRISFVNKMDRMGANPFKSVDQINTKLKLPAA
EFGM_ASPFU            GAVMILCAVSGVQSQTITVDRQMRRYNVPRISFVNKMDRMGANPFKAVEQINTKLKIPAA
EFGM_SCLS1            GAVMILCAVSGVQSQTITVDRQMRRYNVPRISFINKMDRMGANPFKAVEQINQKLRIPAA
C7YWN8_FUSV7          GAVMILCAVSGVQSQTITVDRQMKRYNVPRISFVNKMDRMGANPWKAVEQINTKLKIPAA
I1RCR5_GIBZE          GAVMILCAVSGVQSQTITVDRQMKRYNVPRLSFVNKMDRMGANPWKAVEQINTKLKIPAA
EFGM_NEUCR            GAVMVLCAVSGVQSQTITVDRQMKRYNVPRISFVNKMDRMGANPWKAVEQINTKLKIPAA
EFGM_ASHGO            GAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGADPFKAIQQINTKLRIPAA
EFGM_YEAST            GAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGSDPFRAIEQLNSKLKIPAA
EFGM_CANAL            GAVLVVCAVAGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGANPWRAIEQINAKLKIPAA
EFGM_YARLI            GAVLVVCAVSGVQSQTMTVDRQMRRYNVPRVTFINKMDRMGADPWKAIDQINAKLKTRAA
G3QKQ5_GORGO          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLNHNAA
A0A2I3T1A0_PANTR      GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLNHNAA
EFGM_HUMAN            GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLNHNAA
G1QVZ1_NOMLE          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLNHNAA
EFGM_PONAB            GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLNHNAA
F6QKI2_CALJA          GAVLVLCAVGGVQCQTMTVSRQMKRYNVPFLTFINKLDRMGSSPARALQQMRSKLNHNAA
H0UVN5_CAVPO          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRVGSNPARALQQMRSKLNHNAA
G1T5N5_RABIT          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRAGSNPSRALQQMRSKLNHNAA
G1M4M7_AILME          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLSQNAA
M3WIL3_FELCA          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRTGSNPARALQQMRSKLSHNAA
G1NTB9_MYOLU          GAILVVCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLNHNAA
H0WY66_OTOGA          GAVLVLCAVGGVQCQTMTVNRQMKRYGVPFLTFINKLDRMGSNPTRALKQMRSKLNHNAA
EFGM_MOUSE            GAVLVLCAVGGVQCQTMTVSRQMKRYNVPFLTFINKLDRMGSNPSRALQQMRSKLNHNAA
EFGM_RAT              GAVLVLCAVGGVQCQTMTVSRQMKRYNVPFLTFINKLDRMGSNPARALQQMRSKLNHNAA
F7EHU0_MONDO          GAVLVLCAVGGVQCQTMTVNRQMKRYGVPFLTFINKLDRLGSNPDRALQQLRSKLNHNAA
G1KFW0_ANOCA          GAILVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSSPRRALQQLRSKLNHNAA
F6Q9W5_XENTR          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRLGSNPNRAVQQLRSKLNHNAA
H3AWE2_LATCH          GAILVLCAVGGVQCQTMTVNRQMKRYNVPFLTFVNKLDRMGSNPFRAVHQMRTKLNHNAA
H3CQL2_TETNG          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMGSNPSRALQQMRTKLNHNAA
I3J7A5_ORENI          GAVLVLCAVGGVQCQTMTVNRQMKRYSVPFLTFINKLDRMGANPGRALQQMRSKLNHNAA
G3P617_GASAC          GAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRTGANPSRALQQMRTKLNHNAA
EFGM_DANRE            GAVLVLCAVGGVQCQTVTVNRQMKRYSVPFLTFINKLDRLGANPNRALQQLRTKLNQNAA
C3ZDC2_BRAFL          GAVLVLCAVGGVQSQTLTVNRQMKRYSVPCLGFINKLDRQGANPERVLNQMRSKLNHNAA
EFGM_ANOGA            GAVLVLCSVGGVQSQTLTVNRQMKRYNVPCLAFINKLDRSGANPYRVLGQMRSKLNHNAA
W5JI53_ANODA          GAILVLCSVGGVQSQTLTVNRQMKRYNVPCLGFINKLDRAGANPYRVLGQMRSKLNHNAA
EFGM_AEDAE            GAILVLCSVGGVQSQTLTVNRQMKRYNVPCLAFINKLDRTGANPYRVLGQMRSKLNHNAA
EFGM_DROME            GAVLVLCAVGGVQSQTLTVNRQMKRYNVPCLAFINKLDRLGSNPYRVLSQMRSKMNHNAA
EFGM_DROPS            GAVLVLCAVGGVQSQTLTVNRQMKRYNVPCLAFINKLDRLGSNPYRVLSQMRSKMNHNAA
E9G149_DAPPU          GAVLVLCAVGGVQSQTLTVNRQMKRYNVPCLAFINKLDRLGSNPYRVLHQLRTKLNHNAS
A0A087ZTR9_APIME      GAVLVLCAVGGVQSQTITVDRQMKRYNIPRLAFINKLDRLGANHKRILEQLRGKLNLNAA
E0VF81_PEDHC          GAILVLCAVGGVQCQTLTVNKQMARYNVPCLAFINKLDRQGSNYIKVLENIRSKLKHNAA
EFGM_NEMVE            GAVLVLCAVGGVQSQTLTVNRQMKRYNVPCIAFINKLDRMGANHNRVLSQLRAKLNHNAA
F6UKC4_CIOIN          GVILVICANGGVQSQTLTVNRQINRYKVPCIAFINKIDRLAANPHKCLTHIRSKLRHNAA
EFGM_CAEBR            GAVLVLCGVGGVQSQTFTVNRQLARYNVPFICFVNKMDRNGASPLKALDGLRNKLNHNAA
EFGM_CAEEL            GAVLVLCGVGGVQSQTFTVNRQLARYNVPFICFVNKMDRNGATPLKALDGLRNKLNHNAA
A0DGW7_PARTE          GGVLLICGVAGVQPQTLTVHKQMSRYKVPRIIFINKLDRMGANPWSALQSIRKRLSLTVA
A0C9U4_PARTE          GGVLLICGVAGVQPQTLTVHKQMSRYKVPRIIFINKLDRMGANPWSAIQSIRKRLSLTVA
Q22AK9_TETTS          GGVLLLCGVAGVQPQTLTVFKQMVRYQVPRIIFINKLDRMGANPWAAIDSVRKRLNIHAA
EFG1_ANADE            GACAVFDAVQGVQPQSETVWRQADKYEVPRICFINKMDRVGADYFHAVDTIREKLGARPL
EFG2_MYXXD            GAITVFDAVNGVEPQSETVWRQADKYKVPRICFINKMDRVGADFEMSVGTIREKLGARAV
EFG_KORVE             GAVAVFDAVHGVEPQSETVWRQADKYSVPRICFINKIDKMGADFEHAIDTIRKRLNAKPV
EFG_SOLUE             GAVAVFDAVAGVQPQSETVWRQADKYSVPRICFINKMDRVGADFYHSVDTIVDRLKCRPV
EFG2_GEOSL            GAVAVFCSVGGVEPQSETVWRQADKYRVPRIAFINKMDRVGADFFRGVGMIRDRLKANPV
EFG2_PELCD            GSVAVFCSVGGVEPQSETVWRQADKYRVPRIAFINKMDRIGADFDRGVNMIRERLGANAI
EFG_MAGMM             GAVAVFCGVAGVQPQSETVWRQADRYGVPRLAFVNKMDRMGADFNKAVQTMKDRLKARAI
EFG_CHLAA             GGVVVFDGVAGVEPQSETVWRQADKYNVPRICFVNKMDRVGASFERCVQMIKDRLGAKPA
EFG_HERA2             GGVVVFDAVAGVEPQSETVWRQADKYNVPRICFVNKMDRMGANFDRTVQMIVDRLGAKPV
EFG_DEHM1             GGVVVFDGVAGVEAQSETVWRQASRYGVPRICFINKMDRTGANYERTLGMITQRLKAKCL
EFG_GLOVI             GVITVLCSVGGVQPQTETVWRQANRYNVPRFIFVNKMDRTGANFYKVYSQVRDRLRANAV
EFG2_SYNY3            GVIAVFCSVGGVQPQSETVWRQAERYQVPRIAFVNKMDRTGANFFRVCQQIGDRLRANAV
EFG_DEIRA             GAVAVFDSSQGVEPQSETVWRQADRYGVPRVAFANKMDKTGASFDLVVNDIRERLGAIPA
EFG_ENTFA             GAVTVLDSQSGVEPQTETVWRQATEYKVPRIVFCNKMDKIGADFFYSVESLHDRLQANAH
EFG_OENOB             GAIAVLDGAAGVEPQTETVWRQATTYAVPRLVFVNKMDKMGADFQMSVDSLKERLDVNAK
EFG_MESFL             GAVAVLDGQSGVEPQTETVWRQATTYRVPRIVFVNKMDKTGADFIYSVKSIGDRLGAKAA
EFG_MYCPN             GAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAV
EFG_MYCA5             GAVAVLDAQSGVEPQTETVWRQATNYNVPRIVYVNKMDKAGANFKASTESLRKLLGANAH
EFG_CLOAB             GAVAVFDAKGGVEPQSETVWRQAEKYNVPRMAYINKMDILGADFYRSVQMMRDRLSANAV
EFG_LACP7             SAVGVFCAKGGVEPQSETVWRQADKYNVPRMAFVNKMDISGANFFNVVDMIKSRLGKNAV
EFG_FINM2             GSVALFDAKSGVEPQSETVWRQADKYGVPRICFINKMDATGADYFMSVDTIRERLRANAV
EFG_MOOTA             GAVAVFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRVGADFFRGVRMIAERLGANPV
EFG_ECOLI             GAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVNQIKTRLGANPV
EFG_WIGBR             GAIMVYCAVGGVQPQSETVWRQANKYNVPRIAFINKMDRTGANYFNVINQIKDKLYANPI
EFG_HYDCU             GAVTCFCSVSGVEPQSETVWRQADKYGVPRMGFVNKMDRAGANFLNVNQMVIDRLGALPV
EFG_FUSNN             GAVAVFSAVDGVQPQSETVWRQADKYKVPRLAFFNKMDRIGANFDMCVSDIKEKLGSNPV
EFG_SULSY             GIVFVFASVEGVQPQSEANWRWADRFGVPRIAFVNKMDRVGANFFGVYEDMKKKLGTNPV
EFG_PARUW             GSVALFCSVSGVEPQSETVWRQADKYGVPRIAFVNKMDRMGADFFDAVKTMREKLHANAI
EFG_ENDTX             GAVVVFDSGNGVEPQSETVWRQADKYGVPRIVFSNKMDKVGADFFMVVNDIEEKLGAKPI
EFG_CUTAK             GAVAVFDGVAGVEPQSMTVWRQAAKYGVPRICYINKLDRTGASFDHCVKTIKERLHAIPV
EFG1_STRCO            GAVTVFDGVAGVEPQSETVWRQADRYGVPRICFVNKLDRTGAEFHRCVDMISDRLGAQPL
EFG_BIFAA             GAVAVFDGKEGVEPQSETVWRQADKYGVPRICFINKMDKLGADFYYSVDTIKTKLGATPL
EFG_DESAG             GAVAVFDAVAGVEPQSETVWRQADRYKVPRICFVNKMDRMGANFFRCVDMIRDRLKAKPL
EFG_PARD8             GAVATFCAVGGVEPQSETVWRQADKYNVPRIGYVNKMDRSGANYYEVVRQLKDVLGANPC
EFG_SULMW             GMVALFSAVDGVEPQSETVWRQADKYKVPRIGFVNKMDRQGADFFNVCEQIKSNLGANCL
EFG_SALRD             GAIALFCAVGGVEPQSETVWRQAEKYDVPRIGFVNKMDRTGADFENVLEMMEDRLSANPV
EFG_CHLT3             GAVAVFCAVGGVEPQSETVWRQANKYKVPRIGYVNKMDRVGADFFNVVEMIKERLKANPV
EFG_GLUOX             GAIFVIEGVAGVQPQSETNWRLADRYNVPRIIFINKLDRTGADFYYAFSTLKEKLDIVAV
EFG2_HAHCH            GAVVVFDSVAGVEPQSETNWRLADQYGVPRICLVNKMDRIGADYLRVVAMIRERLGAQPL
EFG1_METCA            GGIGVFCGSGGVEPQSETNWRYANDSEVARIIYVNKLDRVGADFYRVVKQIRDVLGAYPL
EFG1_SYNY3            GGIGVFCGSGGVEPQSETNWRYANDSKVARLIYINKLDRTGADFYRVVKQVETVLGAKPL
EFG_HYPNA             GAVVLLDGNAGVEPQTETVWRQADRYKVPRIVFVNKMDKTGADFFNCVAMIKDRTGATPA
EFG_RHORT             GAIAVFDSVAGVEPQSETVWRQADKYKVPRMCFVNKMDRIGADFYRCVDMIIDRLGAVPL
EFG_NEOSM             GAVAVFDGVAGVEPQSETVWRQADKHNVPRLCFVNKMDRMGADFYRCAEMLVSKLSANPV
EFG_PSELT             GAVAVFDATAGVEPQSETVWRQAERYSVPRIAFMNKMDKTGADFFMSIKSMVEKLHAKPV
EFG_THEMA             GAIAVFDATAGVEPQSETVWRQADKYNVPRIAFMNKMDKVGADFYMAVETLVTKLRANPI
EFG_PETMO             GAIAVFDAQVGVEPQSETVWRQADRYRVPRIAFMNKMDKIGANFFNAIQTMKDKLGANPI
EFG1_SYNWW            GAVVIFCGKGGVEPQSETVWRQADKYQIPRIAYVNKMDAVGADFFRVIEQIKQRLGSNPL
EFG2_SYNWW            GSIGIFCAVAGVQPQSETVWRQADRYHVPRIAYINKMDRVGADFFRVIEMIRKNLSSDAV
EFG1_BDEBA            GAIAVFDGVNGVEPQSETVWKQADKYKVPRICFVNKMDRVGADFVMSFGTIKEKLNANPI
EFG2_DESPS            GVVAVFCAVGGVEPQSETVWRQANKYFIPRVAFINKMDRVGADFDHCLAMIEKRLRANPV
EFG1_GEOSL            GAVTIFSAVEGVQPQSESVWRQADRYGVPRICFINKMDRVGADLRGTLRQMEEKLKARPV
EFG1_PELCD            SAVVIFSAVEGVQAQTESVWRQADRYAVPRICLINKMDRIGADYRRVLEQMRKRFTTRPV
EFG2_SYNAS            GAVVVFDAVAGVEPQSETVWHQADKYGVPKIAFINKMDRVGADYFRVVKMMKERFASVPL
EFG3_MYXXD            GAVAVFDASQGVEPQSEAVWRQADRYNVPRIAFINKMDKVGADFAMSVASIQARLGARPV
EFG2_STRCO            GAVAVFDAVAGVEPQSESVWRQADRHGVPRIAFVNKMDRAGADLDAAVASIRERLHPVPL
EFG2_BORBU            GGIVIFSAVDGIQAQTETVWKQAEKYEIPRLAYVNKMDRIGADFFKVVGDIENKFKTIPL
EFG2_BORAP            GGIVIFSAVDGIQAQTETVWKQAEKYEIPRLAYVNKMDRVGANFFKVVEDIENKFKTIPL
EFG2_BORBP            GGVVIFSAVDGIQAQTETVWKQSEKYEIPRLAYINKMDRLGANFFKVVGDIENKFKTIPL
EFG1_TREDE            GAVAVLCAVGGVQPQTETVWHQADRYKVPRICFVNKMDRIGADFFAVLKDVHEKFGVEVM
EFG2_TREPA            GVVVVLCAVGRVQPQTETVWYQADRYDIPRVCFVNKMDRIGADFFSVLDQVHNKFGIDAV
EFG_CARRP             GAVILICASSGIQPQTETVWNQSEKFNIPKILFVNKLDRIGAKYLSIIENIKKKFFCNIL
EFG_RHOBA             GAVLVLCSVGGVQSQSITVDRQMKRYQIPRLAFINKMDRTGANPRRVVEQLREKLGADAF
K2LYN2_TRYCR          GAIMLMCGVGGVQSQTLTVDRQMKRYGVPRICFINKLDRDNANPQRALKMARERLGINAA
Q38BA0_TRYB2          GAVMLMCGVGGVQSQTLTVDRQMKRYGVPRVCFINKLDRDNANPRRALEMARERLGVNAA
A4ICS8_LEIIN          GAILLMCAVGGVQSQTLTVDRQMKRYGVPRICFINKLDRDNANPQRAVKQAQERLGINAV
Q4Q219_LEIMA          GAILLMCAVGGVQSQTLTVDRQMKRYGVPRICFINKLDRDNANPQRAVKQAQERLGINAV
A4HNR7_LEIBR          GAILLMCAVGGVQSQTLTVDRQMKRYGVPRICFINKLDRDNANPQRALKQAQERLGINAF
Q7RFK0_PLAYO          AAVLVICGVSGVQSQTLTVNRQMDRYHIPRILFINKLDRDGANIERTLETIEKKLNLNTI
A5K8J4_PLAVS          AAVLVVCGVSGIQSQTLTVNRQMNRYFIPRLLFINKLDRDGANVGRTLSTIEQKLNLNTL
A0A1Y3DJ13_PLAKN      AAVLVICGVSGVQSQTLTVNRQMNRYFIPRILFINKLDRDGANVERTLSTIEQKLNLNTL
A7AM19_BABBO          GAILLCCSVSGVQSQTLTVNMQMDRYSIPRIIFLNKMDRDGADPDRVISMIRQKLNIGIL
Q4MYM5_THEPA          SAVLLVCSVSGVQSQTVTVFRQMDRYNIPRIIFLNKLDREGASVDRSIQMLQRKLGVNLL
                      .      .   :: *: :         :. .   ** *   :                  

EFG2_ANADE            LMQLPIGLEDKFEGVVDLVKMKAFRFSGDDG--------EVITESEIPADMQADAARARE
EFG1_DESPS            MMQMPIGLEGDLVGMVDLVTMKAVYYEGENG--------DEIRITDIPAEMLDEATEKRE
EFG1_BORBU            LMQIPIGLEDKHIGVIDLVLMKAYYFEGKDG--------TEIIEKEIPSDLLEEAKSKRE
EFG1_BORBP            LMQIPIGLEDKHIGVIDLVLMKAYYFEGKDG--------TEIIEKEIPSDLLGEAKKKRE
EFG2_TREDE            MMQIPIGLEDKLEGVVDLVTMKAMYFEGENG--------TQIRMAEIPQHLLADAQKYRE
EFG1_TREPA            LMQLPIGLEDRLEGVIDLISLKALYFEGESG--------AHVREAPIPEQYQADVKKYRD
EFG1_SYNAS            LMQLPIGLEADFQGIVDLISMKAVYFDGAGG--------ELLRTEAVPESLLPEAISRRE
EFG2_BDEBA            MIQIPIGLEDQHRGHVDLTDMKAYINQGESG--------ENVLVEEIPADLVETAKKYRQ
EFG1_MYXXD            QMQMPIGAEDRLKGLINLIEMKAYYFDGESG--------EDIREEEIPAELLEEAKTRRQ
EFGM_DICDI            ALQVPIGKESNLEGVIDLVTEKAMIF-GEKG--------TAPIIEEIPSNFVEFVKEKKM
D3BMN4_POLPP          AVQIPIGGEINLEGVCDLLTEKAYIF-GEKG--------SKVQETEVPSSLVELLREKKI
EFGM_CRYNJ            AVQVPIGSESDFAGVVDIVRMKAIYNEGVKGN-------QIVETDEIPESVRALAEEKRA
EFGM_USTMA            AVQIPIGAEDDFNGVIDLIRWKAVYNEGHKGI-------DIRETDEIPAEYLELAKQKRA
EFGM_COPC7            AVQVPIGTEDELKGVVDLVHWRALYNEGPKGT-------EIRVSKDIPESVAELAKQKRA
EFGM_SCHPO            AVQIPIGQEDKLEGVVDLIQMRAIYNRGSKGE-------KIEISQQVPENLIELAKEKRS
F4NY64_BATDJ          PVQMPIGVETNLQGVVDLVYMKAYINQGVKGE-------TISV-QDIPADLLEKAQTMRN
D0NCX8_PHYIT          ALQVPIGAENDLEGVVDLLTMKALRNKGDSGE-------VIEESDDIPAETRSLAEEKRL
EFGM1_ARATH           AVQVPIGLEENFQGLIDLIHVKAYFFHGSSG--------ENVVAGDIPADMEGLVAEKRR
EFGM2_ARATH           AVQVPIGLEENFQGLIDLIHVKAYFFHGSSG--------ENVVAGDIPADMEGLVGDKRR
D7SLS6_VITVI          AVQVPIGLEDDFQGLVDLVQLKAYYFHGSNG--------EKVVAEEIPANMEALVAEKRR
M1CGG0_SOLTU          AVQVPIGLEDDFKGLIDLVQSKAYYFHGSNG--------EKIVTEDIPADMEAITSEKRR
EFGM_ORYSJ            AVQVPIGLEEEFEGLVDLVELKAYKFEGGSG--------QNVVASDVPSNMQDLVMEKRR
I1GYK4_BRADI          ALQVPIGLEEEFEGLVDLVELKAYNFEGGSG--------QDVVTSDVPSNMQDLVTDKRR
C5WSZ1_SORBI          AVQVPIGLEEEFEGLVDLVEMKAYKFEGSSG--------QNVTASDIPLNMEDLVTEKRR
A9RPB9_PHYPA          AVQFPIGLEDQIKGLVDLVHNQAYYSQGAHG--------EKVVKGDIPSEIKEAVSEKRR
A9SP22_PHYPA          AVQFPIGLEDQIKGLVDLVHNQAFYFQGAHG--------EKVLKGDIPSEIAAAVAERRR
EFGM_COCIM            AVQVPIGLEDEFKGVVDIIRMKAIYNEGPRGE-------MVVEKDEIPADVRPVAEERRR
C0NUK7_AJECG          AVQVPIGAEDEFEGVVDLIRMKAIYNEGSKGE-------IVVEKDEIPEKVKAIAEERRR
EFGM_EMENI            AVQVPIGAEDEFEGVVDLVRMKAIYNQGSNGE-------NIVVKDEIPEKVRELAEERRR
EFGM_ASPFU            AVQVPIGAEDEFEGVVDLIRMKSIYNDGPNGE-------TVVVKDEIPEKVKSVVEERRR
EFGM_SCLS1            ALQVPIGSEDSFNGVVDLIRMKAIYNDGPKGE-------IIRETDEIPEELKQLCKEKRA
C7YWN8_FUSV7          AIQVPIGAEDEFQGVVDLINMQAIYFEGPRGT-------KVRVTDQIPGPLQELVKEKRQ
I1RCR5_GIBZE          AIQIPIGAEDEFLGVVDLINMQAMYFEGPRGT-------KVRITDQIPGPLQDFAKEKRQ
EFGM_NEUCR            AIQVPIGSEKELEGVVDLIDMKCIRNDGQRGV-------NLKISKEIPAEIKELCEQKRQ
EFGM_ASHGO            AVHVPIGSESDLCGVVDIINRVAIYNEGENGE-------VLR-KGPVPEELQDLVEEKRL
EFGM_YEAST            AVQIPIGSESSLSGVVDLINRVAIYNKGDNGE-------IIE-KGPVPENLKPLMEEKRQ
EFGM_CANAL            AIQVPIGAEENLQGVVNIIDRVALYNEGEQGE-------TIR-KAEVPEDLKELVEEKRA
EFGM_YARLI            AIQVPIGSEGDLAGVVDIVKEVAYYNDGASGE-------TIR-VAEIPEDLKELVAEKRD
G3QKQ5_GORGO          FMQIPIGLEGNFKGIIDLIEERAIYFDGDFG--------QIVRYGEIPAELRAAATDHRQ
A0A2I3T1A0_PANTR      FMQIPIGLEGNFKGIIDLIEERAIYFDGDFG--------QIVRYGEIPAELRAAATDHRQ
EFGM_HUMAN            FMQIPMGLEGNFKGIVDLIEERAIYFDGDFG--------QIVRYGEIPAELRAAATDHRQ
G1QVZ1_NOMLE          FMQIPIGLEGNFKGIIDLIEERAIYFDGDFG--------QIVRYGEIPAELRAAAADHRQ
EFGM_PONAB            FMQIPIGLEGDFKGIIDLIEERAIYFDGDFG--------QIVQYGEIPAELRAAAADHRQ
F6QKI2_CALJA          FMQIPIGLEGNFKGIIDLIEERAIYFDGDFG--------EIVRYDEIPAELRAAAADHRQ
H0UVN5_CAVPO          FMQIPIGLEGNFKGIIDLIEERAIFFDGDFG--------QIIRYSEIPGELRAAAADHRQ
G1T5N5_RABIT          FVQIPIGLEGNFKGIIDLIEQRAIYFDGDFG--------QIVRYDEIPAELRAAAADHRQ
G1M4M7_AILME          FMQIPIGLEGNFRGIIDLIEERAIYFDGDFG--------QVVRYGEIPTEFRAAAADHRQ
M3WIL3_FELCA          FVQIPIGLEGDFKGVIDLIEERAIYFDGDFG--------QIVRYEEIPAEFRAAAADHRQ
G1NTB9_MYOLU          FVQIPIGLEGDFKGIIDLIEERAIYFDGDFG--------QIVRYGEIPAEFRAAAADHRQ
H0WY66_OTOGA          FVQIPIGLEGNFKGVIDLIEERAIYFDGDFG--------QIVRYGEIPAELRAEAADHRQ
EFGM_MOUSE            FVQIPIGLEGDFKGIIDLIEERAIYFDGDFG--------QIVRYDEIPAGLRAAAADHRQ
EFGM_RAT              FVQIPIGLEGDFKGIIDLIEERAIYFDGDFG--------QIVRYDEIPADLRAAAADHRQ
F7EHU0_MONDO          FVQIPIGLEGNFKGIIDLIEERAIYFDGDFG--------QTIRYTDIPAEFRAVATDHRQ
G1KFW0_ANOCA          FIQIPMGLEGDFRGIIDLVEEKAIYFDGDFG--------QIVKYDEIPLEFRAESVDRRQ
F6Q9W5_XENTR          FVQIPIGIESKFKGIIDLVEERAMYFDGEFG--------QTMRYEDIPAEFRAEAMDRRQ
H3AWE2_LATCH          LVQIPMGLESSFQGIIDLIEEKAIYFEGQFG--------QNIQYDEIPPEFRAEAADRRR
H3CQL2_TETNG          FVSIPIGLESNMRGIIDLVEERSLYFDGTFG--------QNIRYDEIPADFRAEAADRRQ
I3J7A5_ORENI          FVNIPIGLEGNMRGIIDLIEERSMYFEGQFG--------QSIRYDEIPADFRAEAADRRQ
G3P617_GASAC          FVSIPIGLEGNIRGIVDLVEERSMYFEGPFG--------QTIRYDEIPADFRAEAAGRRQ
EFGM_DANRE            FVNIPIGLEGNLRGIIDLIEERSIVFDGPFG--------ESVRYEDIPPEMRSEAADRRQ
C3ZDC2_BRAFL          FVQLPIGLESKTKGIVDLVHRRAIYFDGSDG--------AQLRYEDVPGDMRAQVEDRRQ
EFGM_ANOGA            FVQLPIGVESNCKGVIDLVKQRALYFEEPYG--------LKIREDEIPADMRTESAERRQ
W5JI53_ANODA          FVQLPIGVESNCKGVIDLIKQKALYFEEPFG--------LKIREDEIPADMRTECTERRQ
EFGM_AEDAE            FIQLPIGVESNCKGIVDLVKQRALYFEDHLG--------LTVREDEIPQEMRAESDERRH
EFGM_DROME            FIQLPIGVESNCKGIVDLVREKAIYFEGEHG--------MDIRLDEIPQDMRVESLERRQ
EFGM_DROPS            FIQLPIGVESNCKGLVDLVREQAIYFEGENG--------MDVRLDEIPQDMRVESQERRQ
E9G149_DAPPU          FLQLPIGLESECKGVIDLVHQRAIYFEGVLG--------TTIRYDEIPSDMRAESEDRRQ
A0A087ZTR9_APIME      FLQLPIGLESKNKGIIDLINQKALYFEGNFG--------EIVREDEIPSDMRTETQEKRQ
E0VF81_PEDHC          LVQIPFTHQNDI-GIIDLIDRKAMLFKGACG--------ENVEEIEIPKEMLAEAEDRRS
EFGM_NEMVE            LLQLPVGLEGNNTGVVDIIRWKAYYFDGDNG--------EIVREDVIPEDMVDECRKRRQ
F6UKC4_CIOIN          FLQIPIGLEGDSSGIVDIINRKALFFEGDNG--------QTVTEKPIPENLIEITETKRT
EFGM_CAEBR            LVHLPIGKDSNFNGIVDLVEGHALYYEGEGG--------LIVRKDEIPKDLRVEAEDRRQ
EFGM_CAEEL            LIHLPIGKDSNFNGIVDLVEGHALYYEGEGG--------LIVRKDEIPKDLRVEAEDRRQ
A0DGW7_PARTE          AVQIPIGQDQTFNGLVDLIKMKAYFFEGLKG--------EDVKETEVPERYMEEAKEKRQ
A0C9U4_PARTE          AVQIPIGQDQTFNGLVDLIKMKAYFFEGLKG--------EDVKETEVPERYMEEAKEKRQ
Q22AK9_TETTS          AVQIPIGIDQSLKGLVDIVEMKAIIFEGESG--------EILNVQDVPANLIELAKEKRH
EFG1_ANADE            PLHVPIGAEDKFRGMVDLLKMKGITFDDE-------TMGAKYQEVEIPADLAAQAKEYRA
EFG2_MYXXD            RMQLPLGAEDKHRGVIDLLKMKALVFQDS-------EQGSHYEESDIPEEFKEAADAARA
EFG_KORVE             AIQYPIGLEDKFKGVIDLFKMKALVWHDE-------AMGSQYDVEEIPAELLKKAQAFHN
EFG_SOLUE             PIQLPIGAEEKFLGIVDLVEMRGIIWRDE-------TMGAKYDVIEIPDDLKDKAKEYRE
EFG2_GEOSL            PIQLPIGAEDTYRGVVDLVEMKAIIWDEE-------SLGAKYHEAEIPADLAEMAQEYRE
EFG2_PELCD            PLQLPIGKEDNFSGVVDLVEMKAIVWDDE-------SLGARFEVVDIPADLQERVDSGRE
EFG_MAGMM             PAQYPIGAEEDLRGMVDLITRKAYIFNDE-------SLGAEFEVLDCPEDIEAEVEEARE
EFG_CHLAA             IVQLPIGVEDSFRGTIDLFKMKATVYYDD--------LGKDIREEEIPAELRPAAEQARN
EFG_HERA2             PIQLPIGAEDRFQGIIDLMENKAIFYMDD--------VGKVQEEREIPAELAEKAKAARE
EFG_DEHM1             PLQIPIGCAETFRGSCDLLDFQCYGMDNS--------PEEPAETFDLPDADKERAVKFRN
EFG_GLOVI             PIQLPIGAEDTLSGIVDLVGMKAYVYGND--------IGTDIRVEEIPADMEELVQEYRA
EFG2_SYNY3            PVQIPIGSEAEFEGIVDLVRMKAYLYKND--------LGTDIQEVPIPDSVKDKTEEYRL
EFG_DEIRA             PIQYPMGAENDFKGVIDIVRMQAHTFTND--------LGTEIQVGDVPAEYMDKVNEMRQ
EFG_ENTFA             PIQIPIGAEEDFTGIIDLIKMKAEIYTND--------LGTDIQETDIPEDYLEKAQEWRE
EFG_OENOB             AIQWPIGAEDDFAGVIDLIQREAWYPDDK--------LGTEWEKRPIPDDLKDLVEEKRD
EFG_MESFL             PIQLPIGAEDNFTGIIDLVEMKAYEFDGK--------AEEIAKEIEIPADLKDQAEILRS
EFG_MYCPN             PIQLPIGAENDFNGIIDLIEEKVYFFDGG--------KEEKAEEKPIPDQFKDQVKQMRA
EFG_MYCA5             PIQLNIGEEAQFTGIIDLVEMKAYEFDGK--------PEENMKEIPIPAHLLDEATLMRS
EFG_CLOAB             PIQIPIGKEDNFLGLIDLIRNEAIVYTDD--------LGTTMEEQEIPADMKELAEKYRS
EFG_LACP7             PIQLPIGKEDTFKGVIDLFEMKAYYYLDD--------KGEQIEIKEIPDDMKDQAEEYRA
EFG_FINM2             PIEIPIGAEDKFVGVVDLITMKANIYKNE--------LGTEFTVEEIPSDLVEVAEKYRA
EFG_MOOTA             PIQLPIGAEDSFQGMVDLINMKAIYYTDE--------LGTTLDEEPIPAEMEDLVQEYRE
EFG_ECOLI             PLQLAIGAEEHFTGVVDLVKMKAINWNDA-------DQGVTFEYEDIPADMVELANEWHQ
EFG_WIGBR             PIQLPIGKENNFVGIIDLIKMKSIYWSEI-------DQGITFEYKEIPKDLMVLSNSYRN
EFG_HYDCU             PMQLPIGAEETFRGVVDLVKMKAIYWEEE-------NMGMKYTYEDIPEDMVELCEEWRE
EFG_FUSNN             PIQIPIGAEDQFEGVVDLIEMKEIVWPVD--S----DQGQHFDVKDIRAELKEKAEETRQ
EFG_SULSY             PIQVPIGAEDNFKGVVDLFNMKAIIWEGD-------ELGAKFEEKEIPAELIDLAQEWRE
EFG_PARUW             PVQCPIGAEADFKGMVDLVKMRAYLFHDE-------TLGADWDETDIPADLLEKCKKMRA
EFG_ENDTX             PVQIPIGAESSFQGIVDLVTMKAHIWSGE-------ELGAKFDITDVPKELEEKAHAARS
EFG_CUTAK             LLQLPIGAEDQFMGIVDLVEMNAKTWRG-ET-----ELGAHYETEDIPADMKDEAEAARA
EFG1_STRCO            VMQLPIGAEADFQGVVDLVRMKALVWSA-DA-----AKGEMYDVVDIPATHTEAAEEWRG
EFG_BIFAA             VVQLPIGAENDFAGVVDLIRMKAYVWNDVSG-----DLGAHYDTTDIPADLQDKAEQYRS
EFG_DESAG             ALQVPIGSEDEFQGIVDLVTGKAVVFDK--A-----SKGAEFAVTGVPAELQDQFDVMRL
EFG_PARD8             PIQIPIGAEETFKGVVDLIKMKAIFWHD--E-----TMGAEYSVEEIPADLQAEAEEWRD
EFG_SULMW             ILQIPIGIEDNFQGVVDIISKKAIIWDE--K-----NYGTSYNIRTIPEELLELTNKYRN
EFG_SALRD             PVQYPIGAGDMFRGVIDLIEGKAIIYDD--E-----SQGMQWDVREIPDDLESKAEHWRI
EFG_CHLT3             PIQIPIGQGEMFAGFIDLIRMKGIIYDK--E-----D-GTTYQEVEIPHDLENQAKTWRV
EFG_GLUOX             PLQLPIGAEENFIGVVDLVEMRAIVWEGG-------ELGAKFHYEEIPDDLKEKAAEARQ
EFG2_HAHCH            VVHLPVFVEETYVGLIDLTTMSLHRWNA--------DDGWKYSSEEITPEYQEQAAQYRA
EFG1_METCA            VMTLPIGREESFIGVVELLTRKAWIWDDS-------GDPMKYEVKDVPAEMADEVEKWRA
EFG1_SYNY3            VMTLPIGTENDFVGVVDILTEKAYIWDDS-------GDPEKYEITDIPADMVDDVATYRE
EFG_HYPNA             PIQMPIGSETELEGHIDLVTMTEWVWEGE-------DLGASWVLRPVRESLKAKAEEMRA
EFG_RHORT             VINLPIGSESDYAGVIDLIKMKAVIWHSE-------DLGAHFDYVDIPAEYAEKAAEYRE
EFG_NEOSM             ILQLPIGVSESFVGVVDLVKMQAIYWQGD-------DFGAKFEYREIPADLAEQAALYRE
EFG_PSELT             AIQVPIGAEKDFIGVVDLIEMKAITWTSE--------DGSEFIKHEIPENMLDLAEEMRE
EFG_THEMA             PVQMPIGSEKDFQGVIDLIKMKAIYWVSE--------DGSVYEERDIPEELREEAEMRRE
EFG_PETMO             ALQVPIGSEAEFEGVVDLLTMEALYWTDE--------NGQIIEKRSIPSNLIDFCESKRE
EFG1_SYNWW            VISLPVFKEECFSGIIDLIKMKYYTFAGK--------LGNDIAEESIPSEYTETAEEWRS
EFG2_SYNWW            AIQLPIGVEEAFSGIIDLIDFKAYIYEDE--------SGEQYQERELNPDERSKAQEFRN
EFG1_BDEBA            PVQVPIGMEDTFRGVVDLLENKAYMWDQS-------GMGDHFEITDVPNDMKEEVNRFRT
EFG2_DESPS            AVQIPVGSEAEFAGVIDLIEGEMYAFDDA-------TLGQEVERREVPTEYKERFTAARI
EFG1_GEOSL            LLQLPVGEETGFRGVIDLLAEELITFADGDQ-------GRTVSRGPVPADLLDAAREGRD
EFG1_PELCD            LMHLPLGIEGDFAGVIDVLEGRCLTFSETDQ-------GATVETCDIPEERQSEVAAARE
EFG2_SYNAS            PIQIPLGQQDQFLGVVDLIREKVVTWDDGSK-------GVNYQYSEIPGDREADAKANRE
EFG3_MYXXD            AVQWPLGAGSEFRGLVDLVRMRAVMFDGED--------GSFVDGQAVPEAVRAEVEAQRL
EFG2_STRCO            VVQLPIGTEDGFTGVVDLPRMRALVWADGA--------DAAEEG-PVPGTLREEAARRRR
EFG2_BORBU            VLQIPIGNESNFEGVVDIILNKELHFSMENG-------IPKLTYSQIREEFIEKVILFKK
EFG2_BORAP            VLQIPIGNESNFEGVVDIILNKELHFAMENG-------IPKLTYSQIREEFIEKTALFKK
EFG2_BORBP            ILQIPIGNESNFEGVVDIILNKELHFAMENG-------IPKLTYSPIREEFAEKVGFFKK
EFG1_TREDE            PVQIPIGASDSFEGVIDLIAMKEIHWDAATE-------GEKYEYTAIAQERLALAEEWRE
EFG2_TREPA            ALQIPIGSGTSFEGVIDLITMKEIFWDAASS-------GEQMEYRPIQSARIAQAREARE
EFG_CARRP             IINLNIGIENSFSGIIDLINMKELIWNNS-----------QLEIRNITNKNFDISNKYRN
EFG_RHOBA             LAQIPIGAEENFRGVVDLIEMVAYTFEGD--------QGEKVVTGEIPADLKDEAEEARV
K2LYN2_TRYCR          FIQINMGIAQDFEGVVDVIEKRAVYFDGA--------NGERIRFEEVPAYLKDELKTARK
Q38BA0_TRYB2          FIHLNMGVAQDFEGVVDVIESRAVYFDGK--------NGEKIRFEDIPSYIADDVVATRK
A4ICS8_LEIIN          FIQLNMGTAQDFEGVVDLIEEKAVYFDGP--------FGEAIRYEPVPSYIKEDVAAARK
Q4Q219_LEIMA          FIQLNMGTAQDFEGVVDLIEEKAVYFDGP--------FGEAIRYEPVPSYIKEDVVAARK
A4HNR7_LEIBR          FIQLNMGIAQDFEGVVDLIDEKAIYFDGP--------FGETIRYEPVPSYLKEDVNAARK
Q7RFK0_PLAYO          LLQIPIGIEQKLKGVYDLVNKKGYLFKGKSGVDVEEIPSDQDILNIDSGFPINLVDLLRN
A5K8J4_PLAVS          LLQMPIGIEQKFKGVYDLVSRRCYLFKGLNGIIVEEVN-DDEVTAHDPSFSHEVVEMLRT
A0A1Y3DJ13_PLAKN      LLQMPIGIEQKFKGVYDLVSRKCYLFKGVNGIIVEEVN-DAEVTAHDPSFSYEMMDMLRI
A7AM19_BABBO          QLQLPIYAGSRFEGLIDVLEDCSYYFEGSNG--------QTVVKKDVPAEYKEATISQKL
Q4MYM5_THEPA          QLQIPIGIGPKLEGIIDLVEMKAYYFRGQYG--------EKLVSQPVPENMLKEAEKLNF
                           .       *  ::                                        . 

EFG2_ANADE            ELLDAASMFSDE---LTDAILED-----RVTEELIKAAVRKGTLAL------KLTPVFMG
EFG1_DESPS            TLLEEISMFSEE---LMEALLEDSE---NVDIDLIYKAVRQGTIAL------EFTPVFMG
EFG1_BORBU            IMLDTLADFNDE---LMELHMEGK----EVPTEIIYNATRTGTLAL------KLCPVFMG
EFG1_BORBP            IMLDALADFNDE---LMELHMEGK----DVPIEIICNAIRTGTLAL------KLCPVFMG
EFG2_TREDE            EMIDAATMFSDE---LAEAFLEGA----ETE-EMIRAAVRKGTLAE------QFVPVFLG
EFG1_TREPA            ELIDAASLFSDE---LAEAYLEGT----ETD-QLIRAAVRAGTIAE------KFVPVFCG
EFG1_SYNAS            ELIDSVSLFSDS---LTEAILEGT----EISEVMIMEAVRQGTLER------KITPVFIG
EFG2_BDEBA            IMIGKLADVDSA---IEEKFLMEE----EPTTEEIRAAIRKGTIGL------KLVPVLCG
EFG1_MYXXD            QMIEGVAEVDDQ---LGELFLADQ----PISNEALIAAVRRATIGL------KMTPVMCG
EFGM_DICDI            ELVETIANVDDE---LGEWMIENDFPNNMPDEKTLTAAIRRTTIAR------KVVPVMMG
D3BMN4_POLPP          ELIERVANVDDK---LGEWIIENDFPANMPDEQTLGDAIRRCTVNR------TFVPVFMG
EFGM_CRYNJ            ELIEQLSEADET---LCDLFLDEA----PITPTDIAQALQRATTSL------RFTPVFMG
EFGM_USTMA            ELIEQLAEVDDE---MTEMFIEER----EPTIEELAAAIRRTTIRC------QFSPVFLG
EFGM_COPC7            ELIEQLAEVDEE---IGELFLMDE----TPTNRQIADAIRRATIDL------KFSPVFMG
EFGM_SCHPO            ALIEKLADLDEE---IADIYVMEE----DPTPEQLMGAIRRTTLAR------KFTPVLMG
F4NY64_BATDJ          TLIESIADIDET---IGDIYLNEN----VPTPEQLRDAIRRVTISR------TFVPVFMG
D0NCX8_PHYIT          ELIEALADVDDE---IAELFLMEE----EPTVEQLKDAIRRTTIAH------KFVPVMMG
EFGM1_ARATH           ELIETVSEVDDV---LAEKFLNDE----PVSASELEEAIRRATIAQ------TFVPVFMG
EFGM2_ARATH           ELIETVSEVDDV---LAEKFLNDE----PVSAAELEEAIRRATIAQ------KFVPVFMG
D7SLS6_VITVI          ELIEMVSEVDDK---LAEAFLTDE----PISSASLEEAIRRATVAQ------KFIPVFMG
M1CGG0_SOLTU          ELIEAVSEVDDK---LAESFLNDE----PISSADLEAAIRRATIAR------KFVPFFMG
EFGM_ORYSJ            ELIEVVSEVDDQ---LAEAFLNDE----PIQANQLKAAIRRATVAR------KFIPVYMG
I1GYK4_BRADI          ELIEVVSEVDDQ---LAEAFLNDE----PISANELKAAIRRATVAR------KFIPVYMG
C5WSZ1_SORBI          ELIEVVSEVDDQ---LAEAFLNDE----PITANQLKAAIRRATVAQ------KFIPVYMG
A9RPB9_PHYPA          ELIEAVSEVDEE---LADLFLNDE----PISPEVLSGAVRRATLNL------QFIPVFMG
A9SP22_PHYPA          ELIESVSEVDEE---LADLFLNDE----PILPEILSGAVRRATLNL------QFIPVFMG
EFGM_COCIM            MLIETLADVDDD---IAELFLEEK----EPTVEQLKAAIRRATIAR------TFTPVFMG
C0NUK7_AJECG          MLIETLADVDDE---IAELFLEEK----EPTQEQIKAAIRRSTIAL------KFTPVFMG
EFGM_EMENI            MLIETLADVDDD---MAEIFLNEE----EPTEKQIKDAIRRATIGL------KFTPVFMG
EFGM_ASPFU            MLIETLADVDDE---IAELFLEET----EPTEQQLKAAIRRATIGL------KFTPVFMG
EFGM_SCLS1            LLIETLADVDDE---IAEIFLDEK----TPSIEQMKAAIRRATINL------KFTPVLMG
C7YWN8_FUSV7          ALVEKLADVDDE---IAELYLDEQ----EPTNQQIKDAIRRATIAR------AFTPVMMG
I1RCR5_GIBZE          ALIEKLADVDDE---IAELYLEEQ----EPSNAQIKAAIRRATIAR------AFTPVMMG
EFGM_NEUCR            ELIEKLADVDDE---IAEMFLEEQ----TPTPEQIKAAIRRATIAC------KFTPVLMG
EFGM_ASHGO            LLVETLADVDDE---MAEIFLDEQ----EPTVQQIKDAIRRATIAR------KFTPVLMG
EFGM_YEAST            LLIETLADVDDE---MAEMFLEEK----EPTTQQIKDAIRRSTIAR------SFTPVLMG
EFGM_CANAL            LLIETLADVDEE---MADIYLEGE----EPTVEQIKGAIRRATIGR------KFTPVLMG
EFGM_YARLI            LLIQTLADVDDE---IAECYILEE----TPTEEQLRGAIRRATIAR------TFTPVLMG
G3QKQ5_GORGO          ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLKR------SFTPVFLG
A0A2I3T1A0_PANTR      ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLKR------SFTPVFLG
EFGM_HUMAN            ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLKR------SFTPVFLG
G1QVZ1_NOMLE          ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLKR------SFTPVFLG
EFGM_PONAB            ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLKR------SFTPVFLG
F6QKI2_CALJA          ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLNR------LFTPVFLG
H0UVN5_CAVPO          ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLSR------AFTPVFLG
G1T5N5_RABIT          ELIECVANSDEQ---LGELFLEEK----IPSASDIKLAIRRATLSR------SFTPVVLG
G1M4M7_AILME          ELIECVANSDEQ---LGEMFLEEK----IPSVSDLKCAIRRATLNR------SFTPVFLG
M3WIL3_FELCA          ELIECVANSDEQ---LGEMFLEEK----IPSISDLKCAIRRATLNR------SFTPVFLG
G1NTB9_MYOLU          ELIESVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLSR------SFTPVFLG
H0WY66_OTOGA          ELIECVANSDEQ---LGEMFLEEK----IPSISDLKLAIRRATLNR------SFTPVFMG
EFGM_MOUSE            ELIECVANSDEQ---LGELFLEEK----IPSVSDLKRAIRRATLSR------SFTPVFLG
EFGM_RAT              ELIECVANSDEQ---LGELFLEEK----IPSVSDLKLAIRRATLSR------SFTPVFLG
F7EHU0_MONDO          ELIECVANSDEQ---LGEMFLEEK----VPSVTDLKLAIRRATINR------LFTPVFVG
G1KFW0_ANOCA          ELIECVANIDEQ---LGELFLEEK----IPTVADLKSAVRRTTLSK------SFTPVLVG
F6Q9W5_XENTR          ELIESVANSDEI---LGEMFLEEK----IPTVSDLKLAIRRATLKR------LFTPVLVG
H3AWE2_LATCH          ELVECVANVDEQ---LGEMFLEEK----VPTIAELKSAIRRATISR------SFTPVLVG
H3CQL2_TETNG          ELVECVANADEI---LGEMFLEEK----VPSNADLKAAVRRATVKR------LFTPVLVG
I3J7A5_ORENI          ELVECVANADEM---LGEMFLEEK----IPSKDDLKAAIRRATVQR------LFTPVLVG
G3P617_GASAC          ELVECVANADEM---LGEMFLEEK----VPTNDDLKAAIRRATVQR------LFTPVLVG
EFGM_DANRE            ELVECVANADET---LGEMFLEER----VPTVLDLKAAVRRATVKR------SFSPVLVG
C3ZDC2_BRAFL          ELIEHLSNVDEQ---LGEMFLLEE----VPSEEQIHAAIRRQCIAR------SFTPVFVG
EFGM_ANOGA            ELIEHLSNVDEK---IGELFLEER----EATVEDIMGAIRRSTLKR------AFTPVLVG
W5JI53_ANODA          ELIEHLSNVDDK---LGELFLEEK----VPTEQDVMSAIRRATLKR------VFTPVLVG
EFGM_AEDAE            ELIEHLSNVDES---IGELFLEEK----TPTEQDIMAAIRRSALKR------TFTPVLVG
EFGM_DROME            ELIEHLSNADET---LGELFLEEK----PFTEDDIKAALRRTCINR------TFTPVLVG
EFGM_DROPS            ELIEHLSNADET---FGEFFLEEK----PFSEADLRAALRRTCINR------TFTPVLVG
E9G149_DAPPU          ELIESVSNVDEI---LGEIFLEEK----VPTELDLMAAIRRSCIKR------VFTPVMLG
A0A087ZTR9_APIME      ELIEHLSNVDEH---LGEMYLNEI----QILEKDIVDAIRRCCIKR------TFVPILVG
E0VF81_PEDHC          ELVECVSNGDEI---LGDAYLQEK----PISENDIKQAIRRACISR------MFTPVYVG
EFGM_NEMVE            ELIEVVADVDPE---LGDLFLEEV----KPSESQIIAAIRRATIER------TFTPVFVG
F6UKC4_CIOIN          ELIECVSNVDEE---LAEMFMMDE----VPSVKQLKDAIRRATIAR------KFTPVLMG
EFGM_CAEBR            ELIEHIANVDET---LGEMFLNDQ----KPDVKQIHEAIRRTVVKR------QFVPVLSG
EFGM_CAEEL            ELIEHIANVDET---LGEMFLNDQ----TPNVQQIHEAIRRTVVKR------AFVPVLSG
A0DGW7_PARTE          ELIETLGSIDPE---IEDLYLNEQ----PISEEKLKASIRKNCQEH------KFYPVFMG
A0C9U4_PARTE          ELIETLGSIDPE---IEDLYLNEQ----PISEEKLKASIRKNCQDH------KFYPVFMG
Q22AK9_TETTS          ELIEVLAEIDHQ---IEEKYLAEE----ELTAEEIKAAIRRQTIAL------KFSPVFMG
EFG1_ANADE            KLEETVAEIDDE---LMAKYLDGK---PL-SNDELMRGIRRGTLEM------KFFPVLCG
EFG2_MYXXD            ELLEAAAEQDDA---LTEKFLEGV---EL-TEDEVRGAIRKGCLGL------KLFPVFCG
EFG_KORVE             LMVETIAECDDE---LMAKYIEGE---EM-TAAELQAGLRRATIAM------KVFPVTVG
EFG_SOLUE             HMIEAISEHDEA---LMHKFIEGQ---PI-SNDEIRAGIRKATIAL------QIFPVICG
EFG2_GEOSL            KLIEEIATFDDA---LMEKYLGGE---EL-TTDEIKAAVRKATIDI------QICPVICG
EFG2_PELCD            LLVEEVCTHDEA---LMDKYLGGE---EI-TLEELKNGIRKACIDI------KIIPVLCG
EFG_MAGMM             ALLEAALEQDDT---LMEKYLEGE---EI-TIAEFKSCMRRAVISS------AFVPVFCG
EFG_CHLAA             ELIEMIAETDDE---LTLLYLEGQ---EL-TVEELKRGLRKATIER------KLVPVLCG
EFG_HERA2             YMLEAIAETDDE---LMMLYLEGE---EL-QVPELRRALRAATIGN------KLVPVLCG
EFG_DEHM1             TMIERLAEEDDE---VMEAYLAGE---EL-PVEKLKAAIRRVCLAN------KAIPIFCG
EFG_GLOVI             KLIEAVSETDDV---LLEKYFGGE---EL-TEAEIKAALRKGTVAN------TIVPMLCG
EFG2_SYNY3            RLVESVAEADDA---LMEKYLEGE---EL-TADELVAGLRRGTIAG------TMVPVLCG
EFG_DEIRA             QLIEAAAEVDED---LMMKFLEGE---EP-TQQELIAAIRKGTIDK------QIFPVLCG
EFG_ENTFA             KLVEAVAETDED---LMMKYLEGE---EI-TEEELVAGIRQATINV------EFFPVLAG
EFG_OENOB             ELIEAVADVDDS---LMEKYLGEE---EI-TVDDLKAAIRRATLAL------KFYPVLAG
EFG_MESFL             ELVEAAVEYDEE---LMMKFLDGE---EI-TIPELKQAIRKGVIGA------EFFPVLAG
EFG_MYCPN             HLVEEVANFDDQ---LMADYLEGK---EI-SIADIKRCIRKGVIGC------QFFPVLCG
EFG_MYCA5             SLIESVADFDEE---IMEALLEEK---EV-SIEKIKAAIRKATLSA------TYFPVVCG
EFG_CLOAB             EMIEAIVELDEE---LMNKYLEGE---EI-SVEEINAALRKGVIAN------EIVPVTCG
EFG_LACP7             AMIESICETDDD---LIEAFLEGN---EP-SNEELKKALRNATISV------QIIPVLCG
EFG_FINM2             ELLENIAEHDEE---LMEKYLEGE---EL-TEEEIKRAIRTATIAN------AMNPVLCG
EFG_MOOTA             KLLEAVAESDEE---LMIKYLEGE---EL-TPEEIKAGIRKATIAV------KMVPVLCG
EFG_ECOLI             NLIESAAEASEE---LMEKYLGGE---EL-TEAEIKGALRQRVLNN------EIILVTCG
EFG_WIGBR             ILLETSAEASEK---LTEKYLY-K---NL-TEQDIIEGLRIRSLKN------EIIPVTCG
EFG_HYDCU             KMVESAAEANEE---LMDKYLEEG---DL-SEEEIKAGIRQRCIDV------EIVPMFCG
EFG_FUSNN             YMLESIVETDDA---LMEKFFGGE---EI-TKEEIIKGLRKATIDN------TIVPVVCG
EFG_SULSY             KMIEAIVETDES---LMEKYFAGE---EI-PAEDLKKALRKATIER------KLVPMLCG
EFG_PARUW             ELLEELATLDEDDENFMQKVLENP---DSLTEDEINAAIRKGVCQN------KFNPVLCG
EFG_ENDTX             EMIELIADYSDD---IMNNFMEGK---ES-TAVQIKQAIRNATLQI------KLIPVLCG
EFG_CUTAK             EMLETVAENDEE---FMELYLEDP---DAVTVDQVKAAIRRGVLAS------AFTAVTCG
EFG1_STRCO            KLVEAVAENDEE---VMELFLEG----QEPTEEQLYAAIRRVTIASGKSSDTTVTPVFCG
EFG_BIFAA             ELLDQVAESDEE---LLEKYLES----GELTEDEIRAGIRKLTINR------EAYPVLCG
EFG_DESAG             ELIEAVAEEDDA---LMEKYLGG----EELTEEEIHSAIRRATIAR------TAVPVLCG
EFG_PARD8             KMLEALAECDDA---IMEKYFDDP---STITEEEIMVAIRKGTLAM------QINPMTCG
EFG_SULMW             ILIETISEYDYD---IMGKYFSNP---NEISENDIISSIKKSTINL------DIVPIICG
EFG_SALRD             NLLESVAEYDDE---LLMKYLDED---QEVEPEELHTVIRKATLNR------DMTPMFCG
EFG_CHLT3             NMLEAVSDIDDS---LLEKYLNG----EEITEEEVRRTLRVATLKT------EIIPVLCG
EFG_GLUOX             TLLDTALAMDDA---AMEEYFEKG---DV-DVAILKKCIKKGAISG------EFRPVMCG
EFG2_HAHCH            QLEETLVELDDE---LLEGWFNGA---TL-QADDLKRLIRQGVVSG------AFVPVLCA
EFG1_METCA            ELVEKAVEQDDE---VMEKYLEGE---EP-DVDTLKRLIRKGTIKL------DFFPTYCG
EFG1_SYNY3            MLIETAVEQDDD---LMEKYLEGE---EI-SIDDIKRCIRTGTRKL------DFFPTYGG
EFG_HYPNA             HLVELAVEMDDA---AMEAFLEGK---EP-DVPALRALIRKGTLAL------KFVPILCG
EFG_RHORT             KLLETAVEMDDA---AMEAYLEGV---EP-DEETLKKCIRKGTIAM------KFVPVLNG
EFG_NEOSM             KLMEKIAETDDK---FMDKYFGGE---EI-SEEEIRAAIRAGTIGY------HFVPVLCG
EFG_PSELT             EMISMLAEEDEE---LLELYLEEQ---EL-PVEKIKDILRKATINN------KLVPVLCG
EFG_THEMA             EMLEKIAELDEE---ILEKYLEGE---EI-SEEEIKRVLRKATIEN------KAVPVLCG
EFG_PETMO             DLIAAVAEVDEN---IMELYIEEE---EI-PVDKLKEAIRTSTIQS------KIVPVLCG
EFG1_SYNWW            VLVEKLAETDET---LLDLYYNNE---EI-DAGLLSRVIRTNTVSG------NMVPVCCG
EFG2_SYNWW            LLLERLAEYDDS---ILEKYLEAR---EI-SPAEIRSSLRKSCISN------QIVPVLCG
EFG1_BDEBA            EVIEKIVEFEDE---LLEKYLNGE---EV-TVPELKRALRKGTLEL------KAFPVFCG
EFG2_DESPS            SLLEKLADFDEE---LMEKFLDDE---LI-SSATIYKALRKATLAL------ELVPVFCG
EFG1_GEOSL            AVAEAAADFDDA---ILADLLEG----KDITAARLRGALRLGVLAC------RIFPVLLG
EFG1_PELCD            QIVEAAADFDDA---ILADFLEG----RPIKAARTRAALRRGVLTC------RLCPVFLG
EFG2_SYNAS            IMLEILAEVDDG---IAEKYLEG----EEISESDLLRAIREATLAN------RLVPVMCG
EFG3_MYXXD            RLIEACADEDAT---VLEKFVDGRL--EDITAEDLERALRSGALAR------TLVPVLCG
EFG2_STRCO            VLEEAVAERHPG---ALEEFCDR----ETLTAATLTGALRDLTRTG------DGVVVLCG
EFG2_BORBU            KLIDILSQFSEE---ITQLFLEDK----EIGLDIIKREIRRGTISR------FIIPVLMG
EFG2_BORAP            KLIDILSQFSEE---ITQLFLEDK----EISLDVIKSEIRRGTISR------FIIPVLMG
EFG2_BORBP            KLIDILSQFSEE---ITQLFLEDK----EISLDIIKSEIRRGTISR------FIIPVLMG
EFG1_TREDE            KMLDTISSASDE---ITELILEGK----DVPEELIKKEIRKAVLNQ------SYIPFLCG
EFG2_TREPA            KMLDVISIYSDE---VTECVLAGE----HVPVQLLHAEIRKAVRER------RYVPFLCG
EFG_CARRP             ILLETLSEYDDI---FLEKYI-NS----NFSIKDIIESIRKLVILN------KIIPIACG
EFG_RHOBA             AMLDSLSNYSDE---VMELLLSEE----EVSKDMIYRVMREAVLNG-------ATPVYMG
K2LYN2_TRYCR          ELIERLAECDSE---MEELFLNDK----EPNTEMIHAAIRRATIAN------KFIPVLLG
Q38BA0_TRYB2          ELISRLADCDAE---MEDVFLNDV----EPTAEQIHSAIRRTTIAN------KFVPVLVG
A4ICS8_LEIIN          ELVSRLAECDEE---MEFIFLNDQ----EPTVEQIHAAIRRATIAN------KFVPVMVG
Q4Q219_LEIMA          ELVSRLAECDEE---MEFIFLNDQ----EPTVEQIHSAIRRATIAN------KFVPVMVG
A4HNR7_LEIBR          ELVSRLAECDEE---MESIFLNDQ----EPTAAQIHAAIRRATIAN------KFVPVMVG
Q7RFK0_PLAYO          RIFEKLADADDE---FAEIYLNNDVND--IKINDIYKTIRKCTIQN------KIAPICLG
A5K8J4_PLAVS          RIFEKLADVDDE---FAEVFLNQEMGD--IRVEDVASAIRRCTIRN------AIVPICLG
A0A1Y3DJ13_PLAKN      RMFEKLADVDDE---FADIFLNQEMND--IKTEDVIDAIRRCTIKN------AIVPICLG
A7AM19_BABBO          AVAERLADLDDQ---FAEEYLENSYN-----LESMRAAIRRCCLSH------KAYPLLMG
Q4MYM5_THEPA          ELLEKIADHDNE---FAQKYLESNYN-----SGDIINSIRRLTMSH------VMYPLLMG
                       :                                     :                   .

EFG2_ANADE            SAYKNKAVQKLLDGVVDYLPDPTEVVNEAHDLT---------------------------
EFG1_DESPS            SAYKNKGVQALLDAVETYLPCPTDVENIGLDLD---------------------------
EFG1_BORBU            SAYKNKGVQLLLDAVTRFLPSPHDIKNTALDLN---------------------------
EFG1_BORBP            SAYKNKGVQLLLDAVTRFLPSPHDIKNTALDIN---------------------------
EFG2_TREDE            SAYKNKGIQPLLDAVGYYLPDPTEIENTALDLD---------------------------
EFG1_TREPA            SAYKNKGIQPLLDAITYYLPDPTEVTNTALDLD---------------------------
EFG1_SYNAS            SAYKNKGIQPLLDAVTRYLPCPADIENSALDLS---------------------------
EFG2_BDEBA            SAFKNKGVQRLMDAVTYYLPSPAEKKEQALDIT---------------------------
EFG1_MYXXD            SAYKNKGVQLLLNAVCAFLPNPKEATNEALDQK---------------------------
EFGM_DICDI            SAFKNTGVQPLLDGVIKYLPSPNEKKIIALDT----------------------------
D3BMN4_POLPP          SAFKNIGVQKLLDGVVRFLPNPSEKKSIALD-----------------------------
EFGM_CRYNJ            SAIKNTGVQPLLDGVCAYLPNPSEVQNQAMD-----------------------------
EFGM_USTMA            SAIKNKGVQAMLDGVCSYLPNPAEVPATAMDMSSAATKKAAEEAAQAAGEDQEAAAE---
EFGM_COPC7            SAMKNTGVQFLLDGVCEYLPNPSEREVLAID-----------------NKNLDPATA---
EFGM_SCHPO            SALSNVGVQSVLDAVCDYLPNPSEVENIALN-----------------------------
F4NY64_BATDJ          SAYHNRGVQPLLDGVLDYLPAPHEVDNHALD-----------------------------
D0NCX8_PHYIT          SAFKNRGVQPMLDGVISYLPSPSEVKNYALD-----------------------------
EFGM1_ARATH           SAFKNKGVQPLLDGVVSFLPSPNEVNNYALD-----------------------------
EFGM2_ARATH           SAFKNKGVQPLLDGVVSFLPSPNEVNNYALD-----------------------------
D7SLS6_VITVI          SAFKNKGVQPLLDGVLSYLPCPTEVSNYALD-----------------------------
M1CGG0_SOLTU          SAFKNKGVQTLLDGVLSYLPCPVEVSNYALD-----------------------------
EFGM_ORYSJ            SAFKNKGVQPLLDGVLDYLPCPMEVESYALD-----------------------------
I1GYK4_BRADI          SAFKNKGVQPLLNGVLDYLPCPAEVENYALD-----------------------------
C5WSZ1_SORBI          SAFKNKGVQPLLDGVLDYLPCPLEVDNYALD-----------------------------
A9RPB9_PHYPA          SAFKNKGVQLLLDGVVEYLPNPLEVSNHALD-----------------------------
A9SP22_PHYPA          SAFKNKGVQLLLDGVVEYLPNPLEVSNHALD-----------------------------
EFGM_COCIM            SALADKAVQPMLDGICDYLPNPAEIENLALDQK---------------------------
C0NUK7_AJECG          SALADKSIQPMLDGVCDYLPNPSEIENLALDQK---------------------------
EFGM_EMENI            SALANKSVQPMLDGVIDYLPNPSEVQNTALDKK---------------------------
EFGM_ASPFU            SALANKSVQPMLDGVIDYLPNPSEVENLALDRK---------------------------
EFGM_SCLS1            SALADKSVQPMLDAVCDYLPNPAEVENLALDKR---------------------------
C7YWN8_FUSV7          SALADKGVQPMLDAVCDFLPNPADVENTGLDKS---------------------------
I1RCR5_GIBZE          SALADKGVQPMLDAVCDYLPNPSEIENTGLDKS---------------------------
EFGM_NEUCR            SAIADKGVQPMLDAVCDYLPNPNDTDNTALDRS---------------------------
EFGM_ASHGO            SALANTGIQNVLDAIVDYLPEPSEVLNTALDVS---------------------------
EFGM_YEAST            SALANTGIQPVLDAIVDYLPNPSEVLNTALDVS---------------------------
EFGM_CANAL            SALANRGIQPVLDSVVDYLPQPNEVLNTGLELQK--------------------------
EFGM_YARLI            SALANRGVQPVLDAICEYLPDPSDVVNTALDIK---------------------------
G3QKQ5_GORGO          SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDD------------------------
A0A2I3T1A0_PANTR      SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDD------------------------
EFGM_HUMAN            SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDD------------------------
G1QVZ1_NOMLE          SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDD------------------------
EFGM_PONAB            SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDD------------------------
F6QKI2_CALJA          SALKNKGVQPLLDAVLEYLPNPSEVQNYALLNQEDE------------------------
H0UVN5_CAVPO          SALKNKGVQPLLDAVLEYLPNPSEVQNYALLNQEDD------------------------
G1T5N5_RABIT          SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDD------------------------
G1M4M7_AILME          SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQEDD------------------------
M3WIL3_FELCA          SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQDDD------------------------
G1NTB9_MYOLU          SALRNKGVQPLLDAVLDYLPNPSEVQNYAMLNQEDD------------------------
H0WY66_OTOGA          SALKNKGVQPLLDAVLEFLPNPSEVQNYAILNQEDD------------------------
EFGM_MOUSE            SALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQ-ND------------------------
EFGM_RAT              SALKNKGVQPLLDAVLEFLPNPSEVQNYALLNQ-ND------------------------
F7EHU0_MONDO          SALKNKGVQPLLDGVLAYLPDPSEVQNFAIFNQ-ED------------------------
G1KFW0_ANOCA          SALKNKGVQPLLDAVLEYLPNPAEVQNYALYNQ-ED------------------------
F6Q9W5_XENTR          SALKNKGVQPLLEAVLEYLPNPSEVQNFAILNH-EN------------------------
H3AWE2_LATCH          SALKNKGVQPLLDAVLEYLPNPTEVQNYATLNQ-ED------------------------
H3CQL2_TETNG          SALKNKGVQPLLDAVLDYLPNPTEVKNYAILNEDE-------------------------
I3J7A5_ORENI          TALKNKGVQPLLDAVLDYLPNPSEVKNYAILNEED-------------------------
G3P617_GASAC          TALKNKGVQPLLDAVLDYLPTPTEVKNYAILNDENC------------------------
EFGM_DANRE            SALKNKGVQPLLDAVLEYLPNPTEVQNYAILNEEG-------------------------
C3ZDC2_BRAFL          TALKNKGVQPLLDGVLSYLPDPTEVQNYALDETRD-------------------------
EFGM_ANOGA            TALKNKGVQPLLDAVLDYLPHPGEVENVALVEKKD-------------------------
W5JI53_ANODA          TALKNKGVQPLLNAVLDYLPHPGEVENIALIEKRD-------------------------
EFGM_AEDAE            TALKNKGVQPLLDAVLNYLPHPGEVENIALIEKKG-------------------------
EFGM_DROME            TALKNKGVQPLLDAVLDYLPNPGEVENLGFIEKEG-------------------------
EFGM_DROPS            TALKNKGVQPLLDAVIDYLPNPGEVENLGFIEREG-------------------------
E9G149_DAPPU          TALKNKGVQPLLDAVIDYLPNPGEVVNYAHIEKEG-------------------------
A0A087ZTR9_APIME      SALKNKGVQPLLDAVINYLPNPGEVENYAFQEDK--------------------------
E0VF81_PEDHC          TALKNKGVQPLLDGVIQYLPNPGEVENKAFKDEAE-------------------------
EFGM_NEMVE            SALKNKGVQPLLDGVLDYLPNPTEVKNYALDAE---------------------------
F6UKC4_CIOIN          TALRNKGVQPLLDAVTEFLPDPSEVDNFAFDGNLSRHINHSE------------------
EFGM_CAEBR            SALKNKGVQTMIDSVVKYLPDPSEVVNRATVKTET-------------------------
EFGM_CAEEL            SALKNKGVQTMINSVVKYLPDPSEVVNRATVKTETT------------------------
A0DGW7_PARTE          SAYKNKGVQLALDGVVDYLPAPEEKQNFGFQISLDQ------------------------
A0C9U4_PARTE          SAYKNKGVQLALDGVVDYLPAPEEKQNFGFQISLDQ------------------------
Q22AK9_TETTS          SAFKNKGVQLALDGVRDYLPKPDERKNVGFLQKEDT------------------------
EFG1_ANADE            TAFKNKGVQQILDAVVDFLPSPVDIPAMKGVDAK--------------------------
EFG2_MYXXD            SAFRHKGVQPLLDAVVDYLPSPLEVPPIHGKTPN--------------------------
EFG_KORVE             TAFKNKGVQTLLDAVVDYLPSPLDIPPVTGKNPD--------------------------
EFG_SOLUE             TAFKNKGVQTMLDAVVDYLPSPLDVPAIEGLDVDD-------------------------
EFG2_GEOSL            SAFKNKGVQNLLDSVVAYLPSPLDIPAITGIDAK--------------------------
EFG2_PELCD            SAFKNKGVQNLLDAVIDYMPSPVDVPAITGVVPD--------------------------
EFG_MAGMM             SAFKNKGVQLLLDAVVDYFPSPSDTPYIEGLLPD--------------------------
EFG_CHLAA             AALRNKGVQKLLDAVVEYLPSPLDRPAITGTLPGQVMG----------------------
EFG_HERA2             SALKNKGVQRMLDAVVLLLPSPLEIPVTKAVRPGVDSE----------------------
EFG_DEHM1             TSLRNKGVKRLLDAVCDYLPSPVDIPAIKGTAP---------------------------
EFG_GLOVI             SAFKNKGVQQMLDAVLDYLPSPLDIPPIKGLLP---------------------------
EFG2_SYNY3            SAFKNKGVQLLLDAVVDYLPSPLEVPAIEGHLP---------------------------
EFG_DEIRA             SALKNKGVQLLLDAVVDYLPSPLEVPSIKGTHE---------------------------
EFG_ENTFA             SAFKNKGVQLMLDAVLDYLPSPLDIDAIKGIDT---------------------------
EFG_OENOB             SAYKDKGVQLLLDAVVDYLPSPLEVRPYTATDP---------------------------
EFG_MESFL             SAFKNKGVKLLLDAVVDYLPSPLDVPSIKGVL----------------------------
EFG_MYCPN             SAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYG----------------------------
EFG_MYCA5             TSFKNKGVKLMLNAIVDYLPSPLDIPPMKAYK----------------------------
EFG_CLOAB             SSYKNKGVQQMLDAVVEYLPSPLDIPPVKGVDE---------------------------
EFG_LACP7             SAYRNKGVQKLLDAVIEFMPAPTDIEDIKGFDE---------------------------
EFG_FINM2             SAYKNKGVQPLLDAIVDYMPAPIDVPDIKGVDP---------------------------
EFG_MOOTA             SSFKNKGVQPLLDAIVDFLPAPTDVPAIQGVDP---------------------------
EFG_ECOLI             SAFKNKGVQAMLDAVIDYLPSPVDVPAINGILDD--------------------------
EFG_WIGBR             SAFKNKGIQSMLDTVINYLPSPKDIKYSKKNKFL--------------------------
EFG_HYDCU             SAFKNKGVQALLDAVIEYMPAPSDVPAIQGELED--------------------------
EFG_FUSNN             TAFKNKGIQALLDAIVNYMPAPTDVAMVEGRDPK--------------------------
EFG_SULSY             TAFKNKGIQPMLDAVIDFLPSPVDVPPVKGANP---------------------------
EFG_PARUW             SAFKNKGVQQLLDAVVAWMPSPLDRGQIKAHDLN--------------------------
EFG_ENDTX             TAFKNKGVQPMLDAVCDYLPSPLDRKAFKGINPV--------------------------
EFG_CUTAK             TSFKNKGVQPLLDAIVDYLPSPTDVPAISGFKP---------------------------
EFG1_STRCO            TAFKNKGVQPLLDAVVRYLPTPLDVEAIEGHDV---------------------------
EFG_BIFAA             SAFKDKGVQPMLDAVVDYLPSPEDVPSIVGFDP---------------------------
EFG_DESAG             SAFRNMGVQPLLDAVVEYLPSPVDIEQMVGANP---------------------------
EFG_PARD8             SSFKNKGVQTLLDAVCAFLPSPEDTPAIEGTDP---------------------------
EFG_SULMW             SSFKNKGVQVMLDAICRYLPSPIDIKETKGINP---------------------------
EFG_SALRD             SALKNTGVQRVLDGVTNYLPSPNDVPAITGHHP---------------------------
EFG_CHLT3             SSFKNKGVQFMLDAVVEYLPSPIDVGAVTGHSP---------------------------
EFG_GLUOX             TAFKNKGVQPLLDAVIDYLPAPDEVEGIRIAPPEGEE-----------------------
EFG2_HAHCH            SAFKNKGVQMVLDAVVDYLPSPQEVKGMETV-----------------------------
EFG1_METCA            SSFKNKGVQLVLDAVVDYLPDPTEVKPQPEVDLEGH------------------------
EFG1_SYNY3            SSFKNKGVQLVLDAVVDYLPNPKEVPPQPEVDLEGE------------------------
EFG_HYPNA             SAFKNKGVQPMLNGVVDYLPSPLDVPAYLGFKPGDE------------------------
EFG_RHORT             SSFKNKGVQPMLDAVVDFLPSPLDVPAIHGLIP---------------------------
EFG_NEOSM             SAFKNKGVQPLLDAVVDYLPSPVDTKDIIGENE---------------------------
EFG_PSELT             AAARNKGIQPLLDAVVDYLPSPIDIPAVKAITPS--------------------------
EFG_THEMA             AAKANKGIQPLLDAVIDYLPSPLDLPPVKGWRVSD-------------------------
EFG_PETMO             SAFKNKGVQPLLDAVIDYLPSPLDMPPVKAFDGTT-------------------------
EFG1_SYNWW            SSYRNIGVQLLLDSIVDYLPSPLDLPGSKAVIMET-------------------------
EFG2_SYNWW            SSFKNKGVQMLLDAVVSYLPSPLDIPAIEAMDIAS-------------------------
EFG1_BDEBA            AAFKNKGVQPLLDGVIDYLPSPLEVPAIVGHDPER-------------------------
EFG2_DESPS            SAFKNKGVQPLLDGVVNYLPSPLDVKPVEGVDKD--------------------------
EFG1_GEOSL            SALRNKGIQPLLDAVVDFLPSPLDVPPAKGKRP---------------------------
EFG1_PELCD            SALRNKGIQPLLDAVIDYLPSPLQAPPIAASPPNHQD-----------------------
EFG2_SYNAS            SALKNKGIQPVLDAVVNFLPSPEDVPPVRGIHP---------------------------
EFG3_MYXXD            SAFKKKGVQMLLDAIVNYLPAPSDMPAVEGFVP---------------------------
EFG2_STRCO            SAYRNRGVEPLLDAVVAYLPSPLDVPPVRGTHD---------------------------
EFG2_BORBU            TSLKNIGIEPLIDSIVDYLPSPFE-KSFSAFSLDT-------------------------
EFG2_BORAP            TSLKNIGIEPLIDSIVDYLPSPFE-KSFTAFSLDT-------------------------
EFG2_BORBP            TSLKNIGIEPLIDSIVDYLPSPFE-KNFSAFSLDA-------------------------
EFG1_TREDE            SARKNIGVQPLIDAVVDFLPAPNEVLPAEAFNPKK-------------------------
EFG2_TREPA            SSRHNLGVQPLLDAVVEYLPAPQERKAVEGFHVQK-------------------------
EFG_CARRP             SSLKNKGIEFLLDSIVNFLPSPID------IGIKN-------------------------
EFG_RHOBA             SAYKNKGVQPLLNAVTQYLPSPLDREIYGRDPSD--------------------------
K2LYN2_TRYCR          SAYRNKGVQLLLDAICRYLPSPMEKENKGYLLKKVKDEEGNIS-----------------
Q38BA0_TRYB2          SAYKNKGIQLLLDAVCRYLPSPMEKPNSGYSVTKVKDDEGNVA-----------------
A4ICS8_LEIIN          SAYRNKGVQLLLDAVERYLPSPVERHNSGYQVRRVKDEDGNVS-----------------
Q4Q219_LEIMA          SAYRNKGVQLLLDAVERYLPSPVERHNSGYQVRRVKDEDGNVS-----------------
A4HNR7_LEIBR          SAYRNKGVQLLLDAVERYLPSPEERHNSGYRVKRVKDEDGNVS-----------------
Q7RFK0_PLAYO          SAKSNVGVQLLLDNVCNFLPSPREVKNYGYIYDGQNIADTDIVDNE------------EI
A5K8J4_PLAVS          SAKNNVGVQILLNYVCSFLPSPREVPSYGYVYEGGAASHASDANGENSANSANSSTAADS
A0A1Y3DJ13_PLAKN      SAKNNVGVQILLNYVCSFLPSPREVGSYGYVYEGSNHEGSNHEGSNHEGSDANEENSASS
A7AM19_BABBO          SAKGNKGVQLAIDAVCHYLPAPSEVVQHGYITDD--------------------------
Q4MYM5_THEPA          SAKGNKGVQLLLNSICYYLPSPKNCITQLYKYVNSGENSS--------------------
                      ::  . .::  ::     :* * :                                    

EFG2_ANADE            ------KDEEKVALTIDNEK--PTVALAFKLEDGRYGQL---TYLRIYQGKLSRDMFITN
EFG1_DESPS            ------NEETEFAVTNNDED--PLIMLAFKLEDGRYGQL---TYVRTYQGQLTKGDTVYN
EFG1_BORBU            ------NNEKEIDLKIDNEL--PTVALAFKLEDGQYGQL---TYVRIYQGILKKGQELIN
EFG1_BORBP            ------NNEKEIDLKIDNDL--PTVALAFKLEDGQYGQL---TYVRIYQGTLRKGQELIN
EFG2_TREDE            ------ENEKPVVLGTDENA--PVVALGFKLEDGKYGQL---TYVRVYQGTLKKGEELFN
EFG1_TREPA            ------RAEEPVTLSTDADA--PVVALGFKLEDGKYGQL---TYVRVYQGTIKKGAELFN
EFG1_SYNAS            ------REEAPVQLTSNTED--PVVALAFKLEDGIYGQL---TYIRVYQGILSRGATVVN
EFG2_BDEBA            ------KNEEKFDLHPDPTK--PLVALAFKLQETPFGQL---TYMRVYQGKMGKGDFIVN
EFG1_MYXXD            ------NNEAKVILDSDPEK--PFVGLAFKLEDGRYGQL---TYMRIYQGRVTKGDFIIN
EFGM_DICDI            ---SVKDKETEVELESDPKK--PFVGLAFKLEEGRFGQL---TYMRVYQGTLKRGDTIKN
D3BMN4_POLPP          ----LTNNEAEVELSADPKK--PFVGLAFKLEEGRFGQL---TYMRVYQGTLKRGDMIKN
EFGM_CRYNJ            --ATLPAHAPTIPLVPATDA--PLVGLAFKLEEGRYGQL---TYMRVYQGELKRGSMIYN
EFGM_USTMA            --ARKNAAPPVLPLSPASEA--PLVGLAFKLEEGKYGQL---TYMRVYQGTLKRGNLIFN
EFGM_COPC7            --SSQASQTPNVPLVPAAAA--PFVGLAFKLEEGRFGQL---TYVRVYQGTLKKAMNIWN
EFGM_SCHPO            ----AADSEKPVSLVPSSEK--PLVALAFKLEEGRFGQL---TYLRIYQGTLKRGNYIYN
F4NY64_BATDJ          ----TKEKEKQVVLSCQSNV--PLLSLAFKLEEGRFGQL---TYLRIYQGTMRRGDYITN
D0NCX8_PHYIT          ----QSKGEARVGVPCSPEA--PLLALAFKLEEGKFGQL---TYMRVYAGTLKRGGFIYN
EFGM1_ARATH           ----QNNNEERVTLTGSPDG--PLVALAFKLEEGRFGQL---TYLRVYEGVIKKGDFIIN
EFGM2_ARATH           ----QNNNEERVTLTGSPDG--PLVALAFKLEEGRFGQL---TYLRVYEGVIKKGDFIIN
D7SLS6_VITVI          ----QNKNEEKVTISGTPVG--PLVALAFKLEEGRFGQL---TYLRIYEGVIRKGDFIIN
M1CGG0_SOLTU          ----QTKDEEKVTLTGNPSG--PLVALAFKLEEGRFGQL---TYLRIYEGVIRKGDFIIN
EFGM_ORYSJ            ----QNKSEEKVLLAGTPAE--PLVALAFKLEEGRFGQL---TYLRIYDGVIRKGDFIYN
I1GYK4_BRADI          ----QNKSEEKVLLGGTPAG--PLVALAFKLEEGRFGQL---TYLRIYDGVIRKGDFIYN
C5WSZ1_SORBI          ----QNKSEEKVLLAGTPAE--PLVALAFKLEEGRFGQL---TYLRIYDGVIRKGDFIYN
A9RPB9_PHYPA          ----QNKNEEKVELSGSPEG--KLVALAFKLEEGRFGQL---TYLRLYEGTMRRGDFIIN
A9SP22_PHYPA          ----QHKGEEKVELTGSPSG--KLVALAFKLEEGRFGQL---TYLRLYEGTMRRGDFIVN
EFGM_COCIM            ------RNEASVKLVPYNSL--PFVGLAFKLEESNFGQL---TYIRVYQGTLRKGTNVFN
C0NUK7_AJECG          ------RDEAPVKLVSYNSL--PFVGLAFKLEESNYGQL---TYIRVYQGTLRKSSNVFN
EFGM_EMENI            ------RNEAQVKLVPYNAL--PLVCLAFKLEESSFGQL---TYIRVYQGTLRKGSYVFN
EFGM_ASPFU            ------RDEASVKLVPYNSQ--PFVGLAFKLEESNFGQL---TYIRVYQGTLRKGANVFN
EFGM_SCLS1            ------RAEAPVKLVSYNEL--PFVGLAFKLEESNYGQL---TYIRVYQGSLRKGMNVFN
C7YWN8_FUSV7          ------NDEKTVKLVPYNSL--PFVGLAFKLEENNYGQL---TYIRVYQGKLTKGSYLFN
I1RCR5_GIBZE          ------KDEKTVKLVPYDSL--PFVGLAFKLEENNYGQL---TYIRVYQGKLSKGTYLFN
EFGM_NEUCR            ------KGEQPVKLVPYNSL--PFVGLAFKLEENPYGQL---TYMRVYQGSLKKGAYLYN
EFGM_ASHGO            ------NNETKVNLIPSSHH--PFVGLAFKLEEGNYGQL---TYIRVYQGKLKKGGYITN
EFGM_YEAST            ------NNEAKVNLVPAVQQ--PFVGLAFKLEEGKYGQL---TYVRVYQGRLRKGNYITN
EFGM_CANAL            -----DNSEKPVHLTPSTSE--PFVGLAFKLEEGPYGQL---TYIRVYQGKLKKGAYMTH
EFGM_YARLI            ------KDETPVHLTPAAKA--PFVGLAFKLEDGKYGQL---TYLRVYQGQLKKGMSIIN
G3QKQ5_GORGO          -----SKEKTKILMNSSRDNSHPFVGLAFKLEVGRFGQL---TYVRSYQGELKKGDTIYN
A0A2I3T1A0_PANTR      -----SKEKTKILMNSSRDNSHPFVGLAFKLEVGRFGQL---TYVRSYQGELKKGDTIYN
EFGM_HUMAN            -----SKEKTKILMNSSRDNSHPFVGLAFKLEVGRFGQL---TYVRSYQGELKKGDTIYN
G1QVZ1_NOMLE          -----SKEKTKILMNSNRDNSHPFVGLAFKLEVGRFGQL---TYVRSYQGELKKGDTIYN
EFGM_PONAB            -----SKEKTKILMNSNRDNSHPFVGLAFKLEVGRFGQL---TYVRSYQGELKKGDTIYN
F6QKI2_CALJA          -----SKEKTKILMSSNRDNSHPFVGLAFKLEAGRFGQL---TYIRIYQGELKKGDTIYN
H0UVN5_CAVPO          -----SKEKTKILMNSKRDNSHPFVGLAFKLEAGRFGQL---TYVRNYQGELKKGDSIYN
G1T5N5_RABIT          -----SKEKTKILMNSERDSSHPFVGLAFKLEAGRFGQL---TYVRNYQGELKKGDTIYN
G1M4M7_AILME          -----SKEKNKILMHSERNSSHPFVGLAFKLEAGRFGQL---TYVRNYQGELKKGDTIYN
M3WIL3_FELCA          -----SKEKNKILMNSERNSSHPFVGLAFKLEAGRFGQL---TYVRNYQGELKKGDTICN
G1NTB9_MYOLU          -----SKEKTKILMNSNRDNSHSFVGLAFKLEAGRFGQL---TYIRNYQGELKKGDTIYN
H0WY66_OTOGA          -----SKEKAKILMNSKRDNSHPFVGLAFKLEAGRFGQL---TYVRIYQGQLTKGDTIYN
EFGM_MOUSE            -----SKEKTKILMNPQRDDSHPFVGLAFKLEAGRFGQL---TYVRNYQGELKKGSTIYN
EFGM_RAT              -----SKEKNKILMNPKRDDSHPFVGLAFKLEAGRFGQL---TYVRNYQGELKKGSTIYN
F7EHU0_MONDO          -----SDEKSKVLMSSRRDNSKPFVGLAFKLEAGRFGQL---TYVRNYQGELKKGDTVYN
G1KFW0_ANOCA          -----SQEKSKILLGSVRDNSLPFVGLAFKLEAGRFGQL---TYVRVYQGMLKKSDYIYN
F6Q9W5_XENTR          -----SEEATKILMNSVRDSSQPFVGLAFKLEAGRFGQL---TYVRVYQGMLQKSDYIFN
H3AWE2_LATCH          -----SEETSRILMNPVRDASHPFVGLAFKLEAGRFGQL---TYLRIYQGMLKKSESIYN
H3CQL2_TETNG          -----DKESSRTLMDPTRDSTNPFVGLAFKLEAGRFGQL---TYVRVYQGCLKKGEYIYN
I3J7A5_ORENI          -----STETKKIQMDPTRDSANPYVGLAFKLEAGRFGQL---TYIRVYQGCLKKGEYIYN
G3P617_GASAC          -----DSETSKIEMDPTRDSTNPYVGLAFKLEAGRFGQL---TYVRVYQGCLRKGEYIYN
EFGM_DANRE            -----ESEGSKILMDSTRDDTQPFVGLAFKLEAGRFGQL---TYVRVYQGCLRKTDYIHN
C3ZDC2_BRAFL          -------EKERILMDPTRDASNPFVGLAFKLEAGRFGQL---TYMRVYQGYMKKGDVIHN
EFGM_ANOGA            ------EEPQKVPLNPARDGKDPFVGLAFKLEAGRFGQL---TYLRCYQGVLRKGDNIFN
W5JI53_ANODA          ------QEAQKVVLNPARDGKDPFVGLAFKLEAGRFGQL---TYLRCYQGVLRKGDNIFN
EFGM_AEDAE            ------KEPQQIMLDPARDGKSPFVGLAFKLEAGRFGQL---TYLRCYQGVLRKGDSIFN
EFGM_DROME            ------QDPEKVVLNPARDGKDPFVGLAFKLEAGRFGQL---TYLRCYQGVLRKGDNIFN
EFGM_DROPS            ------KDPEKIVLNPARDGKDPFVGLAFKLEAGRFGQL---TYLRCYQGVLRKGDNIFN
E9G149_DAPPU          ------KEREKIILNPARTSASPFAGLAFKLEAGRFGQL---TYVRVYQGMLKRGDNLYN
A0A087ZTR9_APIME      ------NESVKILLNSERSNKHPFIGLAFKLEAGKFGQL---TYFRCYQGMISKGNTLIN
E0VF81_PEDHC          -----GKEKEKIILNPERSDKHSFIGLAFKLELSKYGQL---TYIRCYQGMFKKGDSLTN
EFGM_NEMVE            -----SLD-TKVLMDSRRSGEAPFVGLAFKLEAGRYGQL---TYLRVYQGALKRGGFIVN
F6UKC4_CIOIN          -----DNQPVKVQMSPVRTKENDLVALAFKLEQSKFGQL---TYLRMYQGALMKGDNIFN
EFGM_CAEBR            ------GEEKRIILSPERNNDKPFVGLAFKLEAGKYGQL---TYFRVYQGQLSKGDTVYA
EFGM_CAEEL            ------GDEKGIILSPKRNNDKPFVGLAFKLEAGKYGQL---TYFRVYQGQLSKGDTVYA
A0DGW7_PARTE          ------KEEKKIEFKTDPKL--PFVGYAFKLEENKFGQL---TYVRVYQGKLKKGDYVYN
A0C9U4_PARTE          ------KEEKKIEFKTDPKL--PFVGYAFKLEENKFGQL---TYVRVYQGKLKKGDYVYN
Q22AK9_TETTS          ------QAEEKIEFIPDPKL--PFVGYAFKLEESKFGQL---TYVRVYQGKLKRGDNVYN
EFG1_ANADE            --------GNDVVRKTSDAE--PFSALAFKIMNDPFVGN--LTFFRVYSGRLEAGSYVYN
EFG2_MYXXD            --------GEDAVRETRDDA--PFSALAFKIMNDPAFQSQTLTFLRVYSGKLEAGTAVWN
EFG_KORVE             -------TGLEEQRSADDKQ--PFAALAFKIMTDPFVGQ--LTFIRVYSGQLKTGDSVYN
EFG_SOLUE             -------PEKTLIRHASDNE--PFSALVFKIMTDPYVGQ--LAFFRVYSGSMKSGGSVFN
EFG2_GEOSL            -------SGEEITRKASDDE--PFSALAFKIMTDPFVGQ--LCFFRVYSGVLNSGSYVYN
EFG2_PELCD            -------TEEEITRPAGDDG--PFAALAFKVMTDPFVGQ--LTFFRVYSGVAESGATVLN
EFG_MAGMM             -------SEEAAVRKPSDEE--PFAALAFKIMTDPFVGT--LTFVRVYSGVMESGTSVLN
EFG_CHLAA             -----DEGVEVITRPVSDDA--PFTALVFKIVADPYVGK--LAYFRVYAGKITKGSYVLN
EFG_HERA2             -----AEDAEFIERPADENA--PFTGLVFKIMADPFVGK--LAYFRVYSGKLETGSYVLN
EFG_DEHM1             ------KTGEPMERHASDTE--PFSALAFKIVSDPFVGR--LVYFRIYSGNVSAGSGVYN
EFG_GLOVI             ------NG-TEVERSADDSQ--PLSALAFKIMADPY-GR--LTFVRVYSGILQKGSYALN
EFG2_SYNY3            ------DG-EVATRPAEDKA--PLSALAFKVMADPF-GR--LTFVRVYSGVLEKGSYVLN
EFG_DEIRA             ------DGETVTEFPADPEG--KLAALAFKIMADPYVGR--LTFVRIYSGTLTSGSYVYN
EFG_ENTFA             ------KTDEETTRPADDEA--PFASLAFKVMTDPFVGR--LTFFRVYSGVLESGSYVLN
EFG_OENOB             ------DTGDEVDLKADDKK--PFAALAFKIMTDPYVGR--LTFLRVYTGTLKSGSYVQN
EFG_MESFL             ------PNGEEAERHADDNE--PFSALAFKVMTDPFVGK--LTFFRVYSGILTKGSYVLN
EFG_MYCPN             ------EDGNEVLISASDDA--PFVGLAFKVATDPFVGR--LTFVRVYSGVLKSGSYVKN
EFG_MYCA5             ------GEG-EISIPASDDE--FFSSLAFKVMNDPYVGN--LTFFRVYSGILNKGTYLYN
EFG_CLOAB             ------DGND-DERKADDSE--PLAALAFKIATDPFVGK--LAFTRVYSGVMKAGSYVLN
EFG_LACP7             ------EGNE-IHRISSDEE--PFAALAFKIMADPFVGK--LAFFRVYSGTLNAGSYVLN
EFG_FINM2             ------QTDEPTTRKSSDEE--PFAALAFKIATDPYVGK--LAFTRVYSGTVESGSYVYN
EFG_MOOTA             ------ETGDEDERHSSDNE--PFAALAFKIMADPYVGK--LTFFRVYSGTLKSGSYVYN
EFG_ECOLI             ------GKDTPAERHASDDE--PFSALAFKIATDPFVGN--LTFFRVYSGVVNSGDTVLN
EFG_WIGBR             ------SKNYKKSILPKDNE--PFSALAFKIANDPFVGN--LTFFRVYSGKIRSGNTVLN
EFG_HYDCU             ------G--TKAERHSTDDE--PFAALAFKVMTDPYVGT--LTFFRVYSGVLSAGSPVYN
EFG_FUSNN             ------NPDVLIDREMSDDA--PFAALAFKVMTDPFVGR--LTFFRVYSGFVEKGATVLN
EFG_SULSY             ------NTGEEEARHASDDE--PFCALAFKVMADPYAGQ--LTYFRVYSGSVKAGQTVYV
EFG_PARUW             -------TDEEILLTPDDEQ--PLAALAFKIMTDPYVGR--LTYIRIYSGTLTKGTSLLN
EFG_ENDTX             -------TSETDSREVDDKA--PFSALAFKIQADPYIGK--LTYLRVYSGTLESGSYVYN
EFG_CUTAK             -----GDESVELERRPCDDE--PLSILAFKIASDPHLGK--LTFVRVYSGVLHAGDQVLN
EFG1_STRCO            -----KDPEVVVKRKPSEDE--PLAALAFKIMSDPHLGK--LTFVRVYSGRLVSGTAVLN
EFG_BIFAA             -----QDESIEIDRKPTTDD--PFSALVFKISTHPFYGK--LVFVRVYSGSVKPGDTVLD
EFG_DESAG             -----DNEEEKIVCPCKDEE--PLAALVFKLASDPYIGH--LSFIRIYSGFIEAGMTVYN
EFG_PARD8             -----SDPDKIITRKPLFEE--PLTALAFKIATDPYVGR--LCFFRVYAGSINAGSYVLN
EFG_SULMW             -----KTE-KEEIRKHNSKE--PFSALAFKIATDSFVGR--LAFFRVYSGQLKSGTYILN
EFG_SALRD             -----QDKEEDITRHPREDE--PFSAVAFKITTDPYVGK--LTFVRVYSGTLESGSRVYS
EFG_CHLT3             -----RDEDEKIARQPDDSA--PFAGLAFKITSDPYVGK--LTFFRVYSGVLKSGSYVLN
EFG_GLUOX             -----VDEDFLPIVPVDPDG--KFAGLAFKIISDKY-GT--LTFVRVYRGVLNSGDTILN
EFG2_HAHCH            --------DGAQIVDADVDG--AFAALAFKVVNDKH-GA--LTYVRVYRGTLQSGSRVLN
EFG1_METCA            --------ETGEFAIVDPDR--PLRALAFKIMDDRY-GA--LTFLRLYSGRLEKGTTVLN
EFG1_SYNY3            --------ETGNYAIVDPEA--PLRALAFKIMDDRF-GA--LTFTRIYSGTLSKGDTILN
EFG_HYPNA             ------TETRDIPRSADDGQ--PFAGLAFKIMNDPYMGT--LTFTRIYSGKLSKGDAFLN
EFG_RHORT             ------ETHEDVIRGCSDDE--PFSALAFKIMNDPFVGS--LTFARVYSGTVESGSYVQN
EFG_NEOSM             -------KGEEINIKPDPKA--PFVGLAFKVMNDPYVGS--LTFVRIYSGTLNSGDVVIN
EFG_PSELT             -------GEEIQI-PPSVEG--DFAGLAFKIQTDPYVGK--LAYVRVYSGKLEKGSYVYN
EFG_THEMA             -------GEVVYR-KPDENE--PFTALVFKVQVDPYIGK--LVYFRVYSGRLEKGSYVYN
EFG_PETMO             -------GEFVKDILPFEDG--DFFALAFKIMADPFIGK--LTFARVYSGTLNKGSYVVN
EFG1_SYNWW            --------TETINIMPDSQD--AFSALVFKIINDRHVGR--LAFARIYSGKLKAGTVVFN
EFG2_SYNWW            --------GENVRIKPEVDA--PLCALAFKLASDPYVGK--LTYFRIYSGRIKAGSTLFN
EFG1_BDEBA            -------PDKEIICKTEFDA--HAAALAFKIANDPFAGT--LTYIRVYSGEVKVGEQLLN
EFG2_DESPS            --------GVEVSRKADPSE--KFAGLVFKLMSDSFVEN--LAFIRVYSGTLKQGDKVFN
EFG1_GEOSL            ------GSETVDELPCDPGG--PFCALAFKVQSEDG-RK--LTYLRVYSGTIKAGGAVWN
EFG1_PELCD            ------ATAEPALLPCDPQG--PLCALAFKVLSDAG-RK--LTYLRVYSGSLRAGDEILN
EFG2_SYNAS            ------ATKEELSRASSVKE--PLSALAFKVMQDEG-RK--LTYIRIYSGQMKAGEELYN
EFG3_MYXXD            ------GKEERVSRPVSDSG--PPCALAFKLMSDKAVGG--IVFLRVYSGTLRAGTVLLN
EFG2_STRCO            ------GAER--ERPADPAA--PMAALAFKV-NATPTGR--LTYLRVYSGTIGKGDTVWD
EFG2_BORBU            --------NKKILVDPNENK--KLSALVFKVQYSSVIASH-LYFVRVYSGEINPNKKIIN
EFG2_BORAP            --------NKKILVDPNENK--KLSALVFKVQYSSVIAAH-LYFVRVYSGEINSNKKIFN
EFG2_BORBP            --------NKKILVNPNENK--KLSALVFKVQYSSVIAAH-LYFVRVYSGEINSSKKIFN
EFG1_TREDE            --------EEKLSVPCKAEG--APLGLVFKIQYDKD-AGS-LCYVRMYSGKIKSGDQVFN
EFG2_TREPA            --------KEPVFIAPTAEG--PLLALVFKIQYERE-AGL-LCYVRMYSGKLRTGDSIVN
EFG_CARRP             --------VSNINYSVNIKS--KFLALLFKVFNDPY-LGL-LSFIRIYSGKIEPGQIIFN
EFG_RHOBA             -------EEKKIELSPDPDK--PFVGMAFKIVEDPF-GQ--LTFMRIYQGTIKKGEAYTN
K2LYN2_TRYCR          -----NVKEDKIDLLTDDEK--PLVALLFKLEETKKTGL--SNYVRVYQGKMRK-EHLLN
Q38BA0_TRYB2          -----NVKGEIVPLATDDEK--PLVAAIFKLEETKKTGL--LNYIRVYQGKMRR-EHLMN
A4ICS8_LEIIN          -----NVKEGEVELMTDDEK--PLVALVFKIEETKKSGL--SNYVRVYQGKMRK-EHLMN
Q4Q219_LEIMA          -----NVKEGEVALMTDDEK--PLVALIFKIEETKKSGL--SNYVRVYQGKMRK-EHLMN
A4HNR7_LEIBR          -----NVKDGEVALLTDDEK--PLVALVFKIEETKKSGL--SNYVRVYQGKMRK-EHLMN
Q7RFK0_PLAYO          NDSFIKSNKNKREVQLLCDNSEPMVGFLFKIQEDSMHGQ--MSYFRIYQGKIRKKDMITN
A5K8J4_PLAVS          ANSANSSTAGRRRVELRCDSALPMVGFLFKIQEDALHGQ--MSYLRIYQGKIKKKDSITN
A0A1Y3DJ13_PLAKN      SGATVPQGKNRKRVDLQCDSTLPMVGFLFKIQEDSMHGQ--MSYFRIYQGKIKKKDNIMN
A7AM19_BABBO          ------QTEELDGGYKQP-----LVAYAFKIQ-DSPMGQ--LTFLRLYQGMMRRGQQLYL
Q4MYM5_THEPA          ------ESDEMNKIELKPEDK-GLVGYIFKIV-DTYLGQ--LSYIRIYKGVLRRGLSVLV
                                                  **:            : * * *          

EFG2_ANADE            MRTKKDHRIGRLVRMHSDQME--DIDAAGSGDIVAMFGVDCN-SGDTF--TDGTV---KL
EFG1_DESPS            RRTGRKVKIGRLCRMHSDEME--EIDGVGSGDIVALFGVDCA-SGDTF--TNDAV---NC
EFG1_BORBU            SRTSKKFKVGRLIRMHANNTE--DIEFGGSGDIVALFGIECA-SGDTF--CDPSI---NY
EFG1_BORBP            SRTSKKFKVGRLIRMHANNTE--DIEFGGSGDIVALFGIECA-SGDTF--CDPSI---NY
EFG2_TREDE            TRAKKKFKVGRLVRMNSATME--DINEGGPGDIVALFGIDCA-SGDTF--CGENL---NY
EFG1_TREPA            VRARKKFKVGRLVRMNSNQME--DISEGTPGDIVALFGVDCA-SGDTF--CSGDL---NY
EFG1_SYNAS            ARDGKKVRIGRLVRMHADQME--DIEAIHAGYIGALFGLECQ-SGDTF--AAQGL---NL
EFG2_BDEBA            QVNKKSVKIPRLVRMHSDKME--DIDVSYAGDIVALFGIDCA-SGDTF--CDENI---QA
EFG1_MYXXD            QSNQKKVKVPRIVRMHSSQMN--DINEATAGDIVALFGIECA-SGDTF--TDGVV---NY
EFGM_DICDI            VNLGKTIKVPRLVKMHASEME--EVSEVGPGEICAMFGVDCY-SGNTF--THQNC---SY
D3BMN4_POLPP          VNLNKVIKVPRLVRMHANEME--EVQEVGAGEICAMFGVDCY-SGNTF--TQQQL---NY
EFGM_CRYNJ            ARTGKRVKVPRLVRMHADEME--DVDAVVAGEICAMFGVECS-SGDTF--TDGSS---TY
EFGM_USTMA            ARTGKKVKVPRLVRMHSNDME--DVDEIGAGEICAMFGVECS-SGDTF--TDGTT---QL
EFGM_COPC7            VRTGKKVKVPRLVRMHSDEME--DIDSIGPGEICAMFGVECS-SGDTF--TDGTS---TY
EFGM_SCHPO            VNSTKKIKVSRLVRMHSNDME--EIEKVEAGGICALFGIECA-SGDTF--TDGSV---SY
F4NY64_BATDJ          VRTGKRVKVARLVRMHSNEME--DVESVGSGEICALFGVDCA-SGDTF--SNGSM---QL
D0NCX8_PHYIT          MSDMKRIKVPRLVKMHSNEME--EVEEVSAGEVVAMFGVECA-SMDTF--SDTNQG--KF
EFGM1_ARATH           VNTGKRIKVPRLVRMHSNDME--DIQEAHAGQIVAVFGIECA-SGDTF--TDGSV---KY
EFGM2_ARATH           VNTGKRIKVPRLVRMHSNDME--DIQEAHAGQIVAVFGIECA-SGDTF--TDGSV---KY
D7SLS6_VITVI          VNTGKKIKVPRLVRMHSNEME--DIQEAHAGQIVAVFGVDCA-SGDTF--TDGSV---RY
M1CGG0_SOLTU          VNTGKKIKIPRLVRMHSNEME--DIQEAHAGQIVAVFGVDCA-SGDTF--TDGSV---KY
EFGM_ORYSJ            VNTGKKIKVPRLVRMHSNEME--DIQEAHAGQIVAVFGVDCA-SGDTF--TDGSV---KY
I1GYK4_BRADI          VNTGKKIKVPRLVRMHSNEME--DIQEAHAGQIVAVFGVDCA-SGDTF--TDGSV---KY
C5WSZ1_SORBI          VNTGKKIKVPRLVRMHSNEME--DIQEAYAGQIVAVFGVDCA-SGDTF--TDGTV---KY
A9RPB9_PHYPA          STTGRKVKVPRLVRMHADDME--DIQEAHAGEIVAVFGVECS-SGDTF--TDGSV---KF
A9SP22_PHYPA          STTGRKVKVPRLVRMHADDME--DIQEAHAGEIVAVFGVECS-SGDTF--TDGSV---KY
EFGM_COCIM            ARNNKRIKVPRIVRMHSNEME--EVSEIGAGEICAVFGVDCA-SGDTF--TDGQL---NY
C0NUK7_AJECG          ARSGKKIKVPRIVRMHSNEME--DVDEIPAGEICAVFGVDCA-SGDTF--TDGQL---AY
EFGM_EMENI            ARTDKKVRIPRIVRMHSNEME--DVSEIGAGEICAVFGVECA-SGDSF--TDGQL---GY
EFGM_ASPFU            ARNNKKVKVPRIVRMHSNEME--EVSEIGAGEICAVFGVDCA-SGDTF--TDGQL---GY
EFGM_SCLS1            ARTDKRVKIPRIVRMHSNEME--EVPEIGAGEICAVFGVDCA-SGDTF--TDGGL---PY
C7YWN8_FUSV7          SRTDKKVRIPRIVRMHSNEME--DVSEVGAGEICAVFGVDCA-SGDTF--TDGGL---PY
I1RCR5_GIBZE          SRTDKKVRIPRIVRMHSNEME--DVSEVGAGEICAVFGVDCA-SGDTF--TDGGL---PY
EFGM_NEUCR            SRGNKKVRIPRIVRMHSNEME--DVNEIGAGEICAVFGVDCA-SGDTF--TDGGL---PY
EFGM_ASHGO            VRTGKKVKVSRLVRMHSNEME--DVNEIGAGEICATFGIDCS-SGDTF--TDGKL---KY
EFGM_YEAST            VKTGKKVKVARLVRMHSSEME--DVDEVGSGEICATFGIDCA-SGDTF--TDGSV---QY
EFGM_CANAL            VKTGKKVKVSRLVRMHSNDME--DVAEVGAGEICATFGIDCA-SGDTFIGQGTQQ---QI
EFGM_YARLI            AKTGKKTKLARLVRMHSDEME--DVDSVGAGEICATFGVDCA-SGDTF--TDGEV---TY
G3QKQ5_GORGO          TRTRKKVRLQRLARMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TDKANS--GL
A0A2I3T1A0_PANTR      TRTRKKVRLQRLARMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TDKANS--GL
EFGM_HUMAN            TRTRKKVRLQRLARMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TDKANS--GL
G1QVZ1_NOMLE          TRTRKKVRLQRLARMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TDKANS--GL
EFGM_PONAB            TRTGKKVRLQRLARMHADMME--DVEKAYAGDICALFGIDCA-SGDTF--TDKANS--GL
F6QKI2_CALJA          TRTRKRVRLQRLARMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TNKDNS--GL
H0UVN5_CAVPO          TRTGKKVRVQRLVRMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TNKDNS--GL
G1T5N5_RABIT          TRTGKKVRVQRLVRMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TNKDNS--GL
G1M4M7_AILME          TRTGKKVRVQRLVRLHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TDKSNS--GL
M3WIL3_FELCA          TRTGKKVRVQRLVRMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TNKNNS--GL
G1NTB9_MYOLU          TRTGKKVRVQRLVRMHADMME--DVEEVFAGDICALFGIDCA-SGDTF--TNKDNS--GL
H0WY66_OTOGA          TRSRKKVRVQRLVRMHADMME--DVEEAYAGDICALFGIDCA-SGDTF--TNKDNS--GL
EFGM_MOUSE            TRTGKKVRVQRLVRMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TNKDNS--DL
EFGM_RAT              TRTGKKVRVQRLVRMHADMME--DVEEVYAGDICALFGIDCA-SGDTF--TNKDNS--DL
F7EHU0_MONDO          TRTKKKVRVQRLVRMHADMME--DVEEVYAGDIFALFGIDCA-SGDTF--TNKDNM--DL
G1KFW0_ANOCA          TRTGKRVRVQRLVRMHADMME--DVEEVYTGDICALFGIDCA-SGDTF--TDKSST--DL
F6Q9W5_XENTR          TRTGKKVRVQRLVRLHADMME--DVEEAYAGDICALFGIDCA-SGDTF--TSKSND--NL
H3AWE2_LATCH          TRTGKKVRVQRLVHLHADVME--DVDEVYAGDICALFGIDCA-SGDTF--TARTSA--NL
H3CQL2_TETNG          TRTSKKVRVQRLVRLHADQME--DVDEVYAGDICALFGIDCA-SGDTF--TSKSSA--NL
I3J7A5_ORENI          TRTSKKVRVQRLVRLHADQME--DVDEVYAGDICALFGIDCA-SGDTF--TSKTTA--DL
G3P617_GASAC          TRTGKKVRVQRLVRLHADQME--DVDEVYAGDICALFGIDCA-SGDTF--TSRASS--NL
EFGM_DANRE            SRTGRRVRVQRLVRLHADQME--DVEVAYAGDICALFGIDCA-SGDTF--TARNNA--NL
C3ZDC2_BRAFL          VRTGKRIKVPRLVRMHANEMEVGDVSEVFAGDICAMFGVDCS-SGDSF--VSTPKL--QL
EFGM_ANOGA            TRSGKKIRLARLVRLHSNQME--DVNEVYAGDIFALFGVDCA-SGDTF--VTNPKL--EL
W5JI53_ANODA          TRSGKKIRLARLVRLHSNQME--DVNEVYAGDIFALFGVDCA-SGDTF--VTNPKL--EL
EFGM_AEDAE            VRSGKKVRLARLVRLHSNNME--DVNEVYAGDIFALFGVDCA-SGDTF--VTNPDL--EL
EFGM_DROME            ARTNKKVRIARLVRLHSNQME--DVNEVYAGDIFALFGVDCA-SGDTF--TTNPKN--NL
EFGM_DROPS            ARTNKKVRIARLVRLHSSQME--DVNEVYAGDIFALFGVDCA-SGDTF--TTNPKN--NL
E9G149_DAPPU          TRTRKKIRVARLVRMHSNEME--DVNEVYAGDICALFGVDCA-SGDTF--VTEPKL--EI
A0A087ZTR9_APIME      TRTNKKVRIQRLVRLHSNQME--DVSEVYAGDIFALFGIDCA-SGDTF--VNNSNL--KL
E0VF81_PEDHC          VRTGKKTRIGRLVRMHSNQME--EVTEAYAGDIVAIFGVDCS-SGDSF--VKDSKL--NI
EFGM_NEMVE            TRTGKRVKVPRIVRMHSDIME--DIQEGYAGDICALFGIECA-SGDTF--TAEGAP--LV
F6UKC4_CIOIN          VRTKRKSKASRVVRLHSNKME--DLEEVYSGDICALFGIDCA-SGDTF--VSKAKH--NY
EFGM_CAEBR            SRDGRKVRVQRLVRMHAADME--EITTAYAGDICATFGLDCH-SGETF--STDQNL--AP
EFGM_CAEEL            SRDGRKVRVQRLVRMHAADME--EITTAYAGDICATFGLDCH-SGETF--STDQNL--AP
A0DGW7_PARTE          MKTKKRVKVARMAKMHANQME--EINDVEAGDIFAVFGVDCS-SGDTLV-YGDMNY--QV
A0C9U4_PARTE          MKTKKRVKVARMAKMHANQME--EINDVEAGDIFAVFGVDCS-SGDTLV-YGDMNY--QV
Q22AK9_TETTS          TTVKKRMKISRMIKMHANQME--EINEAGPGEIFAIFGVECA-TGDTLC-EGDMSY--TA
EFG1_ANADE            STKDKKERIGRLLQMHANKRE--EIKEVYAGDIAAAVGLRASTTGDTLCAEDA-----PV
EFG2_MYXXD            SVKGKRERISRLVQMRADKKD--EITECYAGDICAVVGLKLAGTGDTLCDDKQ-----PI
EFG_KORVE             SSKGRTERIGRLLKMHANKRE--EIGEIMAGDICAVVGLKTITTGDTISDEKH-----PL
EFG_SOLUE             VAKRRNERVGRLLRMHANKRE--EIQEIFAGDICAAVGLKTISTGDTICDDAH-----PI
EFG2_GEOSL            STKEKKERIGRLLKMHANKRE--EIKEVYAGDIAAAVGLKYTTTGDTLCPEDS-----PV
EFG2_PELCD            ATRDKKERFGRLLKMHANKRE--EIKQVYSGDIAAAVGLKLTTTGDTLCDPAN-----PC
EFG_MAGMM             ASKDRKERIGRLMLMHANKRE--DIKEVRAGDICAVVGLKNTTTGETLCDPNK-----PI
EFG_CHLAA             STRNQRERLGRILRMHANHRE--DIEEVYAGEIAAMVGPKNSYTGDTICDPDH-----PI
EFG_HERA2             TTKNKRERVGRLLQMHANHRE--EIKEVYAGDIAAVVGPKDTFTGDTICSPDD-----PV
EFG_DEHM1             STRGERERIGRLIRMHANDRE--EIEYADAGEIVASLGLRNTFTGDTLCDQSA-----PI
EFG_GLOVI             ASKDKKERISRLIVLKADDRI--EVDELRAGDLGAVVGLKDTFTGDTLCTE-DS----PV
EFG2_SYNY3            STKEKKERISRLIILKADDRI--EVDQLNAGDLGAVLGLKDTLTGDTLCDD-QE----PI
EFG_DEIRA             ASKDKRERVGRLLKMHANSRE--EVTELKAGELGAVIGLKDAGTGNTLIGDGDD----RV
EFG_ENTFA             ASKGKKERIGRILQMHANTRQ--EIDKVYSGDIAAAVGLKDTTTGDTLCALDA-----PV
EFG_OENOB             TTKDTRERVGRLLQMHAITRR--EIDEVFSGDIAAAIGLKATSTGDSLTSVDR-----PL
EFG_MESFL             STKGDKERVGRILQMHANNRN--EIEEVYAGDIAAAVGLKNTTTGDTLVDEKH-----EI
EFG_MYCPN             VRKNKKERVSRLVKMHAQNRN--EIEEIRAGDICAIIGLKDTTTGETLVDDKI-----DV
EFG_MYCA5             STKGEKERIGRILLMHANSRT--DIDEVRTGDIGAAVGLKFTTTGDTLIDEKHK----DI
EFG_CLOAB             STKGKKERIGRLVKMHSNHRQ--EVEELEAGELGAIVGLKLTTTGDTLSSEDN-----PI
EFG_LACP7             ATKNKKERVGRILQMHANKRE--DLDKVYSGDIAAAVGFKFTSTGDTICDEKH-----PV
EFG_FINM2             STKGKRERIGRILMMHANKRE--EIDKAYAGDIVAIIGLKDTTTGDTLCDMDS-----EV
EFG_MOOTA             STKGRRERIGRILRMHANHRE--EIDEAYAGDIAAAVGLKETTTGDTLCDEQH-----PI
EFG_ECOLI             SVKAARERFGRIVQMHANKRE--EIKEVRAGDIAAAIGLKDVTTGDTLCDPDA-----PI
EFG_WIGBR             SAKDKQERFGRIVQMHANKRE--EIKEVRSGDIAAAIGLKDVTTGDTLCDPLH-----PI
EFG_HYDCU             SVKSKRERVGRILQMHSNSRE--EIKEVRAGEIACAVGLKDTTTGDTLCDPDN-----KI
EFG_FUSNN             STKGKKERMGRILQMHANNRE--EIEHVYCGDIAAAVGLKDTATGDTLCAENA-----PI
EFG_SULSY             SNKGKKERIGRILRMHANQRE--EISEVYAGDIAAAVGV-DATTGDTLCDEKA-----PI
EFG_PARUW             TTKGGEERISRLLEMHANKRE--EKDEFHTGDIAACIGLKKATTGDTLCTSKR-----PI
EFG_ENDTX             PIKDAKERISRIVRMHSNNRE--EVKSVNTGDIAAAVGLKNTGTGDTLCDEEK-----PI
EFG_CUTAK             ATKGKKERIGKIYQMHANKRE--EIESIGAGMICAVMGLKDTTTGETLCDQTN-----PI
EFG1_STRCO            SVKGRKERIGKIYRMHANKRE--EIESVGAGDIVAVMGLKQTTTGETLSDDKS-----PV
EFG_BIFAA             STKEKKERVGKIFQMHADKEN--PVDAAEAGNIYTFVGLKNVTTGDTLCDEKS-----PI
EFG_DESAG             ANTGKKERIGRLLKMHANKRE--EIKWAGAGDIVAAVGLKQVSTGDTICEINR-----PV
EFG_PARD8             TRSGKKERISRLFQMHSNKQN--PMEVIGCGDIGAGVGFKDIRTGDTLCDENH-----PI
EFG_SULMW             SRSGNKERISRIYQMHANKQN--PVNIIEAGDIGAAVGFKDIKTGDTLCDENY-----PI
EFG_SALRD             PTRDEDERIGRMMFMHADSRE--DVDVIRAGDIAAVVGPKNLKTGDTICDPDH-----PV
EFG_CHLT3             SITGKKERIGRLLQMHANHRE--DLDEVFAGDIAAAVGLKDTKTGDTLCDESK-----SI
EFG_GLUOX             TTKGHKERVGRMFQMHADKRQ--EVKSVGAGDIAAFVGLKDTVTGDTLADAAD-----PV
EFG2_HAHCH            TNVGQYERIGRIYEMHADRKV--ARDRIGAGDIVALVGMKHTQTGDTLCAPEA-----PL
EFG1_METCA            TATGKTERIGRIVEMHANQRN--ELDSAQAGDIVAVLGMKNVQTGHTLCDPDK-----PA
EFG1_SYNY3            TATGKTERIGRLVEMHADSRE--EIESAQAGDIVAIVGMKNVQTGHTLCDPKN-----PA
EFG_HYPNA             ATKGKKERVGRMVMMHANKQD--EITEAFAGDIVALAGLKETTTGDTVCDPAQ-----PV
EFG_RHORT             TVKDKRERIGRMLLMHANNRE--EIKWAGAGDIVAIVGLKDTTTGDTLSDTIK-----PV
EFG_NEOSM             SHGDNKERIGRMLLMHANSRE--DVKSETAGNIVALAGLKNTSTGDTLCASGK-----VL
EFG_PSELT             STKQIRERVARLIFMHADKRE--DAEYARAGDIVAIIGLKNTTTGDTLCSQER-----PV
EFG_THEMA             STKGQRERISRIVFMHADKRE--EVDYVRPGDIAAGVGLKVSQTGDTLCDEKE-----PI
EFG_PETMO             TTKNKTERVSRLVFLHADKRE--EVDYIRAGDIVGLIGLKDTSTGDTLSDKEC-----NL
EFG1_SYNWW            SSKNKRERVGRLLRIHAEHRE--EINEVAAGDIVAIIGLKDIGTGDTLCSENF-----PL
EFG2_SYNWW            SRQDRKERFTRLLKMHANHRE--EIEEACAGDIVAGVGLKNTATGDTLCSENH-----LV
EFG1_BDEBA            PRTQKKERIQKLVKMHANSRE--EINSLKAGDIGAVIGLKFTGTGDTLCESSH-----AV
EFG2_DESPS            PIKGKQEKIGKLLRLHANKRE--EVKEIVAGDIGAVVGLKFTTTGDTLCEKEA-----QI
EFG1_GEOSL            SSRGCFEKLARLFRMHAHKRE--QIEEAAAGDIVAAAGLKEVLTGDTLCDPAH-----RI
EFG1_PELCD            STQGVAEKVARLFRMHAHKRE--RVTEVQAGDIVAAVGLKHALTGDTLCRAEQ-----PL
EFG2_SYNAS            AGKKKKEKASRLLKMHANKRE--RLEQAGAGDIVAVMGLKETVTGDTICDEKN-----PI
EFG3_MYXXD            PATGRRERVGRLMFMHANRRE--EVAEVHAGDICAALGLKGVRTGDTLCDPAE-----PV
EFG2_STRCO            AGTRRTERIGRILRVRADRHD--PLERAVAGDIVAVVGLKTARAGSTLCAPGA-----PL
EFG2_BORBU            ASNGKREKFTKIFRVFSNKNE--QIDFVKTGDIGAVLGLKFSVTGDTLVEENN-----NV
EFG2_BORAP            ASNGKREKFTKIFRVFSNKNE--QIDFVKTGDIGAVLGLKFSVTGDTLIEENN-----NI
EFG2_BORBP            ASNGKREKFTKIFRVFSNKNE--QIDCVKTGDIGAVLGLKFSFTGDTLVEENN-----NV
EFG1_TREDE            TGKKKRERVNRILRMHSNKSE--QMDSVQAGDIAVFIGLKISQTGDTLGSEGQ-----PL
EFG2_TREPA            IGKKKRERVYRILRMHSNKSE--TVECIQAGDIAVIVGLKSAQTGDSVGDGSC-----PV
EFG_CARRP             NSKNIKEKIFRIIRMFANSKK--DLNIASAGDIVVLIGLKNSFTGDTLSFDNE-----KV
EFG_RHOBA             QRSQKKERFSRIVRMHSEKRD--EIDEAGPGDIIAVMGI-DCASGDTYCSERD-----YA
K2LYN2_TRYCR          VRSGRTFLPPKLVRMHADSAE--QVDEVKAGDICAIQGEIDASSGDTIMRAGPKSG-LLI
Q38BA0_TRYB2          VRSGKTFLPQKLVRMHANSTD--QIDEVRAGDICAIQGEIDASSGDTIVKAGVTAG-QLI
A4ICS8_LEIIN          IRTGKNFLPPKLVRMHADSAE--VVDEVRAGDICAIQGEVDASSGDTLMKSGPQSGSQLF
Q4Q219_LEIMA          IRTGKNFLPPKLVRMHADSAE--VVDEVRAGDICAIQGEVDASSGDTLMKSGPQSGSQLF
A4HNR7_LEIBR          IRTGKNFLPPKLVRMHADSAE--VVDEVRAGDICAIQGEVDASSGDTLMKAGPQSGSQLF
Q7RFK0_PLAYO          MITHKKEVVKKIMKMHSNTAQ--EINEAHAGDIIAINGITGS-TGTTYTNGINT----NF
A5K8J4_PLAVS          MLTSKREVVKKILKMHANMAQ--EVTEAHAGDIVAINGISGS-TGTTYTNGVSS----NL
A0A1Y3DJ13_PLAKN      MLTNKKEMIKKILKMHANMAQ--EVNEAHAGDIVAINGISGR-TGTTYTNGVAS----NL
A7AM19_BABBO          VEDGKKHSTKKLFKMHASDTE--DVSEAYSGEIVAITGLKCN-SGVTFTDGRL-----QL
Q4MYM5_THEPA          VEEDKRVTLKKLYKVHSDEVL--EVSEAREGEIVAISGLKCP-SGVTVTDGR------QV
                                ::  : :             * :    *     :  :             

EFG2_ANADE            NMTSMHVPEPVIALSIKPVDSKSETNMGKALRRFTREDPTFRAGLDEESGETIIRGMGEL
EFG1_DESPS            SMTSMHVPEPVISLSIKPIDNKAQINMSKALNRFTKEDPTFRTFVDHETNETIISGMGEL
EFG1_BORBU            SMTSMFIPDPVISLSVKPKDKKSADNMAKALGRFTKEDPTFKTYVDIESNETIIQGMGEL
EFG1_BORBP            SMTSMFIPDPVISLSVKPKDKKSADNMAKALGRFTKEDPTFKTYVDIESNETIIQGMGEL
EFG2_TREDE            AMSSMYVPDPVISLSLTPKDKQAADQMSKALNRFTKEDPTFRSYVDKESNQTIIQGMGEL
EFG1_TREPA            AMTSMFVPEPVISLSITPKDKRSADQVSKALNRFTKEDPTFRSFVDPESNQTIIQGMGEL
EFG1_SYNAS            AMTSMFVPEPVISLAIVPKDKKSMVNMSKALNRFTKEDPTFRTHLDPETSETIIEGMGEL
EFG2_BDEBA            SMQSMHVPDSVISLAIAPKDKTAANNFSKALQKFRKEDPTFRVHRDEESNETIISGMGEL
EFG1_MYXXD            TMTSMHVPDAVISLAVAPKDRSNLTNFSKALNRFTKEDPTFRVHRDEESGQTIIRGMGEL
EFGM_DICDI            TMTSMHVPEPVMSLSIQPKSKDGQANFSKALSKFQKEDPTFRVKSDQESGQIIISGMGEL
D3BMN4_POLPP          TMTSMHVPEPVMSLSIAPKGKDGQTNFTKALNKFQKEDPTFRVQTDQESGQIVISGMGEL
EFGM_CRYNJ            TMTSMFVPEPVISLSIRPEGNE-TPNFSRALNRFQKEDPTFRVHVDSESQETIISGMGEL
EFGM_USTMA            SMTSMFVPEPVISLAITPEGKE-SQNFSRALNRFQKEDPTFRVHVDKESNETIISGMGEL
EFGM_COPC7            SMTSMFVPEPVISLAIKPKGQE-TPNFSRALNRFQKEDPTFRVHIDQESKETIISGMGEL
EFGM_SCHPO            TMTSMFVPEPVISLSLKPKSKD-TTSFSKALNRFQREDPTFRVQLDNESKETIISGMGEL
F4NY64_BATDJ          TMTSMFVPKPVISLSITPKSKE-SANFSKALNRFQREDPTFRVHVDHDSKQTIISGMGEL
D0NCX8_PHYIT          TMTSLHVPEPVMSLAVTPKNKQQIGNFSKALNRFQKEDPTFRVRVDDDSKETIISGMGEL
EFGM1_ARATH           TMTSMNVPEPVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDPESGQTIISGMGEL
EFGM2_ARATH           TMTSMNVPEPVMSLAVQPVSKDSGGQFSKALNRFQKEDPTFRVGLDPESGQTIISGMGEL
D7SLS6_VITVI          TMTSMNVPEPVMSLAISPVSKDSGGQFSKALNRFQREDPTFRVGLDAESGQTIISGMGEL
M1CGG0_SOLTU          TMTSMNVPEPVMSLAVSPVSKDSGGQFSKALNRFQKEDPTFRVGLDAESGETIISGMGEL
EFGM_ORYSJ            TMTSMNVPEPVMSLAVSPISKDSGGQFSKALNRFQKEDPTFRVGLDPESGETIISGMGEL
I1GYK4_BRADI          TMTSMNVPEPVMSLAVNPISKDSGGQFSKALNRFQREDPTFRVGLDPESGQTIISGMGEL
C5WSZ1_SORBI          TMTSMNVPEPVMSLAVSPISKDSGGQFSKALNRFQKEDPTFRVGLDAESGQTIISGMGEL
A9RPB9_PHYPA          TMTSMNVPEPVMSLAIAPSSKDVGPQFSKALNRFQKEDPTFRVSLDPDSGQTIISGMGEL
A9SP22_PHYPA          TMTSMNVPEPVMSLAIAPSSKDVGPQFSKALNRFQKEDPTFRVSLDPDSGQTIISGMGEL
EFGM_COCIM            SMSSMFVPEPVISLSIKPKNSKDLANFSKAINRFQREDPTFRVHFDTESEETIISGMGEL
C0NUK7_AJECG          SMSSMFVPEPVISLSIRPKNSKDSSNFSKGINRFQREDPTFRVHFDEESEETIISGMGEL
EFGM_EMENI            TMSSMFVPEPVISLSIKPKHSKDYANFSKAMARFQREDPTFRVSFDPESEQTLISGMGEL
EFGM_ASPFU            TMTSMFVPEPVISLSIKPKNSKDSANFSKAMARFQREDPTFRVSYNAESEETLISGMGEL
EFGM_SCLS1            SMSSMFVPDPVISLSIKPKTTKDGSNFSKAMNRFQREDPTFRVHVDAESQETIISGMGEL
C7YWN8_FUSV7          TMSSMFVPDAVMSLSIKPKRTGDADNFSKAMNRFQREDPTFRVHVDPESEETIISGMGEL
I1RCR5_GIBZE          TMSSMFVPDAVMSLSIKPKRTGDADNFSKAMNRFQREDPTFRVHVDAESEETIISGMGEL
EFGM_NEUCR            SLSSMYVPDAVMSLSIKPKRSSDADAFSKAMNRFMREDPTFRLHVDEESEETIISGMGEL
EFGM_ASHGO            SMSSMYVPDAVISLSISPNSKDSATNFSKALNRFQKEDPTFRVRFDPESKQTIISGMGEL
EFGM_YEAST            SMSSMYVPDAVVSLSITPNSKD-ASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGEL
EFGM_CANAL            TMSSMFVPEAVISLSISPKTKD-NGAFSKAMNRFQKEDPTFRVHYDSESKETIISGMGEL
EFGM_YARLI            SMSSMFVPDPVISLAITPKDKGSLTNFSKAMNRFQKEDPTFRVHFDAESKETIISGMGEL
G3QKQ5_GORGO          SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVYFDTENKETVISGMGEL
A0A2I3T1A0_PANTR      SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVYFDTENKETVISGMGEL
EFGM_HUMAN            SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVYFDTENKETVISGMGEL
G1QVZ1_NOMLE          SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVHFDTENKETVISGMGEL
EFGM_PONAB            SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVHFDTENKETIISGMGEL
F6QKI2_CALJA          SMESIHVPDPVISIAMRPSNKNDLEKFSKGIGRFTREDPTFKVHFDTENKETIVSGMGEL
H0UVN5_CAVPO          SMESIHVPDPVISVAMSPSNKNDLDKFSKGIGRFTREDPTFKVHFDTESKETIVSGMGEL
G1T5N5_RABIT          SMESIHVPDPVISIAMRPSNKNDLEKFSKGIARFTREDPTFKVHFDTESKETIVSGMGEL
G1M4M7_AILME          SMESIHVPDPVISVAMKPSNKNDMEKFSKGIGRFTREDPTFKVHFDTESKETIVSGMGEL
M3WIL3_FELCA          SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVHFDTESKETIVSGMGEL
G1NTB9_MYOLU          SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVHFDTESKETIVSGMGEL
H0WY66_OTOGA          SMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTFKVHFDTESKETIVSGMGEL
EFGM_MOUSE            SMESIHVPEPVISIAMRPSNKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGEL
EFGM_RAT              SMESIHVPDPVISVAMKPSNKNDLEKFSKGIARFTREDPTFKVHFDTESKETIVSGMGEL
F7EHU0_MONDO          SMESIHVPDPVISVSMKPSNKNDLDKFSKGIARFTREDPTFRIHYDIESRETIVSGMGEL
G1KFW0_ANOCA          SMESIHVPDPVISVAMKPINKNDLDKFSKGINRFTREDPTFRVHFDTESKETIVSGMGEL
F6Q9W5_XENTR          SMESIHVPDPVISVAMKPTNKNDLDKFSKGISRFTREDPTFRVHYEVESKETIISGMGEL
H3AWE2_LATCH          SMESIHVPDPVISVAIRPANKNDLDKFSKGINRFIREDPTFRVFFDTESKETVVSGMGEL
H3CQL2_TETNG          SMESIHVPEPVISMAIKPSNKNDHDKFSKAINRFTREDPTFRVHFDTESKETIISGMGEL
I3J7A5_ORENI          SMESIHIPEPVISMAMKPANKTDLDKFSKGINRFTREDPTFRVHYDTESKETIISGMGEL
G3P617_GASAC          SMESIHVPEPVISMSIKPANKTDLDKFSKGINRFTREDPTFRVHFDTESKETIISGMGEL
EFGM_DANRE            SMESIHVPEPVISMAIRPSNKNDTDKLSKGISRFTREDPTFRVHFDTESKETIISGMGEL
C3ZDC2_BRAFL          SMESIHVPDAVISLSIKPEDKGQLDNFSKGIARFTREDPTFRVHFDDESKETIASGMGEL
EFGM_ANOGA            SMESIFVPDPVVSMAIKPTNSKDRDNFAKAIARFTKEDPTFHFEYDADVKETLVSGMGEL
W5JI53_ANODA          SMESIFVPDPVVSMAIKPSNSKDRDNFAKAIARFTKEDPTFHFEYDADIKETLVSGMGEL
EFGM_AEDAE            SMESIFVPDPVVSMAIKPANNKDRDNFSKAVARFTKEDPTFRFAYDTDIKETLVSGMGEL
EFGM_DROME            SMESIFVPEPVVSMAIKPNNTKDRDNFSKAIARFTKEDPTFHFFFDNDVKETLVSGMGEL
EFGM_DROPS            AMESIFVPEPVVSMAIKPNNTKDRDNFSKAIARFTKEDPTFHFFFDNDVKETLVSGMGEL
E9G149_DAPPU          ALESIHIPEPVISMAIRPAHSKDMDSFSKAVGRFTKEDPTYHINYDTDNKETIASGMGEL
A0A087ZTR9_APIME      SMESIYIPEPVVSMSLQLKNSKDRDNFSKGIARFTKEDPTLKYHYDADNKESLISGMGEL
E0VF81_PEDHC          SMESIFVPDPVISMSIKPASLTNREVFSKAIARFVKEDPTFKMFYDPDSKETLVSGMGEL
EFGM_NEMVE            SMESIFVPEPVISLAVEPKNKNDLDQFSKAINRFTREDPTFRVRFDDESKETIISGMGEL
F6UKC4_CIOIN          SMEPMYVPDPVVSMSLKQEGRDDSGKMSKALNRFSKEDPTFQVKWDEEAEEMVVSGMGEL
EFGM_CAEBR            HCESMHIPEPVISMAIKPVNRKDADNFIKALTRFTKEDPTFRREYNQEAKETIVSGMGEL
EFGM_CAEEL            HCESMHIPEPVISMAIKPVNRKDADNFIKALTRFTKEDPTFRREYNQEAKETIVSGMGEL
A0DGW7_PARTE          LCSSMFVPQPVMSLSIKPTKKEYSARFQKALSKFQREDPTFNVDMDKESEEIIISGMGEL
A0C9U4_PARTE          LCSSMFVPQPVMSLSIKPSKKEYSARFQKALSKFQREDPTFNVDMDKESEEIIISGMGEL
Q22AK9_TETTS          RCSSMHVPAPVVNLSIKPKDNKSSAKFNKALKKFSREDPTFRVSIDKESEEIVISGMGEL
EFG1_ANADE            ILERMEFPEPVIHIAIEPKTKGDQDKMGVALQRLQMEDPSFRVHTDEETGQTIIGGMGEL
EFG2_MYXXD            ILERMDFPEPVIDIAIEPKSTADQDKILQSLQRLAMEDPSFRVRTNEETGQTLIAGMGEL
EFG_KORVE             VLESIEFPTPVISVAVEPKTKSDQEKMGVALNKLAQEDPTFRVSTDPDSGQTIIAGMGEL
EFG_SOLUE             VLEAIDFPMPVIQLAVEPKTKADQEKMGMAIQKLAQEDPTFRVYTDPETGQTILSGMGEL
EFG2_GEOSL            VLESIEFPEPVIAIAIEPKTKADQEKLGISLQKLASEDPSFRVRTDEETGQTIISGMGEL
EFG2_PELCD            LLESMEFPEPVIHIAIEPKTKGDMDKMGQALGKLVQEDPTLRVRTDEETGQTILSGMGEL
EFG_MAGMM             ILEKMDFPAPVIAIAVEPKTKADQERMGVALQRLAQEDPSFRVEVDHETNQTIISGMGEL
EFG_CHLAA             VLESIRFPEPVIELAVEPKTKADQDKMSIALSRLAEEDPTFRVYTDPETGQTIIKGMGEL
EFG_HERA2             VLESIKFPEPVISVAIEPKTKADQDKMSIALSRLAEEDPTFRLNTDVETGQTIIRGMGEL
EFG_DEHM1             LLESIKFPEPVINLAIEPKTRSDQDKMTEGLQKLAEEDPTFKVKFDDETGQTVIYGMGEL
EFG_GLOVI             ILESLFIPEPVISVAIEPKTKADLDKLSKALQSLSEEDPTFRVHVDQETNQTIIAGMGEL
EFG2_SYNY3            ILESLFVPQPVISVAVEPKTKQDMDKLSKALQSLSEEDPTFRVSVDPETNQTVIAGMGEL
EFG_DEIRA             LLESIDIPEPVIKLAIEPKTKADQEKMGVGLQKLAEEDPTFKVETDQESGQTTIAGMGEL
EFG_ENTFA             ILESIEFPDPVIQVAVEPKSKADQDKMGVALQKLAEEDPSFRVETNVETGETVISGMGEL
EFG_OENOB             VLESMEFPDPVIQMAVEPKTKADQEKMAEALQKLSEEDPSFHAETNSETGQTLISGMGEL
EFG_MESFL             ILESMVFPEPVIQLALEPKTKADQEKMGLALSKLAEEDPTFRTYTDEETGQTIIAGMGEL
EFG_MYCPN             QLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGEL
EFG_MYCA5             VLENMNFPEPVISQALEPASKDASEKLSLALQRLAAEDPTFKYYTDEETGQTIIAGMGEL
EFG_CLOAB             ILEKMEFPDPVIEVAIEPKTKASQEKMGIALAKLAEEDPTFKTYTNQETGQTIIAGMGEL
EFG_LACP7             VLEAMEFPEPVIDVAIEPKTKAGQDKMGEALAKLAEEDPTFRVRTNEETGQTIIAGMGEL
EFG_FINM2             ILENMEFPDPVISVAIEPKTKASQEKMGIALAKLAEEDPTFRTYTDEETGDTIISGMGEL
EFG_MOOTA             VLEAMEFPEPVISVAIEPKTKADQEKMSIALQKLAEEDPTFRMYTDQETGQTIISGMGEL
EFG_ECOLI             ILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGEL
EFG_WIGBR             ILEKMEFPEPVISVAVEPKTKSDQEKMSSALNRLAKEDPSFRVSSDEESGQTIISGMGEL
EFG_HYDCU             ILERMEFPEPVISIAIEPKTKADQEKMGIALQKLAAEDPSFRVKTDEETNQTIISGMGEL
EFG_FUSNN             VLEQMEFPEPVISVAVEPKTKNDQEKMGIALSKLAEEDPTFKVRTDEETGQTIISGMGEL
EFG_SULSY             VLEKMEFPEPVIAMAIEPKTKSDQEKLSQVLNKFMKEDPTFKVSVDPETNQTLIHGMGEL
EFG_PARUW             LLEKMEFPEPVISMAIEPKSKGDREKLAMALSSLSIEDPTFRVTTDEETGQTIIAGMGEL
EFG_ENDTX             LLESMDFPVPVIDVAIEPKSKADEEKLGIALNRLSEEDPTFRVRTNEETNQTIIAGMGEL
EFG_CUTAK             ILESMTFPAPVIEQAIEPKSKADQEKLSNAIQRLVEEDPTFRVHTDEETGQTIVAGMGEL
EFG1_STRCO            ILESMDFPAPVIQVAIEPKSKGDQEKLGVAIQRLAEEDPSFQVHTNEETGQTIIGGMGEL
EFG_BIFAA             SLESMTFPDPVIEVAVEPKTKADQEKMSIALAKLSDEDPTFQVKTDEESGQTLISGMGEL
EFG_DESAG             VLESLDIPEPVIEVAIEPKTKADRDALSAALAKLAKEDPSFRVKGDDETNQTLIAGMGEL
EFG_PARD8             TLESMEFPEPVIGIAVEPKTQKDMDKLGMGLAKLAEEDPTFRVQTNEETGQTVISGMGEL
EFG_SULMW             IYENISFPDPVIGLAIEPKYKSDIDKMSLALSKLSEEDPTFIVRNDKYTGQTIISGMGEL
EFG_SALRD             VLESMDFPEPVIRIAVEPRTKADRDKLTNGLTKLAEEDPTFNVRTDEETGQTIIAGMGEL
EFG_CHLT3             VLEKMVFPEPVIQIAIEPKTKADSDKLGMSLAKLAEEDPTFKVSMNEDTNQTLIAGMGEL
EFG_GLUOX             VLERMQFPVPVIDISVEPKTKDAVEKMTLALQKLTAEDPSLHLKTDQETGQTILSGMGEL
EFG2_HAHCH            VLERINAPEPVMDIVIEPKSRQDQDRLGEALRAIVGEDPSLRLSTG-AAGETLVSGMGEL
EFG1_METCA            TLEPMVFPDPVISIAVTPKDKAANEKMGIALGKMVQEDPSFHVETDQESGETILKGMGEL
EFG1_SYNY3            TLEPMVFPDPVISIAIKPKKKGMDEKLGMALSKMVQEDPSFQVETDEESGETIIKGMGEL
EFG_HYPNA             VLETMTFPQPVIEIAVEPKTKADQEKMSVGLQRLAAEDPSFRVETNFESGQTIMKGMGEL
EFG_RHORT             ILERMEFPEPVIEVAVEPKTKADVEKMGMALARLAAEDPSFRVASDSESGQTVIKGMGEL
EFG_NEOSM             TLERISAPDPVIEIAVEPKSTAEQEKMALAVARLCAEDPSLKVASNEETGQTLLRGMGEL
EFG_PSELT             LLEKMSFPEPVISIAIEPLTRDDEERMVKAVAALSEEDPTLRINVDRETGQVVLSGMGEL
EFG_THEMA             ILEKIDFPEPVISLAVEPVTKADEEKLVKALLALSEEDPTLQVRVDKETGETIISGMGEL
EFG_PETMO             VLEKLEFPEPVISVSIEPETKDDEAKLGKALNALTEEDPSLRSYVDHDTGETILSGMGEL
EFG1_SYNWW            LLETIDFPQPVIQIAIEPKNQAGLDKISEALNRISAEDPTFKISYNKETGQVLLAGMGEL
EFG2_SYNWW            LLETIDFPQPVIDVAIEAKTRADQERIEESLRRLAEEDPTFQTRQDKESGQMIISGMGEL
EFG1_BDEBA            VLETITFPEPVISVAVEAKSSADQEKMLAGLAKLEKEDPSCRLRTDPETGQILLSGMGEL
EFG2_DESPS            ILESMEFPDPVIGVAIEPSSKADEKKLTESLAKIALEDPSFVVSQNEDTGQTIISGMGEL
EFG1_GEOSL            VLEGLAVPEPVVSLAVEARGVDDRDKLLPALEKLQWEDPTFRVHEDEETGQTILTGMGEL
EFG1_PELCD            RLEGLRIPEPVVSLAVEPRHIDDREKLPAALEKLLWEDPTFRVREDADTGQTILTGMGQL
EFG2_SYNAS            LLESMEFYEPVISQAIEAKTPADQEKLSLALLKLMEEDPTLRVKYDEETAQTVISGMGEL
EFG3_MYXXD            VLESLGVMEPVVQLAVEARSPAELTKLEDGLHRLAAEDPSLRVGVDPESGQVLLSGMGEL
EFG2_STRCO            LLEPPGVAEPVVHVAVEARRSTETDRLAAALARLTEEDPSLALRTDPETAQTVLSGMGEL
EFG2_BORBU            LLEAVMFPEPVVLMSVEPERSSDEVRLKEIFEIISKEDPTFSYSESKETGQLIISGMGEL
EFG2_BORAP            LLESVMFPEPVVLMSVEPERSSDEVRLKEIFEIISKEDPTFSYSESKETGQLIISGMGEL
EFG2_BORBP            LLESVTFPEPVVLMSVEPERSSDEVRLREIFGIISKEDPTFSYYESKETGQLIISGMGEL
EFG1_TREDE            LLESMQFPEPVISVSVEPKSLSESDRLKEVLEILSKEDPTFTSREDSETGQLIISGMGEL
EFG2_TREPA            VLESMHFPEPVISVSLEPMDASSRDKLQETLGILSREDPTFSVREDAETGQLLISGMGEL
EFG_CARRP             LLEKINIPLPVISVSVEPIVKNDYEKLLNLINKFCKEDPSLLFKINENTGELILSGMGEL
EFG_RHOBA             TLESMYVPEPVIKIAVNPLNRGDGDKMSKALQRFRKEDPTFSVYTDEETNEILISGMGEL
K2LYN2_TRYCR          SCEDMYIPPRVISSSIKVKDDRDLNRLRDRMAAFMREDPTFSFYRNSETNEDILEGMGEL
Q38BA0_TRYB2          TCEDMYVPPRVISASVKINNDRDSSKLRERMGAFMREDPTFCFYRNTETNEDIVEGMGEL
A4ICS8_LEIIN          SCEDMYVPPRVISASLKTKDDKEQSRVRERMLAFMREDPTFVYYRNSETNEDIVEGMGEL
Q4Q219_LEIMA          SCEDMYVPPRVISASLKTKDDKEQSRVRERMLAFMREDPTFVYYRNSETNEDIVEGMGEL
A4HNR7_LEIBR          SCEDMYVPPRVISASLRTKDDKEHSRVRERMLAFMREDPTFVYYRNSETNEDIVEGMGEL
Q7RFK0_PLAYO          HLLNIYVPKPVISVAVEILKKGDMTKLTKALNKFTKEDPTFYVKTDEQTKETIFEGIGEL
A5K8J4_PLAVS          HLLNIHVPKPVISVAVQIEKKGDMTKLTKALNKFVKEDPTFHVKTDDQTKEILFEGIGEL
A0A1Y3DJ13_PLAKN      HLLNIHVPKPVISVAVEIEKKGDMTKLTKALNKFVKEDPTFHVKTDEQTKEIIFEGIGEL
A7AM19_BABBO          TMAPIFVPEPVVSLALKKVNTSDMTKLSKALNRFKREDPTFRIAIDEESKETVMSGMGEL
Q4MYM5_THEPA          TMKPMHVPEPVVSMALKNVNRSDSVKLAKALNRFQKEDPTFKINIDEESKETILSGMGEL
                                *:   :          .   .  :  ***:          :    *:*:*

EFG2_ANADE            HLEVYIERMKREYNCIVEVSPPQVAYRETVSQRAD-FAYTHKKQTGGSGQFGRVCGYIEP
EFG1_DESPS            HLEVYVERMKREYAAEVEVGKPQVSYRETITQRAE-FNYTHKKQTGGTGQFGRVAGYMEP
EFG1_BORBU            HLEVYIERMKREFKAEVETGMPQVAYRETITRKAE-FNYTHKKQSGGAGQFGRVAGFMEP
EFG1_BORBP            HLEVYIERMKREFKAEVETGMPQVAYRETITGKAE-FNYTHKKQSGGAGQFGRVAGFMEP
EFG2_TREDE            HLEVYIERMKREYKCDVETGMPQVAYREAITQRAD-FNYTHKKQTGGSGQFGRVAGFIEP
EFG1_TREPA            HLDVYIERMRREYKCEVETGMPQVAYREAISARAD-FNYTHKKQTGGSGQFGRVAGFIEP
EFG1_SYNAS            HLDIYVERIRREYNAEVTTGNPRVAYRETITQKAA-FNYTHRKQTGGSGQYGRVAGYIEP
EFG2_BDEBA            HLEIYVERMKREFNCEVIVGQPQVAYRETISVEAP-YDYTHKKQTGGSGQYAKIVGKIQP
EFG1_MYXXD            HLEIYIERMKREYNCEVQAGKPQVAYRETISQKGE-FAYTHKKQTGGSGQFARVCGYIEP
EFGM_DICDI            HLEIYVERMKREYNVETVTGKPLVAYRETIQQRGD-YNFTHRKQSGGQGQYAKMIGFAEQ
D3BMN4_POLPP          HLDIYVERMRREYNVETVVGKPLVAYRETIQSRGD-YNYTHKKQSGGQGQYAKMIGYIEP
EFGM_CRYNJ            HLDIYVERMKREYNVACVTGKPRVAFRETITEAAK-FNYTHKKQSGGSGQFGRVIGSIEP
EFGM_USTMA            HLEIYVERMRREYNVPCTTGKPRVAFRETIEKKAT-FAYTHKKQTGGAGQFGRVMGYIEP
EFGM_COPC7            HLEIYVERMRREYNTECITGKPRVAFRETITQRAE-FAYTHKKQTGGAGQFARVIGYIEP
EFGM_SCHPO            HLEVYVERMRREYKVDCETGKPRVAFRETLSKKVP-FSYLHKKQSGGAGQYAKVEGYIEY
F4NY64_BATDJ          HLEIYVERMKREYGVECATGKPQVAFRETITAKVH-FDYLHKKQSGGSGQYGRVIGYIEP
D0NCX8_PHYIT          HLQIYVERMRREYSVDVETGAPQVNYRETIRQRSE-FNYLHKKQSGGSGQYARVVGYVEP
EFGM1_ARATH           HLDIYVERMRREYKVDATVGKPRVNFRETITQRAE-FDYLHKKQSGGAGQYGRVTGYVEP
EFGM2_ARATH           HLDIYVERMRREYKVDATVGKPRVNFRETITQRAE-FDYLHKKQSGGAGQYGRVTGYVEP
D7SLS6_VITVI          HLDIYVERIRREYKVDATVGRPRVNFRETVTKRAE-FDYLHKKQTGGQGQYGRVCGYVEP
M1CGG0_SOLTU          HLDIYVERIRREYKVEAQVGKPRVNFRETITKRAD-FDYLHKKQSGGQGQYGRVIGYVEP
EFGM_ORYSJ            HLDIYVERIRREYKVDAKVGKPRVNFRETITQRAE-FDYLHKKQSGGQGQYGRVCGYIEP
I1GYK4_BRADI          HLDIYVERIRREYKVDAKVGKPRVNFRETITQRAE-FDYLHKKQSGGQGQYGRVCGYIEP
C5WSZ1_SORBI          HLDIYVERIKREYKVDAKVGKPRVNFRETITQRAE-FDYLHKKQSGGQGQYGRVCGYIEP
A9RPB9_PHYPA          HLDIYVERIRREYKVDAVVGKPQVNFRETITQRAE-FDYLHRKQSGGQGQYGRVVGYIEP
A9SP22_PHYPA          HLDIYVERIRREYKVDAVVGKPQVNFRETITQRAE-FDYLHRKQSGGQGQYGRVVGYIEP
EFGM_COCIM            HLDIYVERMRREYRVDCETGKPQVAYRETIGKRVE-FDHLLKKQTGGPGEYARVAGWMEP
C0NUK7_AJECG          HLEVYVERLRREYRVDCVTGKPQVAYRETIGEKTE-FDHLLKKQTGGPGDFAGVVGWLEP
EFGM_EMENI            HLDIYVERMRREYRVDCETGPPQVAYRETISQRVE-FDHLLKKQSGGPGDYARVVGWLEP
EFGM_ASPFU            HLDIYIERMRREYRVDCVTGPPQVAYRETIGNRVE-FDHLLKKQSGGPGEYARVVGWMEP
EFGM_SCLS1            HLDIYVERMRREYKVEVETGKPQVAYRETITEHVT-FDHTLKKQTGGAGDYARVVGFLEP
C7YWN8_FUSV7          HLEVYVERLKREYKTECITGQPRVAYRETIARKAD-YDFLLKRQSGGPGDFARVAGWIEP
I1RCR5_GIBZE          HLEVYVERLRREYKTDCVTGQPRVAYRETIAHRAD-YDFLFKRQSGGPGDFARVAGWIEP
EFGM_NEUCR            HLEIYVERLRREYKVECETGQPRVSYRETITQKAE-FDYLLKRQSGGPGDYARVVGWIEP
EFGM_ASHGO            HLEIYVERMRREYNVACTTGKPQVSYRESIQIPAT-FDYTHKKQSGGAGQYARVMGNLTP
EFGM_YEAST            HLEIYVERMRREYNVDCVTGKPQVSYRESITIPAD-FDYTHKKQSGGAGQYGRVIGTLSP
EFGM_CANAL            HLEIYVERIKREYGVDCVTGKPQVSYREAITVPSA-FDYTHKKQSGGAGQYGRVIGEMNP
EFGM_YARLI            HLEIYVERMKREYNVVCETGKPQVAYRETITTAAP-LDFTHKRQSGGAGQYARIIGEMSP
G3QKQ5_GORGO          HLEIYAQRLEREYGCPCITGKPKVAFRETITAPVP-FDFTHKKQSGGAGQYGKVIGVLEP
A0A2I3T1A0_PANTR      HLEIYAQRLEREYGCPCITGKPKVAFRETITAPVP-FDFTHKKQSGGAGQYGKVIGVLEP
EFGM_HUMAN            HLEIYAQRLEREYGCPCITGKPKVAFRETITAPVP-FDFTHKKQSGGAGQYGKVIGVLEP
G1QVZ1_NOMLE          HLEIYAQRLEREYGCPCITGKPKVAFRETITAPVP-FDFTHKKQSGGAGQYGKVIGVLEP
EFGM_PONAB            HLEIYAQRLEREYGCPCITGKPKVAFRETITAPVP-FDFTHKRQSGGAGQYGKVIGVLEP
F6QKI2_CALJA          HLEIYAQRMEREYGCPCITGKPKVAFRETITAPVP-FDFTHKKQSGGAGQYGKVIGVLEP
H0UVN5_CAVPO          HLEIYAQRMEREYGCPCITGKPKVAFRETITAPVP-FEFTHKKQSGGAGQFGKVIGVLEP
G1T5N5_RABIT          HLEIYAQRLEREYGCPCITGKPKVAFRETITAPVP-FDFTHKKQSGGAGQYGKVIGVLEP
G1M4M7_AILME          HLEIYAQRMEREYGCPCVTGKPKVAFRETITAPVP-FEFTHKKQSGGAGQFGKVIGVLET
M3WIL3_FELCA          HLEIYAQRMEREYGCPCVTGKPKVAFRETITAPVP-FEFTHKKQSGGAGQFGKVIGVLEP
G1NTB9_MYOLU          HLEIYAQRMEREYGCPCITGKPKVAFRETITAPVP-FEFTHKKQSGGAGQFGKVIGVLEP
H0WY66_OTOGA          HLEIYAQRMEREYGCPCITGKPKVAFRETITAPVP-FEFTHKKQSGGAGQFGKVIGVLEP
EFGM_MOUSE            HLEIYAQRMEREYGCPCITGKPKVAFRETIVAPVP-FDFTHKKQSGGAGQFGKVIGVLEP
EFGM_RAT              HLEIYAQRMEREYGCPCITGKPKVAFRETVTAPVP-FDFTHKKQSGGAGQYGKVIGVLEP
F7EHU0_MONDO          HLEIYAQRMEREYGCPCVTGKPKVAFRESITGPVP-FDFTHKKQSGGAGQYGKVIGVLEP
G1KFW0_ANOCA          HLEIYAQRMEREYACPCVTGKPKVAFRESILAAVP-FEFTHKRQSGGAGQYGKVIGFVEP
F6Q9W5_XENTR          HLEIYAQRMEREYACPCVMGKPKVAFRETISKTVP-FDFTHKKQSGGAGQYGKVIGFLEP
H3AWE2_LATCH          HLEIYSQRLEREYNCPCVMGKPKVAFRETISAAVP-FDFTHKKQSGGAGQYGKVIGVLEP
H3CQL2_TETNG          HLEIYSQRMEREYNCPCVMGKPKVAFRETITSPVS-FDFTHKKQTGGSGQYGKVVGVLEP
I3J7A5_ORENI          HLEIYSQRMEREYNCPCVMGKPKVAFRETITSPVP-FDFTHKKQTGGSGQYGKVIGVLEP
G3P617_GASAC          HLEIYSQRMEREYNCPCVMGKPKVAFRETITSSVQ-FDFTHKKQSGGSGQYGKVIGVLEP
EFGM_DANRE            HLEIYSQRMEREYSCPCVMGKPKVAFRETLTSAVP-FEYTHKKQSGGSGQYGKVIGVLEP
C3ZDC2_BRAFL          HLDVYAQRMASEYKCKCVLGKPKVAFRESIMSPVQ-FDFLHKKQSGGSGQYGRVVGVLEP
EFGM_ANOGA            HLEIYAQRMEREYNCPVTLGKPKVAFRETLIGPCE-FDYLHKKQSGGQGQYARVSGILEP
W5JI53_ANODA          HLEIYAQRMEREYNCPVTLGKPKVAFRETLVTPCE-FDYLHKKQSGGQGQFARVTGILEP
EFGM_AEDAE            HLEIYAQRMEREYNCPVILGKPKVAFRETLVAPCE-FDFLHKKQSGGQGQYARVTGVLEP
EFGM_DROME            HLEIYAQRMEREYGCPVTLGKPKVAFRETLVGPCE-FDYLHKKQSGGSGQYARIIGVMEP
EFGM_DROPS            HLEIYAQRMEREYGCPVTLGKPKVAFRETLVGPCE-FDYLHKKQSGGSGQYARIIGVMEP
E9G149_DAPPU          HLEIYAQRMEREYNCPVVMGKPKVSFRESLLSPCE-FDYLHKKQSGGSGQFGRISGVMEP
A0A087ZTR9_APIME      HLEIYAQRLEREYGCPIILGKPKVSFRETLREPIE-FDYLHKKQSGGAGQYARVIGILEP
E0VF81_PEDHC          HLDIYCQRMEREYNCKVILGKPRVAFRQTLTSPYN-FDYFHKKQSGGQGQYGRVIGVLEP
EFGM_NEMVE            HLDVYTERMRLEYNCPVICGKPKVAFRETIGKEAS-LDFRPKSRVAAAGQYGKVVGKIEP
F6UKC4_CIOIN          HLEIYAQRMNNEYGLNVSLGKPKVAFREAITSKVL-FDYTHKRQSGGAGQFGRLVGYIEP
EFGM_CAEBR            HLEIYAQRMKSEYNCPVELGKPSVAYRECLGAPYK-FHFRHKKQTGGQGQFGEIEGVIDP
EFGM_CAEEL            HLEIYAQRMKSEYNCPVELGKPTVAYRECLGSPYK-FHFRHKKQTGGQGQFGEIEGVIDP
A0DGW7_PARTE          HLQIYAERMRREFEIDVHLGQPTVNYRETITQKQQ-FDYLHKKQTGGAGQYAKVIGYMEP
A0C9U4_PARTE          HLQIYAERMRREFEIDVQLGQPTVNYRETITQKQQ-FDYLHKKQTGGAGQYAKVIGYMEP
Q22AK9_TETTS          HLQIYAERMRREFDVDVILGNPTVNYRETITQKAH-FDYLHKKQSGGAGQFARVIGFVEP
EFG1_ANADE            HLEILVDRMFREFKVEANVGKPQVAYRETITRTVE-AEGRYIRQTGGRGQYGHCWLRLHP
EFG2_MYXXD            HLEIIVDRLLREFKVDANIGKPQVAYRETVTTQVE-MEGKYIRQTGGRGQYGHIWLRVAP
EFG_KORVE             HLEILVDRMMREFHVQANVGKPQVAYRETIRKEAQ-AEGKYIRQTGGSGQYGHCKIRVGP
EFG_SOLUE             HLEIIVDRMMREFGVGANVGKPQVAYRETIRKNSE-AEGRHVKQTGGHGQYGHVKIRVEP
EFG2_GEOSL            HLEIIVDRLMREFKVEANVGKPQVAYRETVTKKVK-VEGKFVRQSGGRGQYGHVWIELEP
EFG2_PELCD            HLEIIIDRLQREFKVDANVGAPQVAYRETITKAVE-VQGKFVRQSGGRGQYGDCWLKLEP
EFG_MAGMM             HLEIIVDRMMREFKVDANVGQPQVAYRETITQMVE-HESKFVRQSGGRGQFGHVWLRLEP
EFG_CHLAA             HLEVILDRMRREYKVEANQGKPQVSYRETITIPVD-QETRFVRQTGGKGQYGHVKIKFEP
EFG_HERA2             HLEVIVDRMMREFKVEANVGKPQVAYRESITRSVD-IDSKFVRQSGGKGQYGHVKVKFEP
EFG_DEHM1             HLDVLVSRLLSEFKVNASVGKPRVAYREAITAHAK-AQGKFVRQSGGRGQYGDVTIEVEP
EFG_GLOVI             HLEILVDRMLREFKVEANVGAPQVAYRETIRKAVNNVEGLYKRQTGGKGQYGHVVINLEP
EFG2_SYNY3            HLEILVDRMLREFKVEANVGAPQVAYRETIRKAVQ-AEGKFIRQSGGKGQYGHVVIEVEP
EFG_DEIRA             HLEILVDRLKREYKVEANVGAPQVAYRETITKQVE-VDSKFARQSGGRGQYGHVKLRVEP
EFG_ENTFA             HLDVLVDRMKREFKVEANVGAPQVSYRETFRAATK-AEGKFVRQSGGKGQYGHVWVEFTP
EFG_OENOB             HLDIMVDRMRREFNVDVNVGTPQVAYREAFTKTVQ-AQGKYIRQSGGKGQYGDVWIEFSP
EFG_MESFL             HLDIIVDRMRREFKVETNVGAPQVSYRETIKLPAK-AEGKYVKQSGGRGSYGHVVIEFEP
EFG_MYCPN             HLDILVDRMRREFKVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEP
EFG_MYCA5             HLDIIVDRLKREFKVAANVGAPQVSYRETITKSAE-VEGIHKKQSGGKGQYGHVWIKYEP
EFG_CLOAB             HLEIIVDRLQREFKVECNVGKPQVAYKETIRKPVK-AEGKFVRQSGGRGQYGHAVIEMTP
EFG_LACP7             HLEIIVDRLLREFKVEANVGAPQVAYKEGFTKEVD-IDSKYAKQSGGRGQYGHCKVKFSP
EFG_FINM2             HLEIIVDRLLREFKVEANIGNPQVAYRESITQAAE-AQGKYVKQSGGRGQYGDCTLRVEP
EFG_MOOTA             HLEIIVDRLLREFKVGAKVGRPQVAYKETIRRPVK-AEGKFIRQTGGHGQYGHVIIEIEP
EFG_ECOLI             HLDIIVDRMKREFNVEANVGKPQVAYRETIRQKVTDVEGKHAKQSGGRGQYGHVVIDMYP
EFG_WIGBR             HLEILIDRMYREFNVRSNVGKPQVSYRETIKSCVEE-EGKFIRQSGGRGQFGHVWLRIEP
EFG_HYDCU             HLDIIVDRMKREFNVEANIGAPQVSYRETIKKSVEA-DGKFVRQSGGRGQYGHVVFKISP
EFG_FUSNN             HLEIIVDRMKREFKVESNVGKPQVAYRETITQSCDQ-EVKYAKQSGGRGQYGHVKIILEP
EFG_SULSY             HLEIIIDRMKREHKLEVNVGKPQVAYKETIKKKATA-EGKFIRQSGGRGQYGHVWIDIEP
EFG_PARUW             HLEILHDRMKREFNVEANVGKPQVAYKETITIPGS-SQTKFVKQSGGRGQYAHVELEIRP
EFG_ENDTX             HLEILVDRMKREFNVQANVGRPQVAYRETIRKVQE-AESKYIRQTGGRGQYGHVVLTVEP
EFG_CUTAK             HLDVFIDRMKREFHVEANIGKPQVAYRETLRKPVEKYEYTHKKQTGGSGQFARVIIAIEP
EFG1_STRCO            HLEVLVDRMRREFKVEANVGKPQVAYRETIRKTVERVDYTHKKQTGGTGQFAKVQIAIEP
EFG_BIFAA             QLDIIVDRMRREFKVECNVGNPQVAYRETIRKAVMNQEYTHKKQTGGSGQFAKVLMNFEP
EFG_DESAG             HLDIIVDRLTREFSVNANVGKPQVAYRETISKET-KVDHKYAKQSGGRGQYGHVVIEVEP
EFG_PARD8             HLDIIIDRLRREFKVECNQGRPQVTYKEAITQPV-ELREVYKKQSGGRGKFADIIVRMEP
EFG_SULMW             HLEIILDRMEREFKVKVNKGNPQVEYKEALTNSI-EHREIYKKQTGGRGKYADILFKLEP
EFG_SALRD             HLEIIIDRLKQEFKVEANVGQPQVAYREALTDMI-DEHYVLKKQSGGRGQFAEVYMDVGP
EFG_CHLT3             HLEIIVDRLKREFKVDANVGKPQVSYKETIRKKV-EAEGKFVRQSGGKGQFGLVNIIVEP
EFG_GLUOX             HLDIIVDRLRREYGVDANIGAPQVAYRETITKPHV-ETYTHKKQSGGSGQFAEVKIEFAP
EFG2_HAHCH            HLEIVVDRLQTDFDIAVTVGRPQVAYRETITQSAA-VDYVYKKQKGGPGQFAEVRMRFEP
EFG1_METCA            HLDIKVDILKRTHGVEVNVGKPQVAYRETITRRVE-DEYVHKKQTGGSGQYAKINYVIEP
EFG1_SYNY3            HLDIKMDILKRTHGVEVEMGKPQVAYRESITQQVS-DTYVHKKQSGGSGQYAKIDYIVEP
EFG_HYPNA             HLDILIDRLRREFKVEANIGQPQVAYREKIGRAAD-IDYTHKKQSGGTGQFARIKLTFEP
EFG_RHORT             HLEILVDRMKREFKVECSVGAPQVAYRETISKVFT-VDYVHKKQSGGSGQFAKVSITFSP
EFG_NEOSM             HLEIILDRLKREFNVNVNVGDPQVAYRETITQSYE-IDYTHKKQTGGAGQFARVKMLFEP
EFG_PSELT             HLEIVTDRLKREFGVNVRVGRPQVSYRETIRQTGT-AEGKYVRQTGGRGQYGHVIMKFEP
EFG_THEMA             HLEIVVDRLKREFGVNVRVGQPQVAYRETIKKSAE-AEGKYIRQTGGRGQYGHVILRIEP
EFG_PETMO             HLEIIIDRIKREYKVNVKVGQPRVAYKETIKLPSE-AEGKYIRQTGGRGQYGHVKLRVEP
EFG1_SYNWW            HLEIVAERLAREFKLDFNTGQPQVAYRETIGKSAE-QVTRYVKQTGGKGQFAHVVLRLEP
EFG2_SYNWW            HLEIIIDRLLKEFKVNANIGKPQVAYKESVKKRTA-AEVKFDRQAGGRGQYAHVVLEVLP
EFG1_BDEBA            HLEILVDRLLREHKIQANVGKPQVSYRETITVAAK-AEHVYEREIAGETHFAKVSLSIEP
EFG2_DESPS            HLEIIVYRLLNEFKVAARVGTPQVSYKESIQRSHS-AEGLFEQPTGSSNQFAKVVLEIEP
EFG1_GEOSL            HLEVVVDRLQREFGVGVKTGRPQVVYRETITRAVER-REIFRAEHEGKVQGGEVLLQLSP
EFG1_PELCD            HLEIITDRLHREFGVEVRTGRPQVVYRETVQNSARH-HERFHRETEGRIQSGEVTLEIAP
EFG2_SYNAS            HLEVVIDRLGREFNAHVNVGKPRVVHRETIRNKVDV-EGHFERELGDKKHFGHVRLVLEP
EFG3_MYXXD            HLEVVVDRLRTEHGVEARVGQPKVAWRDTLRRQVRQ-EYRHVRQSGGPGQYAYVVLDVGP
EFG2_STRCO            HLEVAVERVRREYGLEVTVGRPGVAYRETVGEGVTGFVHRHVKQDGGAGQFAHIVLDVEP
EFG2_BORBU            HLEIILTRIKDEFNLNVYTGKPQVSYRESAGKIVK-EVFEFNNIFAGKNIDFKIGMIIKP
EFG2_BORAP            HLEIILTRIKDEFNLNVYTGKPQVSYRESAGKIVK-EVFEFNNIFAGKNINFKIGMIIKP
EFG2_BORBP            HLEIILTRIKDEFNLNVYTGKPQVSYRESAGKIVK-EVFEFNNIFAGKNIDFKIGMIIKP
EFG1_TREDE            HIDVLTRRMLDDFKVEARVGNPQVTYRESITTEKT-QTEKYSKQLGGKDNEAELTLTVRP
EFG2_TREPA            HLDVLTTRMREDFNVQVRVGKPHVTYRESIRKTVE-RTLRVQRVIGGKEYMAGLTLRVEA
EFG_CARRP             HLEIIIDRINNEFNIKTKTSKPQVSYKESIKKTII-QEGKYIKQTGGRGQYGHVVLKIEP
EFG_RHOBA             HLEIYIERIRREYGVEIEVGAPKVSYRESPTREVE-FNYKHKKQTGGSGQYAHIVGKLIP
K2LYN2_TRYCR          HLDIYVERLKREHGLEVELGKPTVNYREIITERKE-FDFVFKRQSGGAGQWAQLKGYIDV
Q38BA0_TRYB2          HLDIYIERLKREYDLEVVLGKPTVNYREVITERKE-FDFVYKRQSGGAGQWAQLKGFIDV
A4ICS8_LEIIN          HLDIYVERLKREYGLHVELGKPTVNYREIITERQD-FDFVFKRQSGGAGQWAHLKGFVEP
Q4Q219_LEIMA          HLDIYVERLKREYGLHVELGKPTVNYREIITERQE-FDFVFKRQSGGAGQWAHLKGYAEP
A4HNR7_LEIBR          HLDIYVERLKREYGLQVELGKPTVNYREIITKRQE-FDFVFKRQSGGAGQWAHLKGYVEP
Q7RFK0_PLAYO          QLEIYKERLKREFNINVNLKNPKINFKETITKPYE-CSYTYKKQKGGAGLYAHVHAIFET
A5K8J4_PLAVS          QLEIYKERLKREYGIGVQLKNPRINFKETITKPYE-CTYTYKKQKGGAGLYAHVHAIFET
A0A1Y3DJ13_PLAKN      QLEIYKERLKREYGIGIQLKNPKINFKETITKPYE-CTYTYKKQKGGAGLYAHVHAIFET
A7AM19_BABBO          HLGIYVERMKREYNLAVETGPPIVNYRESVTRRVD-FSYTHKRQSGGAGQYGKIIGYIEP
Q4MYM5_THEPA          HLNIYLERMKREYGLTIEVGEPIVNYRETITRRAE-FNYTHKRQSGGVGQYAKVIGYIEP
                      :: :    :   .        * :  ::                                

EFG2_ANADE            CE------------Q-QFEFVDDVV-------GGAIPREFISAVEKGFRS-MLAKGRLLG
EFG1_DESPS            LD------------EGDYEFVDKIV-------GGAIPREFISSCDKGFQK-SLVKGHLCG
EFG1_BORBU            LDK----------EGETYEFVNLIK-------GGVIPTEYIPSCDKGFQK-AMERGTLIG
EFG1_BORBP            LNK----------EGETYEFVNLIK-------GGVIPTEYIPSCDKGFQK-AMEKGTLIG
EFG2_TREDE            C------------TEQDYEFDNQIK-------GGAIPSEFIPSCDKGFKE-AIKRGTLIG
EFG1_TREPA            I------------AGQDYEFVDQIK-------GGVIPNEFIPSCDKGFRT-AVKKGTLIG
EFG1_SYNAS            LS------------DEDFLFENKIT-------GGAIPTQFIPACEKGFRM-SMAKGPKME
EFG2_BDEBA            LPPQ--------EDGAVFKFENKVV-------GGRIPKEFIPAVEEGFKE-QTVKGPLIG
EFG1_MYXXD            LPS---------DAVQQYEFVDDIV-------GGSIPREFIPACDKGFTE-AVKKGSLIG
EFGM_DICDI            S-------ENGME----NEFVNDVI-------GTAIPPTFIEAIKKGFKD-CIEKGPLIG
D3BMN4_POLPP          TG------PEGPD----LEFVNDVI-------GTAITPNFIEAIKKGFNE-AVHNGPLIG
EFGM_CRYNJ            ME-----TDPDTG--KDTAFENRII-------GGNIPNQFIPAIQKGFQE-ALDRGLITG
EFGM_USTMA            ME-----VDPETG--VDTAFDNRVV-------GGSIPNGYISACEKGFYD-ALEKGALSG
EFGM_COPC7            ME-----MDPETG--KDVAFENLVM-------GGNIPTNFIPAVEKGFYE-ALEKGSLTG
EFGM_SCHPO            MDG----VEDESGNVVDCEFINKVT-------GGTVPTQYIPACEKAFYE-ALKKGFLIG
F4NY64_BATDJ          LA------EEDTG-----EFENRTV-------GMNIPYQYIPAIEKGFYE-ACEKGSLVG
D0NCX8_PHYIT          LTDEEVEELDNAGNTSGVVFENAIV-------GNAIPPEYITACEKGVND-AIQKGWLIG
EFGM1_ARATH           LP---------PGSKEKFEFENMIV-------GQAIPSGFIPAIEKGFKE-AANSGSLIG
EFGM2_ARATH           LP---------PGSKEKFEFENMIV-------GQAIPSGFIPAIEKGFKE-AANSGSLIG
D7SLS6_VITVI          LP---------EGSTTKFEFENMIV-------GQAVPSNFIPAIEKGFKE-AANSGSLIG
M1CGG0_SOLTU          LE---------PGSGSKFEFENMLV-------GQTVPSNYVPAIEKGFRE-AANSGSLIG
EFGM_ORYSJ            LP---------SESDGKFEFDNMII-------GQAIPSNFIPAIEKGFKE-ACNSGSLIG
I1GYK4_BRADI          LP---------SGSDGKFEFDNMII-------GQAIPSNFIPAIEKGFKE-ACNSGSLIG
C5WSZ1_SORBI          LP---------SGSDGKFEFDNMII-------GQAIPSNFIPAIEKGFRE-ACNSGSLIG
A9RPB9_PHYPA          LP---------EGSEKKFEFENMMV-------GQAVPSQFIAAIEKGFIE-ASNSGALIG
A9SP22_PHYPA          LP---------EGSEKKFEFENMMV-------GQAVPSQFIAAIEKGFIE-ASNSGALIG
EFGM_COCIM            TGNLDG-----------NNFEEQIT-------GGSISEKFLFACEKGFGL-ACDKGPLIG
C0NUK7_AJECG          TGSLEQ-----------NRFEQRIV-------GGAISEKYIYACEKGFNL-ACEKGPLTG
EFGM_EMENI            TGKLEE-----------NQFEEQIV-------GGSISEKFIFACEKGFHL-SCEKGPLIG
EFGM_ASPFU            TGKLED-----------NKFEEQIV-------GGSISEKFLFACEKGFNL-ACEKGPLIG
EFGM_SCLS1            IEAGPNGY-------APSTFKEEVT-------GGSISDKFLFACEKGFLA-SCEKGPLLG
C7YWN8_FUSV7          N-DKPDE----------NHYESQVV-------GGHIPDKFLSACSKGFDV-ACEKGPLLG
I1RCR5_GIBZE          N-DEPDK----------NHYESQVV-------GGNIPDKFLSACAKGFDA-VCEKGPLLG
EFGM_NEUCR            NPNGGED----------NHFESRVV-------GGTIPDKYISACQKGFQE-ACIKGPLLG
EFGM_ASHGO            VANSSE-----------NTFTTAVV-------GGRIPDKYLAACAKGFEE-VCEKGPLIG
EFGM_YEAST            VDDITKG----------NIFETAIV-------GGRIPDKYLAACGKGFEE-VCEKGPLIG
EFGM_CANAL            IESENK-------------FETQII-------GGKIPEKFLFACSKGFED-CLEKGPLIG
EFGM_YARLI            VTDMNAVNEGKATFAAENIFKSEIV-------GGKIPEKFILACDRSFHE-TAEKGPLTG
G3QKQ5_GORGO          LDP---------EDYTKLEFSDETF-------GSNIPKQFVPAVEKGFLD-ACEKGPLSG
A0A2I3T1A0_PANTR      LDP---------EDYTKLEFSDETF-------GSNIPKQFVPAVEKGFLD-ACEKGPLSG
EFGM_HUMAN            LDP---------EDYTKLEFSDETF-------GSNIPKQFVPAVEKGFLD-ACEKGPLSG
G1QVZ1_NOMLE          LDP---------EDYTKLEFSDETF-------GSNIPKPFVPAVEKGFLD-ACEKGPLSG
EFGM_PONAB            LDP---------EDYTKLEFSDETF-------GSNIPKQFVPAVEKGFLD-ACEKGPLSG
F6QKI2_CALJA          LDP---------EDYTKLEFSDETF-------GANVPKQFVPAVEKGFLD-ACEKGPLSG
H0UVN5_CAVPO          LDP---------ENYTKLEFTDDTF-------GTNVPKQFIPAVEKGFLD-ACEKGPLSG
G1T5N5_RABIT          LDP---------ENYTKLEFSDETF-------GANVPKQFVPAVEKGFLD-ACEKGPLSG
G1M4M7_AILME          LDP---------ENYTKLEFSDETF-------GSNVPKQFVPAVEKGFLD-ACEKGPLSG
M3WIL3_FELCA          LDP---------ENYTKLEFSDETF-------GANIPKQFVPAVEKGFLD-ACEKGPLSG
G1NTB9_MYOLU          LEP---------ENYTKLEFSDETF-------GSNIPKQFVPAVEKGFLD-ACEKGPLSG
H0WY66_OTOGA          LDP---------ENYTKLEFADETF-------GSNVPKQFVPAVEKGFLG-ACEKGPLSG
EFGM_MOUSE            LPP---------EDYTKLEFSDETF-------GSNVPKQFVPAVEKGFLD-ACEKGPLSG
EFGM_RAT              LAP---------EDYTKLEFSDETF-------GANVPKQFVPAVEKGFLD-ACEKGPLSG
F7EHU0_MONDO          LEP---------EAYTKLEFLDKTY-------GTNIPKQFIPAIEKGFLD-ACEKGPLSG
G1KFW0_ANOCA          LEP---------ENYTKLEFEDRTV-------GTNIPKQFVPAIEKGFRD-ACEKGPLTG
F6Q9W5_XENTR          LEA---------ENYTKLEFEDKTV-------GTNVPKQFVPAVERGFRE-ACEKGPLTG
H3AWE2_LATCH          MDT---------ESYTKLEFEDRTV-------GTNIPKQFVPAVEKGFLE-ACEKGPLTG
H3CQL2_TETNG          LES---------EHYTKLEFEDQTI-------GTNVPKQFIPAVEKGFME-ACEKGPLCG
I3J7A5_ORENI          LES---------DHYTKLEFEDQTV-------GTNVPKQFVPAVEKGFRD-ACEKGPLSG
G3P617_GASAC          LEP---------EHHTKLEFEDQTV-------GTNVPKQFVPAVEKGFRE-ACEKGPLSG
EFGM_DANRE            LDS---------ENYTKVEFSDETV-------GTNIPKQFVPAVEKGFRD-ACEKGPLIG
C3ZDC2_BRAFL          LPP---------SSYTKLEFSDETV-------GTNVPKQYVPSVERGFRM-ACEKGLLSG
EFGM_ANOGA            LPP---------HQNTTIEFVDETM-------GTNVPKQFIPGIEKGFRQ-MAEKGLLSG
W5JI53_ANODA          LPP---------TQNTVIEFADETM-------GTNVPKQFIPGIEKGFKQ-MAERGLLSG
EFGM_AEDAE            LPP---------HQNTTIEFTDETV-------GTNVPKQFVPGIEKGFRQ-MAEKGLLSG
EFGM_DROME            LPP---------NQNTLLEFVDETV-------GTNVPKQFVPGVEKGYRE-MAEKGMLSG
EFGM_DROPS            LPP---------NQNTLLEFVDETV-------GTNVPKQFVPGVEKGYRE-MAERGMLSG
E9G149_DAPPU          LPA---------TENTKVEFVDETM-------GTNVPKTFIPAIEKGFRM-MVDKGLLSG
A0A087ZTR9_APIME      LPT---------EKNTELIFLDKTI-------GTNVPKQFVPGVERGFRT-MCEKGYLSG
E0VF81_PEDHC          T-----------EENTALEFVDEIV-------GSNLPRNYIPAIKKAYLE-MCEKGSPKG
EFGM_NEMVE            MPP---------ESITKNEFVDATV-------GMNIPKNFIPAIEKGFYE-ACERGFITG
F6UKC4_CIOIN          LPE---------ERNTELEFLDKTV-------GTNVPRNYMSAIKKGFLEDSCEKGPLVG
EFGM_CAEBR            LPA---------DRNTVVEFSDETF-------GNNIPKNLFPALKKGLDA-IVAEGPLIK
EFGM_CAEEL            LPS---------DRNTVVEFSDETF-------GNNIPKNLFPALKKGLDA-IVAEGPLIK
A0DGW7_PARTE          LQLEEG--------QFSNQFENHVI-------GTSIPNEYITAVEKGFYE-SVDKGPLTG
A0C9U4_PARTE          LQLEEG--------QFSNQFENHVI-------GTSIPNEYITAVEKGFYE-SVDKGPLTG
Q22AK9_TETTS          MVNPEDP------QDFSCQFVNKVI-------GTNVPNEYVTACEKSFYD-VIDKGPQTG
EFG1_ANADE            -----------QEPGKGFEFENAIV-------GGVIPKEFISPIQKGIEE-AMTSGVLAG
EFG2_MYXXD            -----------NEPGKGFSFENKVT-------GGVVSKEFVDAVKAGCAE-AMQNGPVAG
EFG_KORVE             -----------NEPGKGYEFINDIV-------GGTIPKEFIKPIDQGIKE-ALEGGVLAG
EFG_SOLUE             -----------LPSGTGFEFVNDVT-------GGRIPKEYINPTEMGIKE-ALEGGILAG
EFG2_GEOSL            -----------QEAGKGYEFVDAIK-------GGVVPREYIPAVDKGIQE-AMETGVLAG
EFG2_PELCD            -----------QEPGAGYEFVDAIK-------GGVIPREYIPAVGKGAEE-AAENGVVAG
EFG_MAGMM             -----------NEPGAGYEFVDGIK-------GGVVPKEYIPAVKNGVGE-AMANGVYVG
EFG_CHLAA             -----------LPPGSGFEFVNAIV-------GGVIPKEYIPAVEQGLRE-AMQTGVIAG
EFG_HERA2             -----------SGEGEGYIFVNGIV-------GGVVPREYVPAVEAGIRE-AMETGVIAG
EFG_DEHM1             -----------RERGAGYEFVDNVK-------GGAVPRNFLMAAEAGIRE-TLETGVYAG
EFG_GLOVI             -----------GEPGTGFEFVSKIV-------GGVVPKEYIGPAEQGMKE-RCESGVIAG
EFG2_SYNY3            -----------TEPGTGFEFVSKIV-------GGVIPKEYIAPSEQGMKE-ACASGVLAG
EFG_DEIRA             -----------LEPGAGFIFENAVV-------GGTVPKEYIGPAQKGVEE-AMQSGPMLG
EFG_ENTFA             -----------NEEGKGFEFENAIV-------GGVVPREYIPAVEKGLED-SMNNGVLAG
EFG_OENOB             -----------NDEGKGFEFDNAIV-------GGAVPREYIPAVEQGLKE-AMQSGPLAG
EFG_MESFL             -----------NVD-KGFEWVDKIT-------GGRVSKEYINAARVGLEN-ALTNGVVAG
EFG_MYCPN             -----------NKD-KGFEFVDKIV-------GGRIPREYIKPVQAGLEN-AMASGPLAG
EFG_MYCA5             -----------NPD-KGFEFVDKIV-------GGKIPKEYIKSIEKGLKE-KMEIGILAG
EFG_CLOAB             TEG--------E-----YEFENAIV-------GGAVPKEYIQPIDNGIQE-ASLSGIIAG
EFG_LACP7             MDV--------NGE-KVFEFVSTVV-------GGAIPKEYIPAVQAGIED-AMKCGVLGG
EFG_FINM2             LDN--------PEESNGIEFVNAIV-------GGAIPKEYIPSVQAGAEE-AAQTGILGG
EFG_MOOTA             QEP--------GKG---YEFVNKIV-------GGVIPKEYIPAVDAGIQE-AMANGVLAG
EFG_ECOLI             LEP--------GSNPKGYEFINDIK-------GGVIPGEYIPAVDKGIQE-QLKAGPLAG
EFG_WIGBR             NKSNI------AKNKNNYTFINKIV-------GGAIPKEFIPAIDKGIQE-QLSNGVLAG
EFG_HYDCU             REA-----------GSGFEFINSIV-------GGAVPREYIGAVEKGAQQ-QLENGVIAG
EFG_FUSNN             NPG------------KEFEFVNKIT-------GGVIPREYIPAVEKGCKE-ALESGVIAG
EFG_SULSY             NQE------------KEYEFVDKIV-------GGVIPKEFIPAVDEGIRE-AMNQGVVAG
EFG_PARUW             -----------NEKGKGNEVVSKIV-------GGVIPREYIAPTIKGIEE-GLSTGVLAG
EFG_ENDTX             -----------QDPGKGYEFVNKIV-------GGVIPREYIPAIDKGIKE-AMTSGTLAG
EFG_CUTAK             K---E------PG--FGYEFVNAVT-------GGRIPKEYIPSVDAGVQE-SMQFGVLAG
EFG1_STRCO            I---E------GGD-ASYEFVNKVT-------GGRIPKEYIPSVDAGAQE-AMQFGILAG
EFG_BIFAA             L---D------TENGETYEFVNEVT-------GGHITKEFIPSIDAGVQE-AMESGILAG
EFG_DESAG             N---P------EK---GYLFENKIT-------GGVIPKEYIPAVDKGIQD-ALKSGVLAG
EFG_PARD8             A---D------ESFEGTLQFIDEVK-------GGNIPKEFIPSVQKGFEK-AMKNGVLAG
EFG_SULMW             G---K------KGAQG-LEFINKVK-------GGNIPKEYIPSIEKAFKE-AMKNGPLYG
EFG_SALRD             IPE-E------EEEESGLVFENEIK-------GGVIPKEFIPSVERGIES-AMEDGPLAG
EFG_CHLT3             S-----------EKDKGFEFVNEIK-------GGSIPKEYIPAVSQGIQE-AMRNGIVAG
EFG_GLUOX             -----------SEKPDEIIFENKVV-------GGTVPKEYIPAVEKGIRM-QSTTGVLAG
EFG2_HAHCH            -----------IAG-DGIEFESQIV-------GAAIPREYIPAVEDGVRQ-AARSGVLGG
EFG1_METCA            -----------GEPGSGFVFESTVT-------GGNVPREFWPAVEKGFRS-MLGKGVLAG
EFG1_SYNY3            -----------GEPGSGFQFESKVT-------GGNVPREYWPAVQKGFDQ-SVVKGVLAG
EFG_HYPNA             -----------LEAGSGFQFVSAIV-------GGAVPKEYIPGVQKGLEM-AKENGLLAG
EFG_RHORT             -----------LPPGSGYQFESKIV-------GGSVPKEYIPGVEKGLKS-AIDTGVIAG
EFG_NEOSM             -----------YDDGE-FLFESKIT-------GGAIPKEYIPGVEKGLVS-VKNKGLLAN
EFG_PSELT             LP---------LDGEKQFEFINKTV-------GGVIPREYIPAIEEGVKE-AMEMGVLAG
EFG_THEMA             IP---------EEEGKNFEFIDKTV-------GGVIPKEFMPAIEAGIKE-AMMAGPLAG
EFG_PETMO             LP---------LNSEKEFEFVDKIV-------GGVIPREYIPAIENGVKE-SMQDGVLLG
EFG1_SYNWW            --------------GEGFEFINRIS-------QGSIPREYIPAVESGIKQ-ALEEGVLKG
EFG2_SYNWW            L-----------AEGQGKRFADKSS-------PEAIPREFIPAVEMGVRE-ALQAGILGG
EFG1_BDEBA            -----------ISQADGIQFISKVAV------SKEFTAPMLKAAESGFRE-AAEVGPLAS
EFG2_DESPS            -----------LERGAGIEFVCEVD-------EKQIPAEFLGAVERGVVD-SLDSGPLVG
EFG1_GEOSL            LPRGA-----------GVRVNVPDAA------ELGIGKELRDAVADSIGR-ACSAGARTG
EFG1_PELCD            SGRGK-----------GLRIVLPED-------ENPLPARLREELKKCLHQ-SCAAGIRTG
EFG2_SYNAS            KERGS-----------GVEIEWKAD-------TAILPAEYVKAVEEGIQE-SLVSGAVAG
EFG3_MYXXD            APRGA------------GLVFTDDTR------GGTIPKELVPAIEKGVAG-AMARGVRDG
EFG2_STRCO            WEQDAD-----GDGAGGGFVFRSTVV------GGRVPQEYVRAVEAGCRD-ALAEGPLGG
EFG2_BORBU            LSR--G-----AGNKIDFECGIEPV--------------IKSAILRGITS-AFVSGI-FG
EFG2_BORAP            LSR--G-----EGNKIDFECSIDST--------------IKSAILRGITT-TFVSGA-FG
EFG2_BORBP            LPR--G-----EGNKIDFECDINPT--------------IKSAIFRGITT-AFVSGV-FG
EFG1_TREDE            LER--G-----SGN--RFVSKVKTFQKSGSGGTNALPEDLLEAVKRSIEG-CFSSGIKVG
EFG2_TREPA            RKR--G-----AGN--EFFCQVKELRGTVCT-AHTAPAEIIGAVEHAIRG-AWDGGIQSG
EFG_CARRP             ILI--E-----KDD---FIFKIEVVGG-------VIPKEYFLSIEKGILE-QIKCGVVLG
EFG_RHOBA             IE---------SESEDSFEFEEKVV-------GGRIPKQYIPAVEKGFRD-ILGKGPIAD
K2LYN2_TRYCR          FPIDMS-----VEKGVKNKVTVSCSN------GDVRESLQKSVIKQLERK-IFVKGELMG
Q38BA0_TRYB2          LPIDMS-----VEKGVKNKVTVKCSN------GDVREALQKSVVKQLERK-IFVKGELMG
A4ICS8_LEIIN          LPIDMS-----VEKGVKNKATTRCSN------GDIRESLQKTVVKHLERK-IFVKGELMH
Q4Q219_LEIMA          LPIDMS-----VEKGVKNKATTRCSN------GDIRESLQKTVVKHLERK-IFVKGELMH
A4HNR7_LEIBR          LPIDMS-----VEKGVKNKATTRCSN------GDIRESLQKTVVKQLERK-IFVKGELMH
Q7RFK0_PLAYO          VSE-------NYNDTPHCQFVNEVI-------GNDLPKNFIQSIEKAFKE-QIEKGYLNK
A5K8J4_PLAVS          VSD-------DYNETSYCSFVNEVV-------GNDLPKNFILSIEKAFKE-QVEKGYLNS
A0A1Y3DJ13_PLAKN      VSD-------DYNETSYCTFVNEVV-------GNDLPKNFILSIEKAFKE-QVEKGYLNS
A7AM19_BABBO          IGD-------DANQHLQVEFVNNLV-------GNDVPPNYVPHIESGFRE-CCTKGLLCG
Q4MYM5_THEPA          IAD-------NPNQHLNIQFINQFI-------GNEIKPNYIVSIENGFKE-SCRRGLLCG
                                                                             *    

EFG2_ANADE            FPVVNTRVVINDGASHAVDSSDIAFQEAARGAWREGFD--RAKPRLLEPIMRVVCEGPAE
EFG1_DESPS            AGITGVRCVINDGSFHAVDSSDVAFQIASVGAFKDGYM--KAKPVIMEPIMKVSVEGPSE
EFG1_BORBU            FPIVDIKITINDGQYHIVDSSDIAFQLAAIGAFREAYE--KAKPTILEPIMKVTLEGPTE
EFG1_BORBP            FPIVDIKITINDGQYHIVDSSDIAFQLAAIGAFREAYE--KAKPTILEPIMKVTLEGPTE
EFG2_TREDE            FPIVGTKVTINDGQSHPVDSSDMAFQAAAIGAFREAYK--AAKPAILEPIMKVSIEGPQE
EFG1_TREPA            FPIVGVRVTINDGQSHPVDSSDMAFQAAAIGAFREAYN--GAKPVVLEPIMRVSVEGPQE
EFG1_SYNAS            FPVTGVKVVIDDGAFHAVDSSDMAFQAAARGAFREAYN--KAKPVILEPIMKVVVETPNE
EFG2_BDEBA            FPIVGVEVVLEDGAYHDVDSSYMAFKIAGMAALREVYA--SAKPTVLEPIMKLETTVPDE
EFG1_MYXXD            FPVVGVRVVINDGAFHAVDSSEMAFKTAAIMGFREGYA--AAKPIILEPMMKVEVQAPED
EFGM_DICDI            HPVVGVKFVVSDGNTHSVDSSELAFRIATAGAFKEAFE--DGEPTILEPIMKVEISLPQE
D3BMN4_POLPP          HPISGVRFVVNDGATHSVDSSELAFRICAVNAFKEGFK--VADPMILEPIMKVEILTPIE
EFGM_CRYNJ            HPITGCKFVLDDGSAHAVDSNELAFRLAAIGAFREAFN--KARPVVLEPVMTVEIVAPIE
EFGM_USTMA            HAVTGVRFVLEDGAAHSVDSSELAFRLATAGAFREAYQ--KANPVILEPKMTVEVVAPIE
EFGM_COPC7            NPITGVRFVLKDGAFHAVDSSELAFRLATIGAFREAFK--KARGIVLEPVMTVDVVAPSE
EFGM_SCHPO            HPIKNCRFVLEDGAYHPVDSSELAFRLATISAFRTAFL--QANPMVLEPIMNVSITAPVE
F4NY64_BATDJ          HNVTGVRFVLEDGQAHLVDSSELAFRLATMYAFRESIK--QAKAIVLEPIMEVSLVAPAE
D0NCX8_PHYIT          HPVQRMRVVVNDGQSHSVDSSELAFRTAMVLAIRQAFL--KADPCILEPVMAVEVEVPNE
EFGM1_ARATH           HPVENLRIVLTDGASHAVDSSELAFKMAAIYAFRLCYT--AARPVILEPVMLVELKVPTE
EFGM2_ARATH           HPVENLRIVLTDGASHAVDSSELAFKMAAIYAFRLCYT--AARPVILEPVMLVELKVPTE
D7SLS6_VITVI          HPVENIRIVLTDGAAHAVDSSELAFKLAAIYAFRQCYT--AAKPVILEPVMLVELKAPTE
M1CGG0_SOLTU          HPVENIRVVLTDGASHNVDSSELAFKLASIYAFRQCYT--AAKPIILEPVMLVDIKVPTE
EFGM_ORYSJ            HPVENIRIVLTDGASHAVDSSELAFKLASIYAFRQCYA--AARPVILEPVMKVELKVPTE
I1GYK4_BRADI          HPVENIRITLTDGASHAVDSSELAFKLAAIYAFRQCYT--AAKPVILEPVMKVELKVPTE
C5WSZ1_SORBI          HPVENLRIVLTDGASHQVDSSELAFKLAAIYAFRQCYT--SAKPVILEPVMKVELKFPTE
A9RPB9_PHYPA          HPVENLRVVLTDGASHAVDSSELAFKLAALYAFRQCYA--AAKPVILEPVMLVELRAPVE
A9SP22_PHYPA          HPVENLRVVLTDGASHAVDSSELAFKLAALYAFRQCYA--AARPVILEPVMLVELRAPVE
EFGM_COCIM            HKVLGTRMVINDGATHMTDSSEMSFKNATQQAFRKAFM--DSQPHILEPLMKTVITAPSE
C0NUK7_AJECG          HKVLGTQMIIVDGSTHVTDSSEMAFKIATQQAFRKAFK--NSKPQVLEPMMKTVITAPVE
EFGM_EMENI            HKVLGTKMVINDGATHMTDSSEMAFKNATQQAFRKAFQ--EGNPAVLEPMMKTVVTAPAE
EFGM_ASPFU            HKVLGTKMVINDGATHMTDSSEMSFKNATQQAFRKAFM--ESNPSVLEPMMKIAVTAPGE
EFGM_SCLS1            HPVLGTHMVVNDGATHMTDSSEMAFKNATQQAFRKAFK--EGKPQVLEPLMKTTITAPNE
C7YWN8_FUSV7          HKVIGAKMIVNDGATHVTDSSDYAFNLATQMAFRKAFT--EAGGQVLEPLMKTTITAPNE
I1RCR5_GIBZE          HKVIGAKMVVNDGATHVTDSSDHAFNLATQMAFKKSFP--EAGGQVLEPLMKTTITAPNE
EFGM_NEUCR            HKVIGSSMVITDGATHVTDSSDYAFNLAAQMAFGKAFT--AAGGQVLEPLMKTTISAPAE
EFGM_ASHGO            HKVLGINMLINDGAIHAVDSNELAFKTATTAAFVQSFM--QAQPVVLEPIMTVTVTAPNE
EFGM_YEAST            HRVLDVKMLINDGAIHAVDSNELSFKTATMSAFRDAFL--RAQPVIMEPIMNVSVTSPNE
EFGM_CANAL            HRVLGVHMLINDGQTHVVDSSELAFRTATHGAFKQAFL--NAQPVILEPIMSVEVTAPNE
EFGM_YARLI            SRVLGVEMLINDGNTHVVDSSELAFKVATQRGFYETFM--QCSPVILEPIMTVTLTAPVE
G3QKQ5_GORGO          HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMAVEVVAPNE
A0A2I3T1A0_PANTR      HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMAVEVVAPNE
EFGM_HUMAN            HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMAVEVVAPNE
G1QVZ1_NOMLE          HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMAVEVVAPNE
EFGM_PONAB            HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMAVEVVAPNE
F6QKI2_CALJA          HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMSVEVVAPNE
H0UVN5_CAVPO          HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGAVKQALS--SATLCILEPIMAVEIIAPNE
G1T5N5_RABIT          YKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--DATLCILEPIMSVEVVAPNE
G1M4M7_AILME          HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALE--NATLCILEPIMSVEVIAPNE
M3WIL3_FELCA          HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMSVEVIAPNE
G1NTB9_MYOLU          HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPIMSVEVVAPNE
H0WY66_OTOGA          HKLSGFRFVLQDGAHHMVDSNEISFVRAGEGALKQALA--NTTLCILEPIMAVEVIAPND
EFGM_MOUSE            HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--NGTLCIIEPIMSVEVIAPNE
EFGM_RAT              HKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALA--SATLCIIEPIMSVEVIAPNE
F7EHU0_MONDO          HRISGVRFVVQDGAHHMVDSNEISFIRAGEGALKQALA--NATLCILEPVMSVEVVAPNE
G1KFW0_ANOCA          HKISGIRFVLEDGASHMVDSNEISFIRAGEGALKQVME--DATVCILEPIMSVEIVAPTE
F6Q9W5_XENTR          HKISGLRFVLEDGAHHMVDSNEISFIRAGEGALKQAME--NATVCILEPIMSVEVVAPSE
H3AWE2_LATCH          HKISGVCFILEDGAHHMVDSNELSFIRAGEGAVKQAME--KVDVRILEPIMSVEVVAPVE
H3CQL2_TETNG          HKISGVRFLLEDGAHHMVDSNEISFIRAGEGALKQAME--KANTVILEPIMSVEIVAPQE
I3J7A5_ORENI          HKISGVRFLLEDGAHHMVDSNEISFIRAGEGALKQAME--KANAVILEPIMSVEVVAPQE
G3P617_GASAC          HKISGVRFILEDGANHMVDSNEISFIRAGEGALKQAME--KAHTAILEPIMSVEIVAPQE
EFGM_DANRE            HKISGVRFVLEDGAHHMVDSNEISFIRAGEGAVKQALE--KATVVILEPVMSVEIVAPNE
C3ZDC2_BRAFL          QKIAGVRFRLQDGANHAVDSSDYSFQRAAEGALKEAMD--DAVKVILEPIMSVEVTAPNE
EFGM_ANOGA            HKLSGIKFRLQDGAHHIVDSSELAFMLAAQGAIKSVFE--NGSWQILEPIMMVEVTAPEE
W5JI53_ANODA          HRLSGIKFRLQDGAHHIVDSSELAFMLAAQGAIKSVFE--NGRWQILEPIMMVEVTAPEE
EFGM_AEDAE            HKLSGIKFRLQDGAHHIVDSSELAFMLAAQGAIKSVFE--NGSWQILEPIMMVEVTAPEE
EFGM_DROME            HKLSGIRFRLQDGGHHIVDSSELAFMLAAHGAIKEVFQ--NGSWQILEPIMLVEVTAPEE
EFGM_DROPS            HRLSGIKFRLQDGGHHIVDSSELAFMLAAHGAIKEVFQ--NGSWQILEPIMMVEVTAPEE
E9G149_DAPPU          HKIAGVRFIVRDGAHHIVDSNEISFILAAQGAVKEVYE--NGFWHILEPIMSVEITAPDE
A0A087ZTR9_APIME      HKVAGVKFTLFDGMHHIVDSSEFAFFLAAEGAMKESFL--NGSWQILEPIMSVEITTPIE
E0VF81_PEDHC          YKLSGLRFRLQDGAHHIVDSSDWSFHLATEGAMRNAFD--EGIWHLLEPIMLVEVSVPSE
EFGM_NEMVE            HKVAGVRFVLEDGAAHAVDSSEMAFRMATIGAFREAFN--KAAPMILEPIMSVEVNAPQE
F6UKC4_CIOIN          ARVMGVRFVVEDGAHHMVDSSDIAFRLAAQGAAEQAYA--RSNKIIQEPIMSVEVSAPVE
EFGM_CAEBR            SRIAGIHVRIQDGATHAVDSTEIAMINTMQNMMRESFE--KASWLLLEPIMKVEVTTPAE
EFGM_CAEEL            SRIAGIHVRIQDGSTHAVDSTEIAMINTMQNMMRESFE--KANWLLLEPIMKVEATVPTE
A0DGW7_PARTE          YPVVNVRFVLEGGETHVVDSSSNAFMTATKYAFAQTFR--QAGPEILEPVMAVEIMVPAP
A0C9U4_PARTE          YPVVNVRFVLEGGETHVVDSSSNAFMTATKYAFAQTFR--QAGPEILEPVMAVEIMVPAP
Q22AK9_TETTS          YPVVNMKFVLEDGQTHVVDSSSNAFMIATKYAFNKAFN--DAGPVILEPFMNVEVTCAAA
EFG1_ANADE            YPMVDLKVELFDGSYHDVDSSEMAFKIAGSMGFKEGAA--KASPVLLEPIMAVEVTTPDD
EFG2_MYXXD            YPMVDVKVEAFDGSMHDVDSSEIAFKIAGSLAFKDAVR--MATPVLLEPIMNCEIVTPDD
EFG_KORVE             YEMVDVKVTLYDGSYHDVDSNEMAFKIAGSMAFKEAAR--KASPVLLEPVMSVEVVVPEE
EFG_SOLUE             YPMSDVKVTLYDGSYHDVDSSEMAFKIAGSMAIKEAAK--RAKPVLLEPIMAVEVVVPED
EFG2_GEOSL            YPTVDFKVALVDGSYHEVDSSEMAFKIAGSMAFKEAAA--KAGPVLLEPIMSVEVVVPEE
EFG2_PELCD            FPIVDVKVTCYDGSYHDVDSSEMAFKIAGSMGFKAGAA--KASPVLLEPVMAVEVVVPEE
EFG_MAGMM             FPMVDVKVTLFDGSYHEVDSSEMAFKIAGSMGLKEGAM--KAKPVLLEPIMDVEVETPED
EFG_CHLAA             YPVVDVKATLYDGSYHEVDSSEMAFKIAASMCLKDAVR--RGKPQLLEPIMKVETVTPEE
EFG_HERA2             YPVVDVKATLFDGSYHDVDSSEMAFKIAASMALKDGVR--KGGPQILEPIMKIEVIVPED
EFG_DEHM1             YPMVDVKVTAVDGSYHDVDSNENAFKMAGSMAIKAAVA--KAKPILLEPIMKLEAVTPEE
EFG_GLOVI             YPLIDVKVTMVDGSYHDVDSSEMAFKIAGSLALREAAQ--KAQPVLLEPMMKVEVEVSGD
EFG2_SYNY3            YPVIDLKATLVDGSFHDVDSSEMAFKIAGSMAIREAVG--QADPVLLEPVMKVEIEVPDD
EFG_DEIRA             FPVVDIKVVIYDGSYHEVDSSEMAFKIAGSMGLKEAVQ--KGSPAILEPVMRVEVTTPEE
EFG_ENTFA             YPLVDIKAKLYDGSYHDVDSNETAFRVAASMALKAAAK--NANPVILEPMMKVTITVPED
EFG_OENOB             YPLVDLKAKLYDGSYHEVDSSEAAFKIAASMSLREASK--TAGAVILEPIMKVSIVSPID
EFG_MESFL             YPMIDVKATIVDGSMHDVDSNEMAYKIAASFALKEACK--KMNPVILEPIMNVEVTVPDE
EFG_MYCPN             YPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGK--VCSPVLLEPIMAIEVTVPEQ
EFG_MYCA5             YPLIDVKATLFDGSYHEVDSSELAYKIAASKSLTKGRE--MLGTVLLEPIMDVAVVIPED
EFG_CLOAB             YPTVNFKVRLVDGSYHDVDSSEMAFKIAGSMAFKNAMT--KADPVILEPIMKVEVTVPEE
EFG_LACP7             YPVLGVRANCYDGSYHEVDSNEMAFKIAGSMAFKDAMH--KAGPILLEPIMRVEVTVPDD
EFG_FINM2             YPMLDMKITLLDGSYHDVDSSEMAYKIAGSMGFRAAVA--KAKPILLEPAMKVEITTPDE
EFG_MOOTA             YPVVDVRATLVDGSYHEVDSSEMAFKIAGSLAFKDAAK--KAQPVLLEPVMRVEVVVPDE
EFG_ECOLI             YPVVDMGIRLHFGSYHDVDSSELAFKLAASIAFKEGFK--KAKPVLLEPIMKVEVETPEE
EFG_WIGBR             YPIVDVCVTVFDGSYHEVDSSEIAFKIAASIAFKSAFM--KASPILLEPIMKVEVETPNE
EFG_HYDCU             FPMVDVSVELIDGSYHDVDSNEMAFSVAAGMGIKNGVT--QASPVILEPVMAVEVTTPEE
EFG_FUSNN             YPLVDVKVTLYDGSYHEVDSSEMAFKIAGSMALKQAAT--KAKPVILEPVFKVEVTTPEE
EFG_SULSY             YPVINVKATLFDGSFHEVDSSEIAFKIAGSMAFRDAMK--KADPVLLEPIMHVEVDTPEE
EFG_PARUW             FNLVDVLVDIVFGSYHDVDSNEMAFKICGSMALKEAAR--KCKPVILEPIMKVDVTTPEA
EFG_ENDTX             YPVADVKVVVIDGSFHEVDSSEMAFKIAGSMAFKDACR--KASPVILEPIMKTEVIVPEE
EFG_CUTAK             YPVEDVKVTLLDGAYHEVDSSEMAFKIAGSMAFKEAAR--KANPGLLEPLMAVEVTTPED
EFG1_STRCO            YEMTGVRVTLIDGGYHEVDSSELAFKIAGSQAFKEAAR--KASPVLLEPMMAVEVTTPED
EFG_BIFAA             FPVVGVKATVTDGQVHDVDSSEMAFKIAGSMCFKEAAP--KAKPVILEPIMAVEVRTPEE
EFG_DESAG             YPMVDVKVALVFGSYHEVDSSEQAFYVAGSMAVKEAAR--KASPVLLEPVMDVEVVTPEE
EFG_PARD8             YPLDKLKVTLIDGSFHPVDSDQLSFEIAAIQAFKNASA--KAGPVLMEPIMQMEVVTPEE
EFG_SULMW             YEINNARIILIDGSYHSVDSDQLSFELASKIGFKNAAK--KTNPIILEPIMKLEVLTPPE
EFG_SALRD             YPIEGVWVRLYDGDHHEVDSDQNAFEIAGRLGFREAAR--HANPVLMEPVMEVEVVTPDD
EFG_CHLT3             YPMIDVKVTLFDGKYHEVDSSEMAFKIAGSIGFKEGAR--KAGAVLLEPIMAVEVITPEE
EFG_GLUOX             FPTVDFKFTLLDGKYHDVDSSALAFEIAAKACFREGMK--NAGPVILEPIMDVEITTPND
EFG2_HAHCH            YPCGGFKAVLLDGAYHAQDSSQLAFSVAGREAFKEAMA--QATPRLLEPVMAVEIVTPRD
EFG1_METCA            YPCVDFKVNLTDGGFHAVDSSAIAFEIAAQAAFRQSVP--KAAPQLLEPIMKVDVFTPDA
EFG1_SYNY3            YPVVDLKVTLTDGGFHPVDSSAIAFEIAAKAGYRQSLP--KAKPQILEPIMAVDVFTPED
EFG_HYPNA             YPVTDFRATLTDGAFHDVDSSVLAFEIAARGAFRELKG--KGDPRLMEPIMKVEVVTPED
EFG_RHORT             FPVTDMKASLIDGGYHDVDSSVLAFEIAARAAFREGLP--KAGPKLLEPIMKVEVVTPED
EFG_NEOSM             YPIIGFKVTLMDGAFHDVDSSVLAFEIAARDAFKEAAK--KLGLKIMEPLMRVEIVTPEE
EFG_PSELT             YPMIGVRAVLLDGSYHEVDSSEIAFKVAASLAFKNAMK--ICQPVLLEPVMKLEVVVPEE
EFG_THEMA             YPVVRVRAIVLDGSYHEVDSSEMAFKIAASMAFKEAMK--KAQPVLLEPIMKLEITTPEE
EFG_PETMO             YPMVAIRVEVFDGSYHEVDSSEMAFKIAASMAFKDAIK--KAKPVLLEPVMKVDVTTPEE
EFG1_SYNWW            YPVVNVKATLLDGSFHEVDSSEMAFRTAAFLATRECLK--KAHPRMLEPVMRLEIVSPEE
EFG2_SYNWW            YPVDDVEVVLKGGSYHEVDSNEPAFKIAASMALKEALE--NAQSVFLEPVMDLEIICPEE
EFG1_BDEBA            CSMLGIKGTLNSVEVRPDSSSEMAFKAAASLAFRDAVK--AASVELLEPIFKLEVTCPDD
EFG2_DESPS            YPVTDVRVRLVGGAYHEEDSTEMAFGVSASIAVRKAAS--EADSVLLEPIMSLEVITPDE
EFG1_GEOSL            YPLTDLEVRVAAIPVEPGVTTDAGVRAAAGRGLMLAAR--DAGPTLLEPVMNLEIVIPAD
EFG1_PELCD            YPLTDVEITIIEAPFEPGLTTEIGLLAAAQRGLSLAAT--QAGLTLLEPVMALELTVPTE
EFG2_SYNAS            YPVVDIRIKILEVGLKEGESSPIGYKIAASSAFRDGCI--KGESVLLQPIMAVNVITPAE
EFG3_MYXXD            VPLVDVEVRLLDGDTHVRDSTPQAFAVAGSLALQAAAH--RAGVQQLEPVMEVEVTTPEE
EFG2_STRCO            HPVTGLRVTLTDGRTHVKDSSDTAFRTAGRFGLRDALR--ASGMILLEPVVEVTVTVPED
EFG2_BORBU            YPIIDINVSIFSIVCGANKISESAFESISGFAFHSIFQ--KSDPIRLEPIMLLEIRTPIE
EFG2_BORAP            YPIIDINVIIFSIVCEISKISESVFESISGFAFHSIFQ--KSDPIRLEPIMLLEIRTPIE
EFG2_BORBP            YPIIDINVGIFSIVSETSKISESAFESISGFAFHSIFQ--KSDPIKLEPIMLLEIRTPIE
EFG1_TREDE            YPCTDIEVELVSVKYNELTATPFAYEAAAAKCFDDACS--AAAPVLLEPVMAVDIMSPKE
EFG2_TREPA            YPCVDVGVHLLSVEYQELTSSPFIFEAAAVQAFGEACV--AAEPYVLEPIMSVELSCAQE
EFG_CARRP             YPVTKIKITLINGSFHPVDSSEYAFKNAASIALKEALK--KANSFLLEPIMKVEIISPKE
EFG_RHOBA             YPVVGTRIELLDGSYHDVDSSEKAFYTAAQGCFREYFK--QAAPKLLEPIMSVEIEVPEE
K2LYN2_TRYCR          APVWGVHFHLGGGAMHEVDSTDMAFKNATQELWETLLP--KLKPTLVEPYMDVEIVVPAH
Q38BA0_TRYB2          APVWGVHFHLSGGAMHEVDSTDLAFRNATQELWETLLP--QLKPTLVEPYMVVEITVPST
A4ICS8_LEIIN          APVWGVHFHLNGGAMHEVDSNDQAFKNATQELWETLLP--KLKPTLVEPFMDVEMTVPAA
Q4Q219_LEIMA          APVWGVHFHLNGGAMHEVDSNDQAFKNATQELWETLLP--KLKPTLVEPFMDVEMTVPAA
A4HNR7_LEIBR          APVWGVHFHLSGGAMHEVDSNDQAFKNATQELWETLLP--KLKPTLVEPFMDVEMTVPAT
Q7RFK0_PLAYO          SEIINMKMRLISGKIHEVDSNDLAFKKATINLIKENYQ--NFCPVLLEPIMHVEIISNYD
A5K8J4_PLAVS          SEIINMKMRLIGGKIHEVDSNDLAFKRATIHLIKENYH--NFVPVLLEPIMLVEIISHYE
A0A1Y3DJ13_PLAKN      SEIINMKMRLIGGKIHEVDSNDLAFKRATIHLIKENYQ--NFVPVLLEPIMVVEIISHYE
A7AM19_BABBO          RQVVNTRIVVNDGQSHEVDSSDVAFKLAAKGAFDESYM--DTNPIILEPVMQVEVVTPHE
Q4MYM5_THEPA          RPVVNTRFVLTDGASHDVDSSDLAFKLATYGAFELAYS--QAEAIILEPVMSVEVTAPQE
                                                                     :* .         

EFG2_ANADE            FSGGILGTLMQ-RRAMIIGSQDDGG---LARIEAEVPLAEMFGYSTTLRSATQ---GKAE
EFG1_DESPS            FQGAVMGSINQ-RRGMIIGSNEEGT---YSVIEAEVPLSEMFGYSTTLRSLTQ---GKAE
EFG1_BORBU            FQGNMFGLLNQ-RRGIITGSLEDGS---FSKVEAEVPLSEMFGFSTVLRSSTQ---GKAE
EFG1_BORBP            FQGNMFGLLNQ-RRGIITGSLEDGS---FSKVEAEVPLSEMFGFSTVLRSSTQ---GKAE
EFG2_TREDE            FQGNIFGLINQ-RRGIIISSTEDDN---FTRVDAEVPLSEMFGFSTILRSSTQ---GKAE
EFG1_TREPA            FQGSVFGLINQ-RRGVVVSSADDEQ---FSRVDAEVPLSEMFGFSTVLRSSTQ---GKAE
EFG1_SYNAS            FQGAVMGLLNQ-RRGMIVGTQDEGQ---TCVIEAQTPLAEMFGFSTVIRSATQ---GKAQ
EFG2_BDEBA            YQGSAVGQINQ-RRGSIVATTAFEG---NCVIEAEVPLTEMFGYSTDLRSATK---GKGE
EFG1_MYXXD            FQGSVVGQLNQ-RRGTILSTETAEG---YVTAVAEVPLNTMFGYSTDLRSATQ---GKGE
EFGM_DICDI            FQGTVISGVNR-RKGAIVNTTTQGE---SLTFECEVPLNNMFGYSTELRSMTQ---GKGE
D3BMN4_POLPP          FQGTVIGGINR-RKGAIFNTGAQGE---NITIECEVPLNNMFGYSTELRSSTQ---GKGE
EFGM_CRYNJ            FQGNVIGAINQ-RKGTIVDTEVRDD---EFTLTAEVALNDMFGYSSQLRGMTQ---GKGE
EFGM_USTMA            FQGAVIGALNQ-RKGTISDTEVRED---EFTLTAEVSLNDMFGYSSQLRGLTQ---GKGE
EFGM_COPC7            FQSNVIGGLNT-RRGTIVDSEVRDD---EFTAVAEVALNDMFGYSNQLRGSTQ---GKGE
EFGM_SCHPO            HQGGVIGNLDK-RKATIVDSDTDED---EFTLQAEVPLNSMFSYSSDIRALTK---GKGE
F4NY64_BATDJ          FQGPCIALLNR-RKGTIHNSEVREE---YLEVTADVPLNDMFGFSTDLRSITQ---GKGE
D0NCX8_PHYIT          FQGTAIAEVNR-RRGLINSSDADEM---HTVVKCDVPLQNMFGFSTDLRSSTQ---GKGE
EFGM1_ARATH           FQGTVAGDINK-RKGIIVGNDQEGD---DSVITANVPLNNMFGYSTSLRSMTQ---GKGE
EFGM2_ARATH           FQGTVAGDINK-RKGIIVGNDQEGD---DSVITANVPLNNMFGYSTSLRSMTQ---GKGE
D7SLS6_VITVI          FQGTVTGDINK-RKGVIVGNDQDGD---DSVITAHVPLNNMFGYSTSLRSMTQ---GKGE
M1CGG0_SOLTU          FQGTVTGDINK-RKGVIIGNDQEGD---DSVITANVPLNMMFGYSTSLRSMTQ---GKGE
EFGM_ORYSJ            FQGTVTGDMNK-RKGIIVGNDQEGD---DTVVVCHVPLNNMFGYSTALRSMTQ---GKGE
I1GYK4_BRADI          FQGTVTGDMNK-RKGIIVGNDQEGD---DTVVVCHVPLNNMFGYSTALRSMTQ---GKGE
C5WSZ1_SORBI          FQGTVTGDMNK-RKGIIVGNEQEGD---DTIVVCHVPLNNMFGYATAIRSVTQ---GKGE
A9RPB9_PHYPA          FQGSIIGDINR-RKGIIVGSDQEGD---DAVVLAHVPLNNMFGYSTGLRSMTQ---GKGE
A9SP22_PHYPA          FQGSIIGDINR-RKGIIVGSDQEGD---DAVVLAHVPLNNMFGYSTGLRSMTQ---GKGE
EFGM_COCIM            FQGDVIALLNK-RNAIINDTETGVD---EFTVYADCSLNGMFGFSTHLRAATQ---GKGE
C0NUK7_AJECG          FQGDIIALLNK-RNAVINDTDTGVD---EFTVYADCSLNGMFGFSTHLRAATQ---GKGE
EFGM_EMENI            FQGDVIGLLNK-RGATINDSEVGVD---EFTVYADCSLNGMFGFSSHLRAATQ---GKGE
EFGM_ASPFU            FQGDVISLLNK-RNATINDTETGVD---EFTVYADCSLNGMFGFSTHLRAATQ---GKGE
EFGM_SCLS1            FQGNIVGLLNK-RNAIISDTEIGPE---DFTLIADCSLNAMFGFSSQLRAATQ---GKGE
C7YWN8_FUSV7          FQGNILMLMNK-RNATIHDTDIGSE---DFTLICDCSLNAMFGFSSQLRAATQ---GKGE
I1RCR5_GIBZE          FQGNILMLMNK-RNATIHDTDIGSE---DFTLICDCSLNAMFGFSSQLRAATQ---GKGE
EFGM_NEUCR            FQGNILMLMNK-R-GTIVDTEVGAD---EFTMVADCSLNAMFGFSTHLRAATQ---GKGE
EFGM_ASHGO            FQGNVITLLNK-LQAVIQDTENGHD---EFTMTSECSLNTMFGFATSLRASTQ---GKGE
EFGM_YEAST            FQGNVIGLLNK-LQAVIQDTENGHD---EFTLKAECALSTMFGFATSLRASTQ---GKGE
EFGM_CANAL            FQGSVVGLINK-LGGMINDTVNGPD---DFTVTAECSLNSMFGFSTSLRASTQ---GKGE
EFGM_YARLI            FQGALIALMNK-NQALISDQDIGSE---EVTLSGECSLNQMFGFATHLRACTQ---GKGE
G3QKQ5_GORGO          FQGQVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
A0A2I3T1A0_PANTR      FQGQVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
EFGM_HUMAN            FQGQVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
G1QVZ1_NOMLE          FQGQVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
EFGM_PONAB            FQGQVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
F6QKI2_CALJA          FQGQVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
H0UVN5_CAVPO          FQGSVIAGINR-RHGVITGQDGIED---YFTLYADVPLNNMFGYSTELRSCTE---GKGE
G1T5N5_RABIT          FQGPVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
G1M4M7_AILME          FHGPVIAGINR-RHGVITGQDGIED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
M3WIL3_FELCA          FQGPVIAGINK-RHGVITGQDGIED---YFTLYAEVPLNDMFGYSTELRSCTE---GKGE
G1NTB9_MYOLU          FQGTVIAGINR-RHGVITGQDGVED---YFTLYADVPLNDMFGYSTELRSCTE---GKGE
H0WY66_OTOGA          FQGSVIAGINR-RHGVITGQDGTED---YFILYAEVPLNDMFGYSTELRSCTE---GKGE
EFGM_MOUSE            FQGTVFAGINR-RHGVITGQDGIED---YFTLYADVPLNNMFGYSTELRSCTE---GKGE
EFGM_RAT              FQGAVFAGINR-RHGVITGQDGIED---YFTLYADVPLNNMFGYSTELRSCTE---GKGE
F7EHU0_MONDO          FQGTVIAGINR-RHGVITGQDGVED---FFTLYAEVPLNEMFGYATELRSCTE---GKGE
G1KFW0_ANOCA          FQGAVISGVNR-RHGIVTGQDGAEG---YFTLYADVPLNNMFGYATELRSSTE---GKGE
F6Q9W5_XENTR          FQGPVIAGINR-RHGVIVGQDGSEG---YFTLYADVPLNDMFGYASELRSCTE---GKGE
H3AWE2_LATCH          FQGVVIAGINR-RHGVITGQDGAEG---YFTLYADVPLNNMFGYSSELRSSTE---GKGE
H3CQL2_TETNG          FQGAVIAGVNR-RHGLITGQDGAEG---YFTLYADVPLNDMFGYATELRSCTE---GKGE
I3J7A5_ORENI          FQGAVIAGVNR-RHGVITGQDGGEG---YFTLYADIPLNDMFGYATELRSCTE---GKGE
G3P617_GASAC          FQGTVIAGVNR-RHGVITGQDGAED---FFTLYADIPLNDMFGYSTELRSGTE---GKGE
EFGM_DANRE            FQGAVIAGVNR-RHGVISGQDGADG---YFTLYADIPLNDMFGYATELRSCTE---GKGE
C3ZDC2_BRAFL          FQGAVIAGINK-RNGLIQGQDGSEG---YFTLYTEVPLNNMFGYSTELRSCTE---GKGE
EFGM_ANOGA            FQGTVIGQLNK-RHGIITGTEGAEG---WFTVYAEVPLNDMFGYAGELRSSTQ---GKGE
W5JI53_ANODA          FQGTVIGQLNK-RHGIITGTEGAEG---WFTVYAEVPLNDMFGYAGELRSSTQ---GKGE
EFGM_AEDAE            FQGTVIGQLNK-RHGIITGTEGSEG---WFTVYAEVPLNDMFGYAGELRSSTQ---GKGE
EFGM_DROME            FQGAVMGHLSK-RHGIITGTEGTEG---WFTVYAEVPLNDMFGYAGELRSSTQ---GKGE
EFGM_DROPS            FQGAVMGHLSK-RHGIITGTEGTEG---WFTVYAEVPLNDMFGYAGELRSSTQ---GKGE
E9G149_DAPPU          FQGTVIGQLNK-RHGIITGTEGNDG---WFTVYAEVPLNDMFGYSTEIRSTTQ---GKGE
A0A087ZTR9_APIME      FQGIVVAQITR-RNGIITNTDNNEG---WCTLKSEVPLNEMFGYIGELRSTTQ---GKGE
E0VF81_PEDHC          FHEIVTIDLIK-RCGIVLCSEFSED---YFVTQAEVPLYEMFGYSSHLRSITQ---GKGE
EFGM_NEMVE            FQGTVIAGVNR-RHGQVTGTDANEG---YFTLFAEVPLNDMFGYATELRSQTQ---GKGE
F6UKC4_CIOIN          FQSAVLSSITK-RKGTISDQDVDTD---YVTINCDVPLNDMFGYASELRSVTE---GKGE
EFGM_CAEBR            FQGNVVTS----------------------------ALSDMFGYTSELRSLTE---GKGE
EFGM_CAEEL            FQGNVVTSLTQ-RNALITTTDSTEG---YATVICEAPLSDMFGYTSELRSLTE---GKGE
A0DGW7_PARTE          SYQQAMVGIAK-RRGSVTNTESRGD---MFVLNADVPLSQMFGYATELRGFTS---GQGE
A0C9U4_PARTE          SYQQAMVGIAK-RRGSVTNTESRGD---MFVLNADVPLSQMFGYATELRGFTS---GQGE
Q22AK9_TETTS          EYQSVMAAISK-RRGLITNTESRGD---IFILNADCPLSQMFGFATELRGLTS---GQGE
EFG1_ANADE            YMGDVIGDLNS-RRGKIHAMNPRAG---VQVIEAHVPLAEMFGYATDLRSKTQ---GRAT
EFG2_MYXXD            FMGDVIGDLNG-RRGKVQGMTPRPG--RVQAIQAQVPLAAMFGYSTDLRSRSQ---GRAT
EFG_KORVE             YMGVIIGDLNS-RRGRIEGLEHRAG---SQVVKAMVPLAEMFGYVNSMRSNTQ---GRAT
EFG_SOLUE             YMGDVIGDLYG-RRGRIEGTELRGN---TRIIKSMVPLSAMFGYATDIRSRTQ---GRGS
EFG2_GEOSL            YMGDVIGDLNS-RRGRIMGMEGRAG---AQVVSAMVPLAQMFGYATDLRSATQ---GRAT
EFG2_PELCD            YMGDVMGDLSS-RRGRVLGMDARGG---AQVINSNVPLASMFGYATELRSMTQ---GRAT
EFG_MAGMM             YMGDVMGDMNS-RRGQIQGMEDSGN---NRLVKAQVPLSGMFGYATDLRSMSQ---GRAT
EFG_CHLAA             FLGTVIGDFNS-RRGRIEGMEARGN---AQVVRAFVPLANMFGYMTDLRSATQ---GRAT
EFG_HERA2             YMGSVIGDVNS-RRGRIEGMEARGN---AQVVRGFVPLANMFGYVNDLRSQTQ---GRAT
EFG_DEHM1             YMGDVIGDFNS-RRGQIISVEPNPE---TTVITGNVPLAESFGYTTDLRSVTK---GRAT
EFG_GLOVI             FLGDVMGDLNA-RRGQIESMDNEGG---VSKVTSRVPLAEMFGYATDIRSKTQ---GRGT
EFG2_SYNY3            FMGNVIGDLNA-RRGHIEGQETEQG---IAKVAASVPLAEMFGYATDIRSKTQ---GRGI
EFG_DEIRA             YMGDVIGDLNS-RRGQIQGMEARGN---AQIVKAFVPLSEMFGYATDMRSKTQ---GRAS
EFG_ENTFA             YLGDIMGHVTS-RRGRVEGMEAHGN---SQIVNAMVPLAEMFGYATTLRSATQ---GRGT
EFG_OENOB             NLGDVMGHVSA-RRGMIEDQETHGN---TVTVTSKIPLAEMFGYTTTLRSATQ---GRGT
EFG_MESFL             YYGDVMGNISS-KRGLIEGSEQRGN---AQTIKSKVPLTEMFGYATELRSFTQ---GRGN
EFG_MYCPN             YFGDTMGDISS-RRGLIEGTEQRDN---VQVIKAKVPLKEMFGYATDLRSFSQ---GRGN
EFG_MYCA5             FFGDVMGDISR-RRGQVRDNETRND--GAHVIKAYIPLSEMFGYATELRSMTT---GRGT
EFG_CLOAB             YMGDIMGDVNS-RRGRIEGMEQRAG---AEVIRAFVPLSEMFGYATSLRSRTQ---GRGV
EFG_LACP7             YMGDVIGDISS-RRGRIEGTEDNNG---SKIIRGFVPLSEMFGYSTTLRSKTQ---GRGA
EFG_FINM2             YLGDVMGDVSS-RRGKIDGMNPKNG---VHVLDAFIPLAEMFGYATDLRSKTQ---GRAT
EFG_MOOTA             YMGDVIGDLNS-RRGRVEGMEPRAG---AQVIRAHVPLAEMFGYATDLRSRTQ---GRGT
EFG_ECOLI             NTGDVIGDLSR-RRGMLKGQESEVT---GVKIHAEVPLSEMFGYATQLRSLTK---GRAS
EFG_WIGBR             YMGDVIGDLNR-RRGIIDGMQDINM---GKIIISKIPLSEMFGYATDLRSQTQ---GRAS
EFG_HYDCU             YMGDIIGDLNR-RRGMVSSMDDIAS---GKSIKAEVPLSEMFGYSNQMRSLTQ---GRAN
EFG_FUSNN             YMGDIIGDLNS-RRGMVSGMIDRNG---AKIITAKVPLSEMFGYATDLRSKSQ---GRAT
EFG_SULSY             YMGDVMGDLNR-RRGRILGMEKRGN---TVTIKAEVPLAEMFGYATDLRSITQ---GRAT
EFG_PARUW             HMGDVIGDLNR-RRGQIVGQENHKG---AVIIHAEVPLSEMFGYSTLLRSLSS---GRAT
EFG_ENDTX             YMGDVIGDLNS-RRGKIVSMESKNK---VQHIKANVPLAEMFGYSTTLRSLTQ---GRGN
EFG_CUTAK             YLGTVIGDLNS-RRGQIQEMVE-EH--GNKVVRALVPLSEMFGYVGDLRSKTS---GQAS
EFG1_STRCO            YMGDVIGDINS-RRGQIQAMEE-RM--GARVVKGLVPLSEMFGYVGDLRSKTS---GRAS
EFG_BIFAA             YMGDVMGDINA-RRGSIQSMTD-ST--GVKVIDAKVPLSEMFGYIGDLRSKTQ---GRAM
EFG_DESAG             YLGDVMGDLNG-RRGKIQSMDS-RA--GAQVIRCHVPLSEMFGYATDLRSRTQ---GRAN
EFG_PARD8             SMGDVIGDLNK-RRGQVEGMETSRT--GARIVKAKVPLAETFGYVTALRTITS---GRAT
EFG_SULMW             NMGNIVGDINR-RRGIIQGMEENRS--NSKIIKALVPLSELFGYVTILRTLSS---GRAT
EFG_SALRD             YMGDIIGDLNG-RRGQIGQMGQ-RN--DAQVINAEVPLSEMFGYSTDLRSLSQ---GRAI
EFG_CHLT3             YMGDVMGDLSG-RRGHIEGMHQ-RA--GAQVIKAKVPLSAMFGYSTELRSMTQ---GRAN
EFG_GLUOX             HVGDVVGDLNR-RRGIIQNQETAGS---TVMIRAQVPLKEMFGYISHLRSATK---GRAS
EFG2_HAHCH            HVGDCIGDLMR-RRGSILNQLDRGD---ACVINAEAPLAEMFGYIGDLRTMTA---GRAS
EFG1_METCA            HVGDVIGDLNR-RRGMIKSQEAGVT---GVRIKAEVPLSEMFGYIGDLRTMTS---GRGQ
EFG1_SYNY3            HMGDVIGDLNR-RRGMIKSQETGPM---GVRVKADVPLSEMFGYIGDLRTMTS---GRGQ
EFG_HYPNA             YMGDVIGDLNS-RRGQIQGSEARGI---ATAITAMVPLVNMFGYVSNLRGMSQ---GRAQ
EFG_RHORT             YMGDVIGDLNS-RRGNILGMDQRGN---ARVIGAMVPLANMFGYVNTLRSMSQ---GRAQ
EFG_NEOSM             YTGTVIGDLNS-RRGKIAEMEAKGN---ARVISGVVPLSRMFGYVNDLRSSTQ---GRAS
EFG_PSELT             YVGGIIADLNA-RRAQIESLESRI--N-LRVIKAFVPLSELFGYATTLRSLSQ---GRAV
EFG_THEMA             YMGNIISDLNS-RRAKVESLETRG--H-LKVIVAKVPLSETFGYATVLRSLSQ---GRAS
EFG_PETMO             YMGDIIADLSS-RRGRIESFENVGGTN-TRVVHAQVPLSELFGYATIMRSLSQ---GRAT
EFG1_SYNWW            YTGNIINNITN-RRGKLESLEMENH---TQIIRGCVPLAELFGYSTVLRSLTQ---GRAG
EFG2_SYNWW            YLGDVISDLNA-RRGRIIALEENRD---TKAVKGLVPLAETFGYATSLRSLTQ---GRAS
EFG1_BDEBA            FVGNIVGDLNA-RRGKILAMNVKQGG--GQVISAEAPLASLFGYATDVRSLSQ---GRAS
EFG2_DESPS            YLGDAIGDLNK-KRAKVVGVEV-EGD--LQKLLAHVPLSEMFGYSTSLRSATQ---GRAN
EFG1_GEOSL            YAGKVLGSVQQ-KRGRIEGISSQGD---TETIRASVPLAEMFGYMTELRSATK---GRGT
EFG1_PELCD            HAGQVIGSLQQ-KHGRIDGLETRSE---SELIQARAPLSQLFDYMGELRSVTR---GRGT
EFG2_SYNAS            FMGDVIGDINA-RKGEIQTITPKGA---MCEIRALVPLKALFGYSTDLRSATQ---GRAV
EFG3_MYXXD            YLGEVLGDLAA-RRGRVLGMEARGV---VRLVSARVPMASLFGYVTGLRGRTQ---GRAQ
EFG2_STRCO            GVGGVLGDLAA-RRGRVTGSDPRGG---AVVVTATVPLAELFGYATRLRSRTQ---GRGT
EFG2_BORBU            HTGEIISTLNV-MGGVIHSVSNIGE---YDLIKSEAAFEKLFGYASILRSSTK---GRGS
EFG2_BORAP            HTGEIISTLNV-IGGVIHSVSNIGE---YDLIKSEAAFEKLFGYASILRSSTK---GRGS
EFG2_BORBP            HTGEIISKFNV-MGGVIHSVSNIGE---YDLIKSEAAFEKLFGYASILRSSTK---GRGS
EFG1_TREDE            FVGDAMSQITQ-RGGLISSMDSKAS---TDIVHAQAPMAKMFGFSTDLRSATQ---GRAS
EFG2_TREPA            NVGDVMNVIIQ-RGGIILGMDSKHG---RELVHAQAPMKKMFGFSTDVRSASR---GGAS
EFG_CARRP             YLGIVISDISKKRGNIISVVDNNNN---LKIINSLIPLRELFGYSTDLRSNTK---GRAN
EFG_RHOBA             FQGTVTGDVIR-RRGLMTSNDTNEG---MTVILAEVPLAETFGYATDLRSMTQ---GQGT
K2LYN2_TRYCR          CMTDVATEFSK-REGIVTETRINGV---DAVIHGETALDTMFGFISDLRRLTK---GQGD
Q38BA0_TRYB2          CMTDVSTEFAK-REGVVTETTISGT---DAIIRGETALDTMFGFISDLRRLTK---GQGD
A4ICS8_LEIIN          NMTDVATEFSK-REGVVTETAVDGP---DAVIRGETALDTMFGFISDLRRLTK---GQGD
Q4Q219_LEIMA          NMTDVATEFSK-REGVVTETAVDGP---DAVIRGETALDTMFGFISDLRRLTK---GQGD
A4HNR7_LEIBR          NMTDVATEFSK-REGVVTETTVNGP---DAVIRGETALDTMFGFISDLRRLTK---GQGD
Q7RFK0_PLAYO          HQSNILTSITK-RKGLVTNIVNNMN---IIYIYADIPLKHMFNYINEIRAITQ---GQGT
A5K8J4_PLAVS          HQSNILTSITK-RKGLVTNIVNHMN---AVHIYADIPLKHMFNYINEIRSITQ---GQGT
A0A1Y3DJ13_PLAKN      HQSNILTSITK-RKGLVTNIVNHMN---AVHIYADIPLKHMFNYINEIRSITQ---GQGT
A7AM19_BABBO          FQAAVLSTITK-RKGLVTDTSTYGT---NVILQAQVALRNMFGYITDLRAATK---GQGE
Q4MYM5_THEPA          FQSQTLSTLTK-RKGIITNTNIIGE---TVTINANVPLKHMFGYITDLRSATK---GQGE
                                                          .:   *.:   :*  :    * . 

EFG2_ANADE            FSMEFSRYLPVPAAMAEELMTKASKKAEGGKK------------
EFG1_DESPS            FTMEFANFKPVPKTVGDNLIKAHEEERKNG--------------
EFG1_BORBU            FSMEFLRYGKVPSTIFDELRKKFNDQNKS---------------
EFG1_BORBP            FSMEFLKYGKVPNAIFDELRKKFNDQNKS---------------
EFG2_TREDE            YSMEFAKYGKAPASISEELIKEYEAKRLAEKK------------
EFG1_TREPA            YSMEFAKYGKAPQGVTDSLIKEYQEKRKAEQR------------
EFG1_SYNAS            FTMEFSAYRQVPQSIAEKITEEVAKRKKSAA-------------
EFG2_BDEBA            FSMEFAKYAPVPRNIQEELAKKYQAKRAAEQK------------
EFG1_MYXXD            YTMEFSRYTPVPRNESEALMAAYKEKLAAEQAARK---------
EFGM_DICDI            FSMEYLKHTNVSRELYNQLLEEYKKKRTEENK------------
D3BMN4_POLPP          FTMEYSKHSPVTREQFDQLIEEYQKKRAEEKK------------
EFGM_CRYNJ            FSMEYKNHQPVLPNIQKEMAEAFRKKQLSK--------------
EFGM_USTMA            FSMEYKCHTPVMMNIQKEMHEAYRKKQTEKK-------------
EFGM_COPC7            FSMEYKHHAPVLPNVQKELEEAYQKTLPQSKK------------
EFGM_SCHPO            FSMEFLKYLPAPKYVQKELVDAYNKQQQK---------------
F4NY64_BATDJ          FSMTYKDHQPVMPFVQEQLVKEYQIATGHAPPASNKK-------
D0NCX8_PHYIT          FTMEYKTHGIVMRDMQEKLVAEYEKSLAAKNK------------
EFGM1_ARATH           FTMEYKEHSAVSNEVQAQLVNAYSASKATE--------------
EFGM2_ARATH           FTMEYKEHSAVSNEVQAQLVNAYSASKATE--------------
D7SLS6_VITVI          FTMEYKEHSPVSQDVQLQLVNTYKANKAAENS------------
M1CGG0_SOLTU          FTMEYREHAPVSGDTQTQLVNTYKASKES---------------
EFGM_ORYSJ            FSMEYLEHNTVSQDVQMQLVNTYKASRGTE--------------
I1GYK4_BRADI          FTMEYMEHNTVSQDVQMQLVNSHKATKSPE--------------
C5WSZ1_SORBI          FTMEYLEHNVVSQDVQMQLVNSYKAAKGTE--------------
A9RPB9_PHYPA          FTMEYHQHAAVPQDAQAVLVKEYTNKRVTL--------------
A9SP22_PHYPA          FTMEYYQHAAVPQDAQAVLVKEYTNKRVV---------------
EFGM_COCIM            YTMEFSHYEKAPGHLQKELIAEYEKAQAARHKK-----------
C0NUK7_AJECG          YTMEFSHYERAPGQLQKQLIAEYEAAQAARHKK-----------
EFGM_EMENI            YTMEFSHYEKAPPQEQRELVKKYLQAQADRHKK-----------
EFGM_ASPFU            FTMEFSHYEKAQPQLQKELIQKYLKAQADRHKK-----------
EFGM_SCLS1            FGMEFSHYAPAPGQLQKELISNYEKAQADRHKK-----------
C7YWN8_FUSV7          FSMEFSHYAPAPPHLQKELVAKYQAELEAKRTK-----------
I1RCR5_GIBZE          FSMEFSHYAPAPPHLQKELVAKHQAEIEAKRTK-----------
EFGM_NEUCR            FSMEFSHYAPAPPHLQKELVQKYQKELEAKRTK-----------
EFGM_ASHGO            FSLEFKQYSPASPQLQKQLIEEYRK--SKK--------------
EFGM_YEAST            FSLEFSHYAPTAPHVQKELISEFQKKQAKK--------------
EFGM_CANAL            FSLEFLKYSPTAPQVQKQLIQEYQKAQAAKK-------------
EFGM_YARLI            FSLEFSHYAPCSPHLQKELVDAHQKKLQAERDGK----------
G3QKQ5_GORGO          YTMEYSRYQPCLPSTQEDVINKYLEATGQLPV---KKGKAKN--
A0A2I3T1A0_PANTR      YTMEYSRYQPCLPSTQEDVINKYLEATGQLPV---KKGKAKN--
EFGM_HUMAN            YTMEYSRYQPCLPSTQEDVINKYLEATGQLPV---KKGKAKN--
G1QVZ1_NOMLE          YTMEYCRYQPCLPSTQEDIINKYLEATGQLPV---KKGKAKN--
EFGM_PONAB            YTMEYGRYQPCLPSTQEDVINKYLEATGQLPV---KKGKAKN--
F6QKI2_CALJA          YTMEYCRYQPCLPATQEELINKYLEATGQLPA---KKGKAKN--
H0UVN5_CAVPO          YTMEYCRYQPCLPSTQEDLINKYLEATGQLPI---KKGKAKN--
G1T5N5_RABIT          YTMEYCRYQPCSPSTQEDLINKYLEATGQLPI---KKGKAKN--
G1M4M7_AILME          YTMEYCRYQPCSPSTQEDLINKYLEATGQLPV---KKGKAKN--
M3WIL3_FELCA          YTMEYCRYQPCSPATQEDLINKYLEATGQLPV---KKGKAKN--
G1NTB9_MYOLU          YTMEYCRYQPCLPATQEDLINKYLEATGQLPI---KKGKAKN--
H0WY66_OTOGA          YTMEYCRYQPCLPATQEDLVNKYLEATGQLPV---KKGKAKN--
EFGM_MOUSE            YTMEYCRYQPCSPSTQEELINKYLEATGQLPV---KKGKAKN--
EFGM_RAT              YTMEYNRYQPCSPSTQEELVNKYLEATGQLPV---KKGKAKN--
F7EHU0_MONDO          YTMEYSRYQPASAATQEELVHKYLEATGQLPV---KKGKAKS--
G1KFW0_ANOCA          YTMEYSRYHPCLPTVQEELVNRYLEATGQLSG---KKGKAKS--
F6Q9W5_XENTR          YTMEYSRYQPCLASTQEELINKYLEATGQLPA---KKGKAKS--
H3AWE2_LATCH          YTMEYSKYQPCLPSTQEELVNKYLESTGQLPA---KKGKAKN--
H3CQL2_TETNG          YTMEYSRYQPCLPATQEDLVHKYLEATGQLPA---KKNKWKS--
I3J7A5_ORENI          YTMEYSRYQPCLPATQEELIHKYLEATGQLPA---KKNKWKS--
G3P617_GASAC          YTMEFSRYQACLPASQEELMHKYLEAIGQLPA---KKNKWKA--
EFGM_DANRE            YTMEYSRYQPCAASVQEDLVNKHLEATGQLPA---KKSKWKN--
C3ZDC2_BRAFL          YAMEYCRYQHASAETQEQIIREYMEATGQLKED-KKSGKKKARN
EFGM_ANOGA            FSMEYSRYSPCMPEVQEKLCHEYQVSQGLVVD---KKQKKKN--
W5JI53_ANODA          FSMEYSRYSPCLPEVQEKLVHDYQVSQGLVVD---KKQKKKN--
EFGM_AEDAE            FSMEYSRYSPCKPDVQEKLMQDYQIAQGNVVVDAKKQQKKKN--
EFGM_DROME            FTMEYSRYSPCLPDVQDQIVRQYQESQGLAQP---DKKKKKN--
EFGM_DROPS            FTMEYSRYSPCLPDVQDQIVRQYQETQGASQP---DKKKKKN--
E9G149_DAPPU          FSMEYSRYSPALPDVQNQVINKYRESIGISTTD--SKKKKK---
A0A087ZTR9_APIME      FTMEYARYTPCLPEVEERLIREYQETNNLFSQ-----QKN----
E0VF81_PEDHC          FSMEYCKYNKCRTEVEEQLLNED-SSSDKASQ----KSRKKN--
EFGM_NEMVE            FTMEYCRYLPALAQVQAELMDRFNVEKL-------KKAKR----
F6UKC4_CIOIN          YAMEFCRYQPCREDVQDDLIRKAQEATAAPPK---KKAGGRKR-
EFGM_CAEBR            FSMEYSRYAPTSLEAQDRVQAEWRQLHGIADPN--EKGKKKKK-
EFGM_CAEEL            FSMEYSRYAPTTLEAQDRVQAEWRQLHGIADPN--EKGKKKKK-
A0DGW7_PARTE          FSLEYKRHDPVPPNEIETIIAKFKKQKR--GQ------------
A0C9U4_PARTE          FSLEYKRHDPVPPNEIETIVAKFKKHKR--GQ------------
Q22AK9_TETTS          FSMEYKSHEPIDPSQAEEVKKQYQIRRKDKGQD-----------
EFG1_ANADE            YSMQFAHYAQVPASIAETIVTKAKGVAAGAK-------------
EFG2_MYXXD            YTMQFSHYAPAPKTALNR--------------------------
EFG_KORVE             FSMHFAHYEEAPRSVAEEIVAKVQGKPAAR--------------
EFG_SOLUE             FTMHFGKYEEVPAAQAEEIVSKVQGKTTR---------------
EFG2_GEOSL            YTMTFDHYEQVPKSVSEEIVAKVKG-------------------
EFG2_PELCD            YTMVFDHYEQVPKAISEEIVARVKG-------------------
EFG_MAGMM             FTMQFGHYAQVPKSIAEEIKAKTTG-------------------
EFG_CHLAA             SSMEFDHYEPLPEALAKEIIEKRSAN------------------
EFG_HERA2             YSMEFHHYEPIPRNLQEELVEKARS-------------------
EFG_DEHM1             FSMEFESYREMPGELANQVVEAAGKK------------------
EFG_GLOVI             FSMEFSHYEEVPRNVAETIIAKNKGNA-----------------
EFG2_SYNY3            FSMEFSHYAEVPRNVAEAIVAKSRGYA-----------------
EFG_DEIRA             YSMFFDHYTQVPTNLAQQLMKK----------------------
EFG_ENTFA             FMMVFDHYEDVPKSVQEEIIKKNGGNA-----------------
EFG_OENOB             FQMFFDHYEAVPRNVQEDIIKNAGKE------------------
EFG_MESFL             YTMIFSHYAEAPRSIAEEIIKKSGK-------------------
EFG_MYCPN             YVMQFSHYAETPKSVVNEIIATKK--------------------
EFG_MYCA5             YQMWFDHYEKLPRNLADEIIKKRGGKVKIDED------------
EFG_CLOAB             FTMQFDHNEEVPKNIQEKIIGEKK--------------------
EFG_LACP7             YSMFFSTYEPVPKNVQEKVLSNKTK-------------------
EFG_FINM2             YSMQFDHYEQVPNSISEEVIGKKNNK------------------
EFG_MOOTA             YVMQFDHYEEVPKNIAEEIISKRQGA------------------
EFG_ECOLI             YTMEFLKYDEAPSNVAQAVIEARGK-------------------
EFG_WIGBR             YSMEFLRYNELPNNITESIINSNQLK------------------
EFG_HYDCU             YSMTFLKYNDAPSNIQEEIIAKAQKGE-----------------
EFG_FUSNN             YSWEFSEYLQVPASIQKQIQEERGK-------------------
EFG_SULSY             FVMTFERYEEVPRHIAEQVAGQRSKANA----------------
EFG_PARUW             YVMEPSHFERVPSKIQEEIIKK----------------------
EFG_ENDTX             YSMEPSHYEEVPSQIADKILERTTRG------------------
EFG_CUTAK             YSMEFDSYGECPSSVADEIIAKANGGK-----------------
EFG1_STRCO            YSMQFDSYAEVPRNVAEEIIAKAKGE------------------
EFG_BIFAA             FTMQMDSYAEVPKNVSEEIIKAQRGE------------------
EFG_DESAG             FTMQFDHYERVPANLAEELTKSKSGE------------------
EFG_PARD8             SSMQFSHYAQVSSSIAKQVLTEVQGRVDLIK-------------
EFG_SULMW             STMEFYKYK--PKPAPYNILNKK---------------------
EFG_SALRD             YTMQFGSYEPVPEEVASEIMDEQTMSATA---------------
EFG_CHLT3             YSMEFHDYSEVPASIANEIVEKSSGKVTA---------------
EFG_GLUOX             FTMQFHHYDPVPRNVAEEIIAKSA--------------------
EFG2_HAHCH            FSMTFSHYAETPQGVADAVLNAD---------------------
EFG1_METCA            FSMEFSHYMPCPKNVADEVIKEAQERAARK--------------
EFG1_SYNY3            FSMVFDHYAPCPTNVAEEVIKEAKERQAAA--------------
EFG_HYPNA             FTMFFDHYDEVPRAEAQKIIQEVSGS------------------
EFG_RHORT             YTMHFDHYSEVPNNVSEEIRAKMAG-------------------
EFG_NEOSM             YSMEFKEYAKMPDHIAAELVDKRVAN------------------
EFG_PSELT             HVAQFSHYKEAPDKVVEKVLKVV---------------------
EFG_THEMA             YIMQFSHYQEVPEKIAEKIIKVV---------------------
EFG_PETMO             SSIQFSHYEEVPEQVTQKLLSRE---------------------
EFG1_SYNWW            FSMEFSHYEERHLAS-----------------------------
EFG2_SYNWW            FSMKIKNFAEVPESKSREIIARRYGLPV----------------
EFG1_BDEBA            FSMEFLEYAIVPAKVKTDILHKMGRY------------------
EFG2_DESPS            FTMQFLAYDVVPANKAETIIKKIRGI------------------
EFG1_GEOSL            YTMEFSHYDRAPIEVLRRFGLEA---------------------
EFG1_PELCD            FAMEFSHYDPAPDEIQTLYGLL----------------------
EFG2_SYNAS            FTMQFYAYDQG---------------------------------
EFG3_MYXXD            ASMRLGAYEPVPEALQASYAAEARA-------------------
EFG2_STRCO            FTARPTGYAQAPAAVVR---------------------------
EFG2_BORBU            FTMEFSYFKEKLS-------------------------------
EFG2_BORAP            FTMEFSYFKEKVS-------------------------------
EFG2_BORBP            FTMEFSYFKEKVG-------------------------------
EFG1_TREDE            FTMSFSHFEIKR--------------------------------
EFG2_TREPA            FTMRFSHFESCA--------------------------------
EFG_CARRP             YNMEFHNYSETPNYILEKIKKK----------------------
EFG_RHOBA             FTMELAAYRQTPSNIQEEIIAERKKDELAGAR------------
K2LYN2_TRYCR          FGMQFKEYRPMQQYKAQIRMDERNKEIGRKLYKLAGE-------
Q38BA0_TRYB2          FGMQFKEYRPMQQYKAQCRMDERNKDLGRKLYRLSGQ-------
A4ICS8_LEIIN          FSMQFKEYRPMQQYKAQMRMDERNNDLGRKPFKLSD--------
Q4Q219_LEIMA          FSMQFKEYRPMQQYKAQMRMDERNNDLGRKPFKLSD--------
A4HNR7_LEIBR          FSMQFKEYRPMQQYKAQMRMDERNSDLGRKSFKLPD--------
Q7RFK0_PLAYO          YTMEFSRYEQVSKNDLDEILKQADKK------------------
A5K8J4_PLAVS          YTMEFARYEQVPRSDLDALQRGG---------------------
A0A1Y3DJ13_PLAKN      YTMEFARYEQVPKSDLDEILRSANNANKRCE-------------
A7AM19_BABBO          FTMEFKLYQPMNAADQEAVAKEYQESLKN---------------
Q4MYM5_THEPA          YSMEFKYYEQMSKNDQEEENKKYLQSAKKN--------------