CLUSTAL format seed alignment for MF_00059

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOA_BUCAI       -------------------------------MQNSIMDFLRPRLVDIEQI------SATH
RPOA_BUCAP       -------------------------------MQNSIIGFLKPRLVEIEQI------TATH
RPOA_ECOLI       -------------------------------MQGSVTEFLKPRLVDIEQV------SSTH
RPOA_BAUCH       -------------------------------MQGSVTEFLKPRLVDIEQL------SLTH
RPOA_WIGBR       -------------------------------MHNSATEFLKPRLVDIEQI------SKTH
RPOA_BUCBP       -------------------------------MQSSVTEFLIPRLVNIEQI------SMTH
RPOA_BLOFL       -------------------------------MQSFEKEFLKPRSINIEKI------SEIH
RPOA_BLOPB       -------------------------------MQNSVIEFLKPRLVDIEQI------TETR
RPOA_BUCCC       -------------------------------MQGFVEDFLKPRLVDIQQI------SATH
RPOA_COLP3       -------------------------------MQGSVTEFLRPRLVGIETV------SPRR
RPOA_PSEA6       -------------------------------MSGSVTEFLKPRLVEIDNV------SPTR
RPOA_SHEAM       -------------------------------MQGSVTEFLKPRLVDIEQV------SPTR
RPOA_AERS4       -------------------------------MLGSVTDFLKPRLVDIEQV------SPTH
RPOA_PSEHT       -------------------------------MQGSVTEFLKPRLVDIDAI------NPTR
RPOA_IDILO       -------------------------------MQGSVTEFLKPRLVDIEQI------SPTH
RPOA1_PSYIN      -------------------------------MQGFVKDFLKPNLVGIEQI------NATR
RPOA2_PSYIN      -------------------------------MQGSVIEFLKPNLVGIEQI------NATR
RPOA_ACIBT       -------------------------------MTRTANEFLTPQAIKVEAV------SGTS
RPOA_PSYCK       -------------------------------MMLNATEFLTPNAINVDTV------NETI
RPOA_HAHCH       -------------------------------MQRSLNEFLTPRTIEVNQI------NATH
RPOA_MARHV       -------------------------------MQRSVHELLTPRTIDVKES------SATR
RPOA_PSEE4       -------------------------------MQISVNEFLTPRHIDVQVV------SPTR
RPOA_SACD2       -------------------------------MQSAVNEFLTPRHIDVTEL------GPTR
RPOA_CHRSD       -------------------------------MQRSVTEFLRPRDIKVEEI------NANH
RPOA_ALCBS       --------------------------------MTAVNDFLTPRSIAVNAI------NQTH
RPOA_NITOC       ---------------------------------MQVSNFLKPRIVDVQRI------NDYA
RPOA_XANOM       -------------------------------MTVTANQVLRPRGPQIERL------TDNR
RPOA_XYLFT       -------------------------------MTVTVSQVLRPRGPQIERL------TENR
RPOA_ALKEH       -------------------------------MQGTFRDFLKPRTVDIQEQ------GERR
RPOA_HALHL       -------------------------------MKGYLKDFLKPRSVEIEPL------SDNR
RPOA_AZOSB       ---------------------------------MQSNALLKPRIIDVQSI------SPVQ
RPOA_NITMU       ---------------------------------MQSNTFLTPRIIDVQNI------SPLH
RPOA_DECAR       ---------------------------------MQSSGLLKPRIIDVQSV------SPVQ
RPOA_POLNA       ----------------------------------MQTNLLKPKTINVEQL------GANR
RPOA_RHOFT       ----------------------------------MQNSLLKPKAINVEQM------GGNR
RPOA_METPP       ----------------------------------MQTNLLKPKAINVEPLSAA--KGAHR
RPOA_RALSO       ----------------------------------MQTALLKPKIIAVEPL------GDHH
RPOA_BORA1       ---------------------------------MSTQGFLKPRSIEVEPV------GPNH
RPOA_NEIG1       -------------------------------MQNSTTEFLKPRQIDVNTF------SATR
RPOA_CHRVO       -------------------------------MQNSASEFLKPRLIDVQPV------SATH
RPOA_THIDA       --------------------------------MQSATEFLKPRIVEVDRA------SPLH
RPOA_METFK       -------------------------------MQNSPTEYLKPRVVDVDVI------SPVR
RPOA_NITEC       ---------------------------------MSSNSFLTPRIIEVHNL------SPLR
RPOA_METCA       -------------------------------MHNSLAELIKPRTVEVVPH------GSHS
RPOA_LEGPA       -------------------------------MYTEINEMLTPKVLKVQAE------SPYK
RPOA_COXBU       -------------------------------MQNVLKSFLTPKNIQVQTI------SPCH
RPOA_HYDCU       -------------------------------MQEMLEQLLTPRLVDIKTV------NGFN
RPOA_DICNV       ---------------------------------MALTELLTPRIVQIKEI------GSNT
RPOA_VESOH       -------------------------------MQGSARDFLKPKLVESSQT------GVNE
RPOA2_FRAT1      ---------------------------------MALENLLHPTNIKIDEY------AKNA
RPOA1_FRATN      ------------------------------MSNNNSKQEFVPNIQLKEDL------GAFS
RPOA_NEOSM       --------------------------MSAVLDKGSLVDVFSSPSVVFNQIR-----EGYC
RPOA_KORVE       ---------------------------------MLWKGFQKPKRLAF-DSES---LTDKY
RPOA_SOLUE       ----------------------------------MFKGFQKPKRLVA-NTET---LTERY
RPOA_LEPBL       -----------------------------MSLKSLLKGFKRPKKIEF-NTEA---STPNY
RPOA_ANADE       --------------------------MVDPIVTKNWRDLIKPRGLVV-DQDS---LSNTY
RPOA_MYXXD       --------------------------MADTFVAKNWRDLIKPRRMEV-DQDS---ATPTY
RPOA_GEOMG       -------------------------------MYRNWRDLISPKKLQV-ESES---LTNTY
RPOA_GEOSL       -------------------------------MYRNWRDLISPKKLQV-ESET---LTNKY
RPOA_PELPD       -------------------------------MYKNWRDLIRPKQLQF-EKES---LSDTY
RPOA_PELCD       -------------------------------MYKNWRELIKPKRLQV-DADS---LSDTY
RPOA_SYNFM       -------------------------------MQRNWRELIKPKRLEV-ETKG---LPNTY
RPOA_BDEBA       ---------------------------MQEHYYKFWREMIKPKGFEV-DRDS---LRDDY
RPOA_SYNAS       -------------------------------MVRNWCSLIRPRRIEI-DEST---HTRFY
RPOA_DESPS       ---------------------MTQEIDEKIPVYRNWHELIRPEKVEI-DQSN---HSETY
RPOA_DESVV       ---------------------MLIKQGDRLINTRNWSELVKPEQISR-DGEV---SDTMY
RPOA_DESAG       ---------------------MLIKQGDRLINTRNWSELVKPDQISR-ASES---ADTMY
RPOA_LAWIP       ---------------------MLFREGTRLINSRNWAKLVRPEAVIN-NMES---NTTTY
RPOA_RHILO       ------------------------------MIQKNWQELIKPNKIEF-SSK----KKT-L
RPOA_BRUME       ------------------------------MIQKNWQELIKPNKVDF-ITHG---SRT-H
RPOA_BARQU       ------------------------------MIQKNWQELIKPNKVEF-CTHD---NPN-I
RPOA_BARBK       ------------------------------MIQKNWQELIKPNKIEF-HAHS---NPN-V
RPOA_NITWN       -----------------------------MTIQKNWQELIRPNKLQV-VPGS---DPSRF
RPOA_CAUVC       ------------------------------MIERNWNELIRPEKPQI-ETGA---DATRK
RPOA_MARMM       ------------------------------MIEKNWQELIRPMKPEI-EPGH---DPARQ
RPOA_MAGSA       ------------------------------MIQKNWQELIKPNKLHV-EPGA---DPQRT
RPOA_RHORT       ----------------------------MSVIQKNWQELIKPNKLMI-ELVG---GSKKV
RPOA_GRABC       -----------------------------MVIQRNWQSLIKPEKLDV-EPGN---EPSRI
RPOA_ROSDO       ------------------------------MIHKNWAELIKPQQLDV-KPGN---DPARQ
RPOA_JANSC       ------------------------------MIHKNWQELIKPTQLVV-QPGT---DPARK
RPOA_PARDP       ------------------------------MIHKNWAELIKPTQLEI-KPGA---DSSRV
RPOA_HYPNA       ---------------------------MTTVNDRNWKVLIRPNRPVV-QAGY---DAKRK
RPOA_NOVAD       ----------------------------MTVNIKNWQELKKPNNLEI-KPGN---DSKRR
RPOA_SPHAL       ----------------------------MTVNIRNWQELKKPSNLEI-KTGG---DGKRK
RPOA_ERYLH       ----------------------------MSVNTKNWQELKKPTQLDV-KESS---DKARK
RPOA_ZYMMO       ----------------------------MAVNAKNWQELKKPNALEK-KASG---NGKCK
RPOA_PELUB       -------------------------MESLNVNAKNWKALIKPAQLDV-KISD---DKS-H
RPOA_MAGMM       -------------------------------MYRNWTELIKPHTIELGGDET---EIQRK
RPOA_RICTY       ----------------------------MLSLSKNWNTLIKPNRVTYENFPE---TNN-K
RPOA_RICBR       ----------------------------MLSLSKNWNALIKTDKVSYESFPE---TNN-K
RPOA_ANAMM       -----------MAISDNGGGSVGLCYGSEFSISDHWDKLTRPSSIKVVGDGD---LSR-S
RPOA_ANAPZ       -------------------------------MADHWNKLTRPSSIKVVG-GK---EPC-V
RPOA_EHRRW       MIFDEDSSSVAQESGYMGVGSPYSSDVGRISMSDHWNKLTKPSSIKVVNHGN---ALN-K
RPOA_WOLPM       -----------------------MYYNNDVSLCSNLDKLIKPSSVKVVS-DD---SSE-K
RPOA_WOLTR       -----------------------MYYDDGIPVFDSLDKLTKPNSMKVVS-SD---SSE-K
RPOA_RHOBA       -----------------------------MTMHIRWRGMELPSSLEV-DRDS---LTQTY
RPOA_TREDE       -----------------------------MARKNLLKGFKKPKGLEF-AQQE---STESY
RPOA_TREPA       -----------------------------MPRRNLLKGFKRPKVLEF-LSEN---SSECY
RPOA_BORBP       -----------------------------MPVEKFLKDFTIPEKIEF-LKSQ---DDGSY
RPOA_BACTN       ---------------------------------MAILAFQKPDKVLM-LEA-----DSRF
RPOA_PORGI       ---------------------------------MAILAFQKPENVLM-MET-----SDSI
RPOA_GRAFK       ---------------------------------MAILNFQKPDKVIM-IDS-----TDFE
RPOA_CYTH3       ---------------------------------MSILSFQMPEKVVM-EKA-----DDFH
RPOA_PELLD       ----------------------------------MIYQMQMPAKIEV-DEAT---HTDQY
RPOA_CHLPD       ----------------------------------MIYQMQMPAKIEV-DEAT---HTEMF
RPOA_CHLTE       ----------------------------------MIYQMQMPTKIDV-DEAT---HTGSF
RPOA_CHLCH       ----------------------------------MIYQMQMPAKIEL-DESS---HSDSF
RPOA_SALRD       ---------------------------------MSNHGLQMPEGVHV-EEV-----SDSE
RPOA_CAMJE       -------------------------------MRNITTSAYTPTEFTIENISDT------V
RPOA_CAMFF       -------------------------------MKKITTSAYMPTEIEVVNVSEN------V
RPOA_HELHP       -------------------------------MNMIKIEPYIPTDISIEEISTN------R
RPOA_WOLSU       -------------------------------MKNIKTSPYIPTDISIQEIGKN------K
RPOA_HELAH       -------------------------------MKVIKTAPLIPSEIKVLEKEGN------R
RPOA_SULDN       -------------------------------MKKIKTTPLAPQEFEVEQISEN------E
RPOA_CHLMU       --------------------------MSDNSHNLLYNKFELPESVKMSPVEGAAGGIDKV
RPOA_CHLFF       --------------------------MSDNSQNLLYDKFELPKSVKMMTVEGSGGSIDKH
RPOA_CHLPN       --------------------------MSDNAHNLLYDKFELPEAVKMLPVEGL--PIDKH
RPOA_PARUW       -------------------------------MSVKYGKFEMPHKITVDQESPE----SNF
RPOA_AQUAE       ----------------------------------MLNEFIYPDKIFWEEKTDT------Y
RPOA_THEMA       -----------------------------------MIEFVIPKKLKVEEEREER--DYYY
RPOA_COREF       -----------------------------------MLISQRPT--LTEEF-----IDSSR
RPOA_CORDI       -----------------------------------MLISQRPT--LTEEY-----VDSAR
RPOA_CORJK       -----------------------------------MLISQRPA--LTEEF-----IDDSR
RPOA_BIFAA       -----------------------------------MLIAQRPT--LTEES-----LNPQR
RPOA_FRAAA       -----------------------------------MLIAQRPT--LVEDP-----ISEFR
RPOA2_STRAW      -----------------------------------MLIAQRPS--LTEEV-----VDEFR
RPOA_THEFY       -----------------------------------MLIAQRPT--LTEEP-----ISEFR
RPOA_ACIC1       -----------------------------------MLIAQRPT--ITEEP-----VHDTR
RPOA_ARTS2       -----------------------------------MLIAQRPT--LSEEV-----VSENR
RPOA_NOCSJ       -----------------------------------MLIAQRPT--LSEET-----VDEFR
RPOA_MYCLE       -----------------------------------MLISQRPT--LSEDI-----LTDNR
RPOA_MYCS2       -----------------------------------MLISQRPT--LSEET-----VAENR
RPOA_RHOJR       -----------------------------------MLISQRPT--LTEEV-----IADNR
RPOA_SACEN       -----------------------------------MLISQRPS--LAEEA-----VAETR
RPOA_CUTAK       -----------------------------------MLIAQRPT--LTEES-----ISEFR
RPOA_LEIXX       -----------------------------------MLIAQRPT--LTEEN-----ISEFR
RPOA_TROWT       -----------------------------------MLIAHRPT--LIEKK-----VSDIR
RPOA_RUBXD       ----------------------------------MMLDVAPPR--FRVEE-----EDERH
RPOA_GEOTN       -----------------------------------MIEIEKPK--IETVEL---SEDAKY
RPOA_BACHD       -----------------------------------MIEIEKPV--IETIEI---SEDAKY
RPOA_OCEIH       -----------------------------------MIEIEKPK--IETVEI---SENATF
RPOA_LISW6       -----------------------------------MIEIEKPK--IETIEI---SDDAKY
RPOA_STAS1       -----------------------------------MIEIEKPR--IETIEI---SEDAKF
RPOA_LACPL       -----------------------------------MIEFEKPN--IHKID-----ENDNY
RPOA_LACBA       -----------------------------------MIEFEKPN--IHKID-----ESNNY
RPOA_LACS1       -----------------------------------MIEFEKPK--IHKIE-----EDNNY
RPOA_LACP3       -----------------------------------MIEFEKPN--ITKVD-----ESTNY
RPOA_PEDPA       -----------------------------------MIEFEKPK--IHKID-----ENDNY
RPOA_ENTFA       -----------------------------------MIEFEKPR--IEKID-----ENRDY
RPOA_CLONN       -----------------------------------MLEIEKPK--IECVEA---SEDGTY
RPOA_CLOAB       -----------------------------------MLEIEKPK--IECVES---TEDGSY
RPOA_CLOTE       -----------------------------------MLEIEKPK--IECIEM---TENGSY
RPOA_CLOPS       -----------------------------------MLEIEKPV--IQCVES---NDNGTY
RPOA_CLOD6       -----------------------------------MIEIEKPK--VDIVEL---SEDYRY
RPOA_CARHZ       -----------------------------------MLEIEKPK--IETEEL-----NDRY
RPOA_MOOTA       -----------------------------------MLEIEKPK--IECQHL-----DDKY
RPOA_DESHY       -----------------------------------MLEIEKPK--IECVER---TDDNSY
RPOA_HUNT2       -----------------------------------MIEIEKPK--IECVVC---SEDNRY
RPOA_SYMTH       -----------------------------------MIGMEKPK--IETVVL---AEDNSY
RPOA_CALS4       -----------------------------------MFEIIEPK--IEIVEQ---SEDGRY
RPOA_SYNWW       -----------------------------------MLEMEKPR--IDCVEK---NSSSNY
RPOA_LACGA       -----------------------------------MIEFEKPN--ITVVD-----QEEAY
RPOA_LACAC       -----------------------------------MIEFEKPN--ITVVE-----QEDSY
RPOA_LACDB       -----------------------------------MIEFKKPN--ITVVD-----QEDSY
RPOA_STRSV       -----------------------------------MIEFEKPN--ITKID-----ENKDY
RPOA_STRS2       -----------------------------------MIEFEKPT--ITKID-----ENKDY
RPOA_LACLS       -----------------------------------MIEFEKPK--ITKFD-----ESENY
RPOA_LEUMM       -----------------------------------MIEFEKPN--IHNIE-----EDARY
RPOA_OENOB       -----------------------------------MIEFQKPT--ISTVE-----ESENY
RPOA_DEIGD       --------------------------------------MDQKR--PQLKAR---VEG-DY
RPOA_DEIRA       --------------------------------------MEQKR--PQLKAR---VDG-DY
RPOA_THET8       -----------------------------------MLDSKLKA--PVFTVR---TQGREY
RPOA_FUSNN       -----------------------------------MLKIEKQAKAIKITEV---KESNYK
RPOA_MYCMS       -----------------------------------MKQFVRPEFILLKEG-----QDKNY
RPOA_MESFL       -----------------------------------MKQFNKPEFGIVKES-----PNKFY
RPOA_MYCGE       -----------------------------------MEKFLKYEIKVNNNQPT--NTNPNY
RPOA_MYCPN       -----------------------------------MEKFLKYEIKVNNEQ-A--RANPNY
RPOA_MYCGA       -----------------------------------MQQFLRYNINVIKED-----NDKNY
RPOA_MYCPE       -----------------------------------MEKFLRYNIQIGKDQ----NKDADY
RPOA_UREPA       -----------------------------------MRKFLKYQLDVPSIN----SEDKNR
RPOA_MYCMO       -----------------------------------MEKFIKINWTENKTK----RINDFS
RPOA_MYCPU       -----------------------------------MKKMVQIKYKEVKTK----RVNDYE
RPOA_MYCH7       -----------------------------------MKKHAKVYYSENLVE----QVNEFE
RPOA_MYCS5       -----------------------------------MEKLTKIKHRIIPAKDS--QNNSYK
RPOA_AYWBP       -----------------------------------MKNLKFIKPFFVEEID----ENPIS
RPOA_DEHMC       -----------------------------------MSDLAIPTISCTESD-------GKY
RPOA_OSTTA       ----------------------------------MIKAAATLKSLQYRQNS----LTDCY
RPOA_SINAL       ----------------------------MVREKVKVST--RTLQWKCVESRR-DSKRLYY
RPOA_AETGR       ----------------------------MVREKVKVST--RTLQWKCVESRR-DSKRLYY
RPOA_LIRTU       ----------------------------MVREEVAVST--RTLQWKCVESRT-DSKRLYY
RPOA_DRIGR       ----------------------------MVREEVAVST--RTLQWKCVESRT-DSKRLSY
RPOA_ACOCL       ----------------------------MVREEVVGST--RALQWKCVESRA-DSKRLYY
RPOA_VITVI       ----------------------------MVREKVTVST--RTLQWKCVESRV-DNKRLCY
RPOA_PLAOC       ----------------------------MVREKVTVST--RTLQWKCVESRA-DSKRLYY
RPOA_NANDO       ----------------------------MLREEVAVST--RTLQWRCVESRT-DSKRLYY
RPOA_RANMC       ----------------------------MLRDEVAVSA--RTLQWKCVESRA-DSKRLYY
RPOA_NICTO       ----------------------------MVREKVTVST--RTLKWKCVESRT-DSKRLYY
RPOA_PANGI       ----------------------------MVQEKVRVST--RTLQWKCVEARA-DSKRLYY
RPOA_COFAR       ----------------------------MVREKITVST--RTLEWKCVELRT-DSKRLYY
RPOA_LACSA       ----------------------------MVREKITVST--RTLQWKCVESAA-DSKRLLY
RPOA_SPIOL       ----------------------------MVREKIRVST--QTLQWKCVESRT-DSKCLHY
RPOA_EUCGG       ----------------------------MVREKVRVST--RTLQWKCVESRA-DSKRLYY
RPOA_OENEH       ----------------------------MVREKVRVST--RTLQWKCVESRV-DSKRLYY
RPOA_CITSI       ----------------------------MVREKVKVST--RTLQWKCVESRA-DSKRLYY
RPOA_GOSBA       ----------------------------MVREKVKVSTSTRTRQWKCVESRT-DSKRLYY
RPOA_POPTR       ----------------------------MVREKVRIST--RTLQWKCVESRA-DSKRLYY
RPOA_CUCSA       ----------------------------MVREKIRVST--RTLKWKCVESRA-DSKRLYY
RPOA_MORIN       ----------------------------MGQEKVTVST--RPLQWKCVESRA-DSKRLYY
RPOA_JASNU       ----------------------------MVREKVRVST--RTLQWKCVESRE-DSKRLYY
RPOA_PHAVU       ----------------------------MVQEKLRVST--RTLQWKCVESRI-DSKRLYY
RPOA_LOTJA       ----------------------------MVREKVRVST--RTLQWKCVESRI-DSKRLYY
RPOA_PIPCE       ----------------------------MVREEIAVAT--GAPRWKCVESRI-DSKRLYY
RPOA_AMBTC       ----------------------------MVRKEVPVSN--RTLQWKCVESKA-DSKRLYY
RPOA_NYMAL       ----------------------------MVREEVPVST--RTLQWKCVESRA-DSKRLYY
RPOA_ORYSJ       ----------------------------MVREEVAGST--QTLQWKCVESRV-DSKRLYY
RPOA_PHAAO       ----------------------------MVREDVVGST--RTLQWKCVESRV-DSKRLYY
RPOA_PINTH       ----------------------------MIRDEISVSI--QTLRWKCIESRA-YSKRLHY
RPOA_PSINU       ----------------------------MIQDEIPIPV--QTLQWKCIESKK-EGKRLHY
RPOA_ANGEV       ----------------------------MIQDEVPVSA--QTIQWRCIESKI-ESKRLHY
RPOA_MARPO       ----------------------------MIQDEIKVST--QTLQWKCIESKI-ESKRLLY
RPOA_ANTAG       ----------------------------MIQNEIPIPA--EALQWKCIESKI-DSERLHY
RPOA_HUPLU       -------------------------MNDLDLNLVPPTA--GSAYWRCVESKV-ESERLFY
RPOA_ADICA       ----------------------------MRKNEMSTSK--QAIQWKCLESKI-ESKRLHY
RPOA_CHAGL       ----------------------------MADQTISNVL--NQPQWRCLESKI-EKSTLHY
RPOA_CHAVU       ----------------------------MIQNVTDDKI-----QWKCLESKI-ESQRIHY
RPOA_STAPU       ----------------------------MEKKTGLIQF---LSEWKCVDDQPDHNRRLHY
RPOA_ZYGCR       ------------------------------MNLHRISS---EPKCKCLNHEI-QNARLHY
RPOA_MESVI       ----------------------------------MSGNDLFPSTIYCIESKI-ESPRNLY
RPOA_CHLAT       ----------------------------------MAHQRIVGPTIECIESRI-ESRRNHY
RPOA_PYRYE       ---------------------------------------MAQFQIECIESRT-DGARGQY
RPOA_GRATL       ---------------------------------------MTYFQIECVESKT-ESNRQQY
RPOA_GUITH       ---------------------------------------MTQFEIECLDSKV-YNARDHW
RPOA_CYAPA       ---------------------------------------MTQFQIECVESKV-ESSCNQY
RPOA_CYACA       -----------------------------------MLGKVNGVQIECLESMV-INSREIY
RPOA_CYAM1       ---------------------------------MCMSQFPIEFQIECAASTI-NHARDIY
RPOA_TRICV       -------------------------------------MN--NFYIKCLKSKK-VESGSIY
RPOA_THAPS       -------------------------------------MNSSNLLMECIKSEK-IESGPMY
RPOA_PHATC       -------------------------------------MN--NISIKCLKSEK-IQSGACH
RPOA_TRIV2       ---------------------------------------MAQFQIECVESNT-EESRNHY
RPOA_TRIEI       ---------------------------------------MAQFHYECVESKT-DKDRSQY
RPOA_SYNY3       ---------------------------------------MAQFQIECVESST-RKNQQQY
RPOA_SYNE7       ----------------------------------------MTFQVECVESRT-EADQGQY
RPOA_SYNJA       ---------------------MMQTSRTLHNLGSKAASSAAPYQTECVESHQ-EANGVHY
RPOA_GLOVI       ---------------------------------------MAQYTIECVETRT-EADNGQY
RPOA_THEEB       ----------------------------------------MAYQIECLETRV-EEDQGQY
RPOA_SYNS3       ---------------------------------------MLQYQIDRIEHQI-TDDRSQT
RPOA_SYNPX       ---------------------------------------MLQYQIDRIEHQV-EEDRSQS
RPOA_PROMA       ---------------------------------------MLQYQIDRIEHQV-SDDRSQT
RPOA_PROM5       ---------------------------------------MLQYQIDRIDHQT-ANDRSQT
RPOA_PROM1       ---------------------------------------MLQYQIDRIDHQV-SNDRSQT
RPOA_EMIHU       -----------------------------------------MFQVQCLESAQ-KAATENV
                                                                             

RPOA_BUCAI       TKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSTKEGV
RPOA_BUCAP       TKVTLEPLERGFGHTLGNALRRILLSSMPGYAVTEVEI-DG--------VLHEYSTKEGV
RPOA_ECOLI       AKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSTKEGV
RPOA_BAUCH       AKVILEPLERGFGHTLGNALRRILLSSIPGYAVTEVEI-DG--------ILHEYSTKEGI
RPOA_WIGBR       AKITLEPLERGFGHTLGNALRRILLSSMPGYAVTEVEI-DG--------ILHEYSSKEGV
RPOA_BUCBP       VKITLEPLERGFGHTLGNALRRILLSSMPGFAVTEVEI-DG--------ILHEYSTKEGV
RPOA_BLOFL       SKITLEPLERGFGHTLGNALRRILLSSMPGCAITEVEI-EG--------VLHEYGTKEGV
RPOA_BLOPB       AKVTLEPLERGFGHTLGNALRRILLSSMPGYAITEVEI-DG--------VLHEYSTKEGI
RPOA_BUCCC       AKITLEPLERGFGHTLGNALRRILLSSISGCAVTEVEI-DG--------ILHEYMHKEGV
RPOA_COLP3       AKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSSKEGV
RPOA_PSEA6       AKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSTKEGV
RPOA_SHEAM       AKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSSKEGV
RPOA_AERS4       AKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSSKEGV
RPOA_PSEHT       SKIVLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSAKEGV
RPOA_IDILO       AKVTLEPLERGFGYTLGNALRRILLSSMPGCAVTEVEI-DG--------VLHEYSSKEGV
RPOA1_PSYIN      AKVTLEPLERGFGHTLGNALRRILLSSMPGAAITEVEI-DG--------VQNEYSIKEGV
RPOA2_PSYIN      AKVTLGPLERGFGHTLGNALRRILLSSMPGTAVTEVEI-DG--------VQHEYSTKEGV
RPOA_ACIBT       AKVILEPLERGFGHTLGNALRRILLSSLPGAAVVEVEI-EG--------VEHEYSTLEGL
RPOA_PSYCK       AKVTLEPLERGFGHTLGNALRRILLSSLPGAAVIEAEI-DG--------VDHEYSTLEGL
RPOA_HAHCH       AKVTLEPLERGFGHTLGSALRRILLSSMPGCAVVEVEI-DG--------VLHEYSTVEGV
RPOA_MARHV       AKVTLEPLERGFGHTLGSALRRILLSSMPGCAVTEAQI-DG--------VLHEYSAIEGV
RPOA_PSEE4       AKITLEPLERGFGHTLGNALRRILLSSMPGCAVVEAEI-DG--------VLHEYSAIEGV
RPOA_SACD2       AKVVLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEI-DG--------VQHEYSAIEGV
RPOA_CHRSD       AKIVLEPFERGFGHTLGNALRRILLSSMPGCAVVEAEI-EG--------VLHEYSAIEGV
RPOA_ALCBS       AKVVLEPLERGFGHTLGTALRRILISSMPGCAITEVEI-DG--------VQHEYSSIEGV
RPOA_NITOC       TKVTLEPLERGFGHTLGNALRRILLSSMPGCAIIEAQI-DG--------VLHEYTTKEGV
RPOA_XANOM       AKVVIEPLERGYGHTLGNALRRVLLSSIPGFAITEVEI-DG--------VLHEYTTVEGL
RPOA_XYLFT       AKVVLEPLGRGYAHTLGNALRRVLLSSIPGFAITEVEI-DG--------VLHEYTTVEGL
RPOA_ALKEH       AKIVLEPLERGFGHTLGNALRRVLLSSMPGSAVVQAEI-EG--------VEHEYSSMEGV
RPOA_HALHL       AKVVLEPLERGFGHTLGNALRRLLLSSMPGTAVTEVEI-EG--------VQHEYTAVEGI
RPOA_AZOSB       ARVTMEPFERGFGHTLGNALRRILLSSLPGHAPTEVSI-EG--------VLHEYSTLDGM
RPOA_NITMU       ARITMEPFERGYGHTLGNALRRILLSSMPGFAPTEVQI-SG--------VVHEYSALDGV
RPOA_DECAR       AKVVMEPFERGYGHTLGNALRRILLSSMVGYAPTEVGI-DG--------VLHEYSTVDGV
RPOA_POLNA       AKVTLEPFERGYGHTLGNALRRVLLSSMVGHAATEVTI-AG--------VLHEYSSIDGV
RPOA_RHOFT       AKVALEPFERGYGHTLGNALRRVLLASMPGYAATEVTI-AG--------VLHEYSSIDGV
RPOA_METPP       AKVTLEPFERGYGHTLGNALRRVLLSSMVGYAPTEVTI-AG--------VLHEYSAIDGV
RPOA_RALSO       AKVVMEPFERGYGHTLGNALRRVLLSSMVGYAPTEVTI-AG--------VVHEYSTIDGV
RPOA_BORA1       AKIVMEPFERGYGHTLGNALRRILLSSMTGYAPTEVQM-TG--------VVHEYSTIPGV
RPOA_NEIG1       AKVSMQPFERGFGHTLGNALRRILLSSMNGFAPTEVAI-AG--------VLHEYSTVGGV
RPOA_CHRVO       ARVSMEPFERGYAHTLGNSLRRILLSSMPGYAPTEVTI-AG--------VLHEYSALDGV
RPOA_THIDA       AKVIMEPFERGYGHTLGNALRRILLSSMVGYAPTEVAI-SG--------VVHEYSTIEGV
RPOA_METFK       ARVTLEPMERGFGYTLGNALRRVLLSSIPGFAITEVKI-DG--------VVHEYSTLDGV
RPOA_NITEC       AKVVMEPFERGFGYTLGNALRRVLLSSIPGCAPTKISI-SG--------VVHEYSTIDGL
RPOA_METCA       ARVVIEPLERGFGHTLGNALRRVLLSAIPGAAVTDVVI-DG--------VLHEYSTIEGV
RPOA_LEGPA       ARIVLEPLERGFGHTLGNALRRILLSSMPGSAITEASI-DG--------VLHEYSTIEGV
RPOA_COXBU       FRILLEPLERGFGHTLGNALRRILLSSMPGAAIVQAEI-DG--------VLHEYSSIEGV
RPOA_HYDCU       SRVTLEPLERGFGHTLGNALRRILLSSMPGAAIVEAQI-DG--------VLHEYSAIEGV
RPOA_DICNV       SRVTLEPLERGFGYTLGTALRRVLLSSIEGAAITECQI-DG--------VSHEYSAIEGV
RPOA_VESOH       FKVILEPLERGFGHTLGNAIRRTLLSSMTGFAVTEVVI-DG--------VMHEFSTIDGV
RPOA2_FRAT1      TKFSFEALERGVGYTLGFALKQTMLYSIAGACVTSIKINDG--------KVTSLEDVIPC
RPOA1_FRATN      YKVQLSPVEKGMAHILGNSIRRVLLSSLSGASIIKVNI-AN--------VLHEYSTLEDV
RPOA_NEOSM       AEFIVEPLRVGFGLTIGNAMRRVLLSSLSGFAISAVGI-KG--------LTHEFSCIPGV
RPOA_KORVE       GHFWAQPFERGFGTTIGNALRRVLLSSIEGAAITAVKIEG---------VLHEFQSIPGV
RPOA_SOLUE       GMFTAQPFQRGFGTTIGNSLRRVLLSSIEGAAITAVRIEG---------VEHEFSPIPGV
RPOA_LEPBL       GKFVAEPFERGFATTIGNSLRRTLMSSIEGAAISAIRIEG---------VNHEFSFIEGV
RPOA_ANADE       GKFVAEPLERGFGITLGNSLRRVLLSSLQGAAITSVKVEG---------VEHEFMTIPEV
RPOA_MYXXD       GKFVAEPLERGFGTTLGNSLRRVLLSSLQGAAITTVKIEG---------VDHEFTTIPEV
RPOA_GEOMG       GKFFAEPFERGFGTTLGNSLRRVLLSSLQGAAISSVKIKG---------VLHEFSSIPGV
RPOA_GEOSL       GKFYAEPFERGFGTTLGNSLRRVLLSSLQGAGITSVRIKG---------VLHEFSSIPGV
RPOA_PELPD       GKFFAEPFERGFATTLGNSLRRILLSSLQGSAITSVRIKG---------VLHEFSAIQGV
RPOA_PELCD       GKFMAEPFERGFGTTLGNSLRRVLLSSLQGAAITSVRIKG---------VLHEFSNIPGV
RPOA_SYNFM       GKFECEPLERGFGITLGNALRRVLLSSLQGAAITSVKVDG---------VLHEFSTIPGV
RPOA_BDEBA       AKFIIRPLERGFGVTLGNSLRRILLSSMMGSAITAVKFEG---------VLHEFTTIPDV
RPOA_SYNAS       GEFVCQPLERGFGITLGNALRRVLLSSIQGAAIVSVKIDN---------VLHEFSTVPGV
RPOA_DESPS       GKFICQPLERGFATTIGNSLRRILLSSIQGAAITTVKIEG---------ALHELTSMKDV
RPOA_DESVV       GKFVCEPLERGYATTIGNAMRRVLLSSLQGAAFVAVKISG---------VQHEFTTIPGV
RPOA_DESAG       GKFVCEPLERGYGTTIGNAMRRVLLASLQGAAFVAVKISG---------VQHEFTTIPGV
RPOA_LAWIP       GRFEYEPLERGYGITIGNALRRVLLSSLQGAAFVSVKILG---------VQHEFTTIPGI
RPOA_RHILO       TTLVAEPLERGFGLTLGNALRRVLLSSLRGAAVTAVQIDG---------VLHEFSSIAGV
RPOA_BRUME       ATVVAEPLERGFGLTLGNALRRVLLSSLRGAAVTAVQIDG---------VLHEFSSIPGV
RPOA_BARQU       SSVIVEPLERGFGLTLGNALRRVLLSSLRGAAITAVQIDG---------VLHEFSSIPGV
RPOA_BARBK       LSVVAEPLERGFGLTLGNALRRILLSSLRGAAITAVQVEG---------VLHEFSSIPGV
RPOA_NITWN       ATLIAEPLERGFGQTLGNALRRILLSSLQGAAVQSVHIDG---------VLHEFSSIAGV
RPOA_CAUVC       ARIVAEPLERGFGVTLGNALRRVLLSSLQGAAVTAIQIDG---------VVHEFSSLEGV
RPOA_MARMM       AKIVAEPLERGFGMTLGNALRRVLLSSLQGAAVTNVHIDG---------VVHEFSSIDGV
RPOA_MAGSA       AIVVAEPLERGFGMTLGNSLRRVLLSSLQGAAVTAIQIDG---------VLHEFSSIPGV
RPOA_RHORT       ATVVAEPLERGFGLTLGNALRRVLLSSLQGAAVTAIQIEG---------VLHEFSSIPGV
RPOA_GRABC       ATIVAEPLERGFGMTLGNAIRRILLSSLQGAAVTAVQIDG---------VLHEFSSVAGV
RPOA_ROSDO       ATVTAEPLERGFGLTMGNALRRVLMSSLQGAAITSVQIDN---------VLHEFSSVAGV
RPOA_JANSC       ATVVAEPLERGFGLTLGNALRRVLMSSLQGAAITSVQIDG---------VLHEFSSVAGV
RPOA_PARDP       ATVVAEPLERGFGLTLGNALRRVLLSSLQGAAITSVQIDN---------VLHEFSSVPGV
RPOA_HYPNA       AKLVVEPLERGYGTTLGNALRRVLLSSLQGAAIIGVQIDG---------VVHEFSAIPGV
RPOA_NOVAD       ATFVAEPLERGFGLTLGNALRRVLLSSLQGAAVTSIKIEN---------VLHEFSSLAGV
RPOA_SPHAL       ATFVAEPLERGFGLTLGNALRRVLLSSLQGAAITSIKIEN---------VLHEFSSLAGV
RPOA_ERYLH       ATFIAEPLERGYGLTLGNALRRVLLASLQGAAITSIKIEN---------VLHEFSSLAGV
RPOA_ZYMMO       ATFVAEPLERGFGLTLGNALRRVLLSSLQGAAITAIKIEN---------VLHEFSSLNGV
RPOA_PELUB       AKIIAEPLEKGYGLTLGNSLRRILLSSIRGAAVTSIQIDG---------VLHEFTSIKGV
RPOA_MAGMM       ATLVAEPLERGFGTTLGNALRRVLLSSLQGAAVSTVRIEG---------VLHEFSSVPGV
RPOA_RICTY       AKIIVEPLERGFGLTLGNAMRRVLLSSLQGAAITSIKIPA---------IEHEFSSIPGV
RPOA_RICBR       SKIIVEPLERGFGLTLGNAMRRVLLSSLQGAAVTSIKIPG---------IEHEFSSIPGV
RPOA_ANAMM       AELIVEPLESGFALTLGNALRRVMMSSLRGFAVYGIEVEG---------VSHELTSLSGV
RPOA_ANAPZ       MELVIEPLESGFALTLGNALRRVMMSSLRGFAVYGIEIEG---------ASHELTALSGV
RPOA_EHRRW       ADLIIEPLESGFALTLGNALRRVMMSSLRGFAVYGVEIEN---------VLHEFTSISGV
RPOA_WOLPM       SDIVLEPLESGFALTLGNALRRVMLSSLKGSAVYGIKIEG---------VTHEFTSIQGV
RPOA_WOLTR       GDIVLEPLESGFALTLGNALRRVMLSSLIGSAVYGIKIDG---------ITHEFTSIQGV
RPOA_RHOBA       GKFSAEPFERGFGASIGNSMRRVLLSSLVGSAVTQIKIRG---------AQHEFTTIPGV
RPOA_TREDE       GKFTASPFETGFGTTIGNCLRRILLSSIQGYAISAVLITSHDADGVPHTISSEFENIPNV
RPOA_TREPA       GKFTASPFETGFGTTVGNCLRRVLLSSIQGYAVTGVRITSFDADGVAHFISSEFEQIPHV
RPOA_BORBP       GKFTIYPFERGFGVTIGNTLRRVLLSSIEGYAITAMRIQSNNKDSSSKVVSSEFDLIPGV
RPOA_BACTN       GKFEFRPLEPGFGITVGNALRRILLSSLEGFAITTIRIDG---------VEHEFSSVPGV
RPOA_PORGI       AKFEFKPLEPGYGITIGNALRRILLSSLEGFAITAIKIEG---------VEHEFATIPGV
RPOA_GRAFK       GKFEFRPLEPGYGLTVGNALRRVLLSSLEGFAITSVRIEG---------VDHEFSTIAGV
RPOA_CYTH3       GLFEFKPLEKGYGVTIGNALRRILLSSLEGYAITGIKVPG---------VLHEFSTIPGV
RPOA_PELLD       GRFIAQPLERGYGVTLGNMMRRVLLASLPGTAITGIKVDG---------VFHEFSSIEGV
RPOA_CHLPD       GRFIAQPLERGYGVTIGNVMRRVLLASLPGTAITGVKIEG---------VYHEFSAIEGV
RPOA_CHLTE       GRFIAQPLERGYGVTLGNAMRRVLLASLPGTAITGIKIDG---------VFHEFSTIDGV
RPOA_CHLCH       GKFIAQPLERGYGVTLGNLMRRVLLASLPGTAITGIKIEN---------VYHEFSTIQGV
RPOA_SALRD       GQFVMGPLERGYGVTIGNALRRVLLSSLRGLAITAVKIDG---------VQHEFSTIPGV
RPOA_CAMJE       AKISAWPFEIGYGITLAHPLRRLLYTSTIGYAPTAIHIDG---------VAHEFDSMRGM
RPOA_CAMFF       AKIIAYPFETGYAVTLAHPLRRLLYTSTVGFAPTAVKIDG---------VAHEFDSMRGM
RPOA_HELHP       IRISAYPFESGYAITLAHPIRRLLLSSSVGYAPTALRIQG---------VTHEFDSIRGI
RPOA_WOLSU       IKISAYPFESGYAITLAHPLRRLLLGSSVGFAPTALKIEG---------AAHEFDSVRGI
RPOA_HELAH       IKISLAPFEFGYAVTLAHPIRRLLLLSSVGYAPVGLKIEG---------VHHEFDSLRGV
RPOA_SULDN       ANIMAYPFETGFAISLAHPLRRFLLSSSVGYAPIAIKIEG---------AKHEFDSVRGM
RPOA_CHLMU       ARFVADPLEKGMGHTLGSALRRALLIGLEAPAIVSFSMTG---------VLHEYMAVEGI
RPOA_CHLFF       ARFVAEPLERGMGHTLGNALRRALLIGLEAPAIISFSMTG---------VLHEYMAIEGI
RPOA_CHLPN       ARFIAEPLERGMGHTLGNALRRALLIGLEAPAIISFAMTG---------VLHEYMAIEGV
RPOA_PARUW       ARYVAEPFERGFGHTIGNALRRMMLSSLEAPAIISVRVEG---------IPHEYMAIEGI
RPOA_AQUAE       GRLVVEPLERGFGTTVGNSLRRVLLSSISGTAITAVKIY---------GIYHEFSAIEGV
RPOA_THEMA       SRFSLSPLERGYAITIGNALRRVLLSSIPSLAIVGVRFIKP-------EKYHEYDYIEGV
RPOA_COREF       SKFIIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSVKIDG---------VLHEFTTINGI
RPOA_CORDI       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIKIDG---------VLHEFTTINGV
RPOA_CORJK       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSLRIEG---------VLHEFTTIPGV
RPOA_BIFAA       SRFTIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSVRISG---------VPHEFTTLPGV
RPOA_FRAAA       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGASVTSIRIDG---------VLHEFSTVPGV
RPOA2_STRAW      SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRVDG---------VLHEFTTVPGV
RPOA_THEFY       SKFILEPLEPGFGYTIGNSLRRTLLSSIPGAAVTSIRIEG---------VEHEFTTVPGV
RPOA_ACIC1       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSLRIDG---------VLHEFSTVPGA
RPOA_ARTS2       SRFIIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDG---------VLHEFTTVPGV
RPOA_NOCSJ       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGASVTSIKIDN---------VLHEFSTIEGV
RPOA_MYCLE       SQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDG---------VLHEFTTVPGV
RPOA_MYCS2       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDG---------VLHEFTTVPGV
RPOA_RHOJR       SKFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDG---------VLHEFTTVPGV
RPOA_SACEN       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSLRIDG---------VLHEFTTIPGV
RPOA_CUTAK       SKFVIEPLEPGFGYTIGNSLRRTLLSSIPGASVTSIKIEG---------VQHEFSTIEGC
RPOA_LEIXX       SRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDG---------VLHEFSTVPGV
RPOA_TROWT       SRFIIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSINIQG---------VMHEFSTIPGV
RPOA_RUBXD       GIFVAEPLPRGLGHTLGNALRRVMLSGLPGAAVTKLRIEG---------VQHEFSTIEGV
RPOA_GEOTN       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVTSVQIDG---------VLHEFSTIEGV
RPOA_BACHD       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVTSVQIDG---------VLHEFSTIEGV
RPOA_OCEIH       GKFVVEPLERGYGATLGNSLRRILLSSLPGAAVTTVQIDG---------ALHEFSTVDGV
RPOA_LISW6       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVTSIQIDG---------ALHEFSVIEGV
RPOA_STAS1       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVKYIEIEG---------VLHEFSAIDNV
RPOA_LACPL       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVTSIQIDG---------VLHEFSTIEGV
RPOA_LACBA       GKFIVEPLERGYGTTLGNSLRRILLSSLPGAAVTSIQIDG---------VLHEFSTVEGV
RPOA_LACS1       GKFVIEPLERGYGTTLGNSLRRILLSSLPGAAITDVQIDG---------VLHEFSTIPGV
RPOA_LACP3       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAISSIQIDG---------VLHEFSTIDGV
RPOA_PEDPA       GRFVIEPLERGYGTTLGNSLRRILLSSLPGAAITSVQIDS---------VLHEFSTIEGV
RPOA_ENTFA       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAITNIQIDG---------VLHEFSTIPGV
RPOA_CLONN       GKFVIEPLERGYGITLGNSLRRILLSSLPGGAANSIKIDG---------VLHEFSTVTGV
RPOA_CLOAB       GRFVVEPLERGYGITLGNSLRRILLSSLPGVAANSVRIEG---------VLHEFSTVKGV
RPOA_CLOTE       GKFVVEPLERGYGITLGNALRRILLSSLPGVAVNSIKIEN---------VLHEFSTVKGV
RPOA_CLOPS       GKFEIEPLERGYGITLGNALRRILLSSLPGVAPTSVKIDS---------VLHEFSTITGV
RPOA_CLOD6       GKFVIEPLERGYGITIGNALRRILLSSLPGVAVNAIKIDG---------VLHEFSTIPGV
RPOA_CARHZ       GRFVIEPLERGYGITLGNSMRRILLSSLPGAAVTSIKIEG---------VLHEFSTVPGV
RPOA_MOOTA       GRFVVEPLERGYGITLGNSLRRMLLSSLPGAAVTSVKIEG---------VLHEFSTIPGV
RPOA_DESHY       AKFVVEPLERGYGITLGNSLRRILLSSLPGTAVTSVKIEG---------VLHEFSTVPGV
RPOA_HUNT2       GKFVVEPLERGYGITLGNSLRRILLSSLPGVAVTSIKIDG---------ILHEFSTIPGV
RPOA_SYMTH       GKFVVEPLERGYGITLGNSLRRILLSSLPGAAVTSVKIDG---------VLHEFSTLPGV
RPOA_CALS4       GKFVVEPLERGYGITLGNSLRRVLLSSIPGAAPKSVKIDG---------VLHEFSTLPGV
RPOA_SYNWW       GRFVIEPLERGYGTTLGNSLRRVLLSSLPGAAVTSIKIDG---------VLHEFSTIPGV
RPOA_LACGA       GKFVVEPLERGFGTTLGNSLRRVLLTSIPGTALSYIQIDG---------VLHEFSTVPGV
RPOA_LACAC       GKFVVEPLERGFGTTLGNSLRRVLLTSIPGTGLVYVQIDG---------VLHEFSTVPGV
RPOA_LACDB       GKFVVEPLERGFGTTLGNSLRRVLLTSVPGTGLVKVKIDG---------ILHEFTTVPGV
RPOA_STRSV       GKFVVEPLERGYGTTLGNSLRRVLLASLPGAAVTSINIEG---------VLHEFDTISGV
RPOA_STRS2       GRFVIEPLERGYGTTLGNSLRRVLLASLPGAAVTSIKIDG---------VLHEFDTVPGV
RPOA_LACLS       GKFVVEPLERGYGTTLGNSLRRVLLSSLPGAAVTSIQIEG---------VQHEFATIPGV
RPOA_LEUMM       GKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVNTVQIDG---------VVHEFSTVDGV
RPOA_OENOB       GKFVAEPLERGYGTTLGNSLRRVLLSSLPGAAINSVQIDG---------VLHEFTTIDGV
RPOA_DEIGD       GEFVLEPLTRGYGVTIGNPIRRILMSSIPGTAVTSVYIED---------VLHEFSTIPGV
RPOA_DEIRA       GEFVLEPLARGYGVTIGNPIRRILMSSIPGTAVTSVYIED---------VLHEFSTIPGV
RPOA_THET8       GEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIED---------VLHEFSTIPGV
RPOA_FUSNN       GQFIVEPLYRGYGNTLGNALRRVLLSSIPGAAIKGMRIEG---------VLSEFTVMDGV
RPOA_MYCMS       GKFSVSPLERGFGITLGNAIRRTLLAATPGASVYAIKIAG---------ATHEFTSIPGI
RPOA_MESFL       GKFEAAPLERGFAVTLGNALRRTLLSSTPGASVFAIKIAG---------AQHEFTSISGI
RPOA_MYCGE       GIFEVAPLESGFGITIGNAMRRVLLSCIPGASVFAIAISG---------VKQEFSNVEGV
RPOA_MYCPN       GIFEVGPLESGFVITIGNAMRRVLLSCIPGASVFALSISG---------AKQEFAAVEGM
RPOA_MYCGA       GKYIVKPLEKGFGITLGNALRRVMLSHLPGSSVFALKIKG---------ISHEFGFIPGV
RPOA_MYCPE       GVFVFKPLERGFGHTLGNSLRRVLLSNIIGHSLFAIKIPN---------VSHEFQSIKGV
RPOA_UREPA       TVVKIAPLEIGFGDTLGNALRRICLSSIPGASMFAVKFGG---------YSHEFQPYEGV
RPOA_MYCMO       TSFIVQPLEKGLATTLGTAIRRVLLSSISSVAPFAVKIKG---------VEHEFMAINKV
RPOA_MYCPU       TTFKIEPLERGFGSTIGTALRRTLLSSITSVVPFAIKIKD---------VDQEFDTISDI
RPOA_MYCH7       TSFEIKPLERGLGNTLGNALRRTVLSSIPSCAVFGVKIEG---------IKHEFTVLDDV
RPOA_MYCS5       KVLKIKGLERGFGNTLAVALRRILLSNITGIAPFCVRIEG---------VEHEFTALEKV
RPOA_AYWBP       GKFTIKPLERGYGITVGNALRRVLLSSLPGAAIVNVKIQG---------VEQEFTTIPGV
RPOA_DEHMC       GRFVVEPLEKGFGTTMGNSLRRILLSYLDGVAITRVRIDG---------IQHEFCALPKA
RPOA_OSTTA       GRLSFGPVNPGQGLTIGNTLRRILLNDLPGIGVIGAEING---------VQSEFSTLPGI
RPOA_SINAL       GRFILSPLMKGQADTIGIAMARALLGEIEGTCITRAKSEN---------IPHDYSNIVGI
RPOA_AETGR       GRFILSPLMKGQADTIGIAMRRALLGEMEGTCITRAKSEN---------IPHDYSNIVGI
RPOA_LIRTU       GRFILAPLMKGQADTIGIAMRRALLGEIEGTCITRVKSEK---------VPNEYYTIVGI
RPOA_DRIGR       GRFILSPLMKGQADMIGIAMRRALLGEIEGTCITRAKSDK---------IPHEYSTIVGI
RPOA_ACOCL       GRFILSPLLKGQADTIGIAMRRALLGEIEGTCITRAKSEK---------VPHEYSTIAGI
RPOA_VITVI       GRFILSPLIKGQADTIGIAMRRALLGEIEGTCITRAKSEK---------IPHEYSTIVGI
RPOA_PLAOC       GRFILSPLIKGQADTIGIAMRRALLGEIEGTCITRAKSEK---------IPHEYSTIVGI
RPOA_NANDO       GRFVLSPLMKGQADTIGIAMRRALLGEIEGTCITHAKSEK---------IPHEYSTIVGI
RPOA_RANMC       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEK---------IPHEYSTIVGI
RPOA_NICTO       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRVKSEK---------VPHEYSTIMGI
RPOA_PANGI       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEK---------IPHEYSTLVGI
RPOA_COFAR       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRVKSEK---------VAHEYSTIAGI
RPOA_LACSA       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEK---------ISHEYSTIMGI
RPOA_SPIOL       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEK---------IPHEYSTILGI
RPOA_EUCGG       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKFEK---------IPHEYSTIVGI
RPOA_OENEH       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKFEK---------IPHEYSTIVGI
RPOA_CITSI       GRFILSPLMKGQADTIGIAMRRVLLGEIEGTCITRAKSEK---------IPHEYSTIVGI
RPOA_GOSBA       GRFILSPLMKGQADTIGIAMRRALLGELEGTCITRAKSEK---------IPHEYSTIVGI
RPOA_POPTR       GRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSKK---------IPHEFSTITGI
RPOA_CUCSA       GRFILSPLMKGQGDTIGIAMRKALLGEIEGTCITRAKSEK---------IPHEYSTIVGI
RPOA_MORIN       GRFLLAPLMRGQADTIGIAMRRALLGEIEGTCITRAKSEK---------IPHEYSTIVGI
RPOA_JASNU       GRFILSPLRKGQADTIAIGIRRALLGEIEGTCITRVKSKN---------VPHEYSTIAGI
RPOA_PHAVU       GRFILSPLMKGQADTIGIAIRRILLGEIEGTCITCVKSEK---------IPHEYSTIIGI
RPOA_LOTJA       GRFILSPLMKGQADTIGIAMRRILLGEMEGTCITRAKSEK---------ISHEYSTIVGI
RPOA_PIPCE       SRFILSPLMKGQADMIGIAMRRALLGEIEGTCITRVKSEK---------VPHEFSTIVGI
RPOA_AMBTC       GRFVLSPLMKGQADTIGTAMRRSLLGEIEGTCITCAKSER---------VPHEYSTIVGI
RPOA_NYMAL       GRFVLSPLMKGQADTIGIAMRRALLGELEGTCITRAKSDK---------VPHEYSTVVGI
RPOA_ORYSJ       GRFILSPLRKGQADTVGIALRRALLGETEGTCITHAKFGS---------VPHEYSTIAGI
RPOA_PHAAO       GRFVLSPLMKGQADTIGIAIRRALLGEIEGTCITRATSEN---------VLHEYSTIAGI
RPOA_PINTH       GRFALSPLHKGRADTIGIAMRRALLGEVEGTCITRVKLEN---------IKHEYSAIIGI
RPOA_PSINU       GRFAVSPFRKGQASTVGVAMRRALLGEVEGTSITYAKFKN---------VVHEYSTLVGI
RPOA_ANGEV       GRFAISPFRKGQANTVGIAIRRSLLGEIEGTAITYAKSKN---------VIHEYSTIIGI
RPOA_MARPO       SRFAISPFRKGQANTVGIAMRRALLNEIEGASITYAKIKK---------VKHEYSTIIGL
RPOA_ANTAG       GRFAISPLRPGQANTVGIAIRRALLGEIEGTCITYVKFEK---------VTHEYSTIMGI
RPOA_HUPLU       SRFILSPLKVGQANTIGLVMRRALLGEIKGTCITCAKFEN---------ITHEYSTMDGI
RPOA_ADICA       GRFLVSPFKRGQASTVGIAMRRALLQEIEGTSITCARFCG---------VVHEYSTITGL
RPOA_CHAGL       GRFIISPLWKGQANTIGLALRRTLLSEVEGTCITSVKIKN---------AIHEYSSLSGV
RPOA_CHAVU       GRFAIAPLKKGQANTLGITLRRTLLSDLDGICITSVKIDN---------IKHEYCTLTGV
RPOA_STAPU       SRFALSPLLVDQAMTIGVAIRRALLSEVEGISIISANIVG---------AVHEYSTLDGV
RPOA_ZYGCR       GRFAVYPLFPGQAITIGTAIRRALLGEVHSTCITSAYVVG---------ASHEYSTLKGI
RPOA_MESVI       GRFLIEPLAIGQGITVGNTLRRILLGDIEGAAITSVKIPG---------ANNEFSILPGI
RPOA_CHLAT       GRFVIAPLEIGQGITVGNVFRRVLLGDLEGACITSVQIPG---------VNHEFSTIHGV
RPOA_PYRYE       GSFVIEPLNQGQGITLGNALRRSILSDLEGTAIVAVRIAG---------VNHEFSTIPGV
RPOA_GRATL       GRFILEPLNKGQGITLGNSLRRTILSDLQGAAIVAVRIAG---------INHEFSTITGV
RPOA_GUITH       SRFVIDPLKPGQGTTLGNALRRTLLSELEGLAITAVRIAG---------VSHEFSTINGI
RPOA_CYAPA       GRFIVEPLEPGQGITIGNSLRRVLLSDIEGSAITAVRIAG---------VNHEFCSIPGV
RPOA_CYACA       GKFMIEPLSYGQAITVGNALRRVLLSDVPGVTIVSVRIAG---------INHEFSTVKGV
RPOA_CYAM1       AKFILQPLSYTQALTMGNSLRRVLLSELESISITAVRIAG---------ASHELATLKGV
RPOA_TRICV       GQFVIKSLHPGQGITIGNLFRRVLLSDLGGTAITGVRIAG---------VRDEFSTIPGI
RPOA_THAPS       GQFLIDSLSSGQGITIGNLLRRVLLGDLQGTAITGVRIAG---------VKDEFSLIPGV
RPOA_PHATC       GQFLINSLNPGQGITIGNQLRRVLLGDLGGVAISAVRIAG---------ITHEFSTIPGV
RPOA_TRIV2       SKFILEPLERGQGTTVGNALRRVLLSNLEGTAVTAVRIAG---------VSHEFATVPGV
RPOA_TRIEI       GKFIIEPLARGQGTTVGNALRRVLLSNLEGTAITSVRIAG---------VNHEFATIKGV
RPOA_SYNY3       SKFSLEPLDRGQGTTVGNALRRVLLSNLPGAAVTAIRIAG---------VNHEFATILGV
RPOA_SYNE7       GRFSIEPLARGQGTTVGNALRRVLLSNLEGTAVTAVRIGG---------VNHEFATIPGV
RPOA_SYNJA       GKFALGPLERGQGITVGNALRRVLLSNLEGTAVTAVRIAG---------VTHEFSTVPGV
RPOA_GLOVI       GKFVLEPLERGQGTTLGNALRRVLLSNLEGTAVTAVRITG---------VNHEFATMKGI
RPOA_THEEB       GQFALHPLAPGQGITVGNALRRVLLSNLPGSAVTAVRIAG---------VNHEFSTIPGV
RPOA_SYNS3       GVFLIGPLERGQATTLGNSLRRMLMGNLAGTAVTAVRIAG---------VNHEYATIPGV
RPOA_SYNPX       GVFLIGPLERGQATTLGNALRRVLMGGLEGSAVTAIRIAG---------VNHEYATVPGV
RPOA_PROMA       GIFLIGPLERGQATTLGNSLRRVLMGGLEGSAVTAVRISG---------VNHEYATVPGV
RPOA_PROM5       GTFLIGPLERGQATTLGNSLRRVLMGGLEGSAVTAVRIAG---------INHEYATIPGV
RPOA_PROM1       GVFLIGPLERGQATTLGNSLRRVLMGGLEGSAVTAVRIAG---------VNHEYATIPGV
RPOA_EMIHU       AKFCIEPLSKGQGITIGNALRRTLLSNIPGTAIVGTRISG---------VDHEFSVIPGV
                        .       :.  : :       .                      .       

RPOA_BUCAI       QEDVLEILLNLKALAVKVYG-------------KDETLLTLHKSG--IGSITAADII---
RPOA_BUCAP       QEDILEILLNLKELAVKVHG-------------KDEVFMSLNKSG--IGSVTASDII---
RPOA_ECOLI       QEDILEILLNLKGLAVRVQG-------------KDEVILTLNKSG--IGPVTAADIT---
RPOA_BAUCH       REDIIEILLNLKELAVKVQS-------------KDNVILTLNKSG--LGPVTAANII---
RPOA_WIGBR       QEDIVEILLNLKELALIIKG-------------KDIAVLSLFKSG--IGKVTASDII---
RPOA_BUCBP       QEDIIEILLNLKGLAIRVYG-------------KDQVYLTLVKTG--IGVVTAADIN---
RPOA_BLOFL       REDVLEILLNLKTLAINMYV-------------KDSIVLTLKKTG--IGPVIASDIE---
RPOA_BLOPB       QEDVLEILLNLKKLAIRIEG-------------KDSVTLTLKKSG--IGPVIANDIL---
RPOA_BUCCC       KEDILDILLNLKGLSIKLFG-------------KDEVTLYLKKSG--IGPVLAKDIN---
RPOA_COLP3       QEDIIEILLNLKGLAVILEG-------------KNEAVLTVTKSG--EGPVTAADIQ---
RPOA_PSEA6       QEDVIEILLNLKGLAVRLEG-------------KTEATLTLVKSG--AGPVLAGDIQ---
RPOA_SHEAM       QEDILEILLNLKGLAVILEG-------------KDEAMLTLSKSG--AGPVTAADIT---
RPOA_AERS4       QEDILEILLNLKGIAVKLEG-------------KDEVTLSLTKSG--TGPVTAGDIT---
RPOA_PSEHT       QEDIIEILLNLKGLAVTLEG-------------KDEVFLTLAKSG--VGPVTASDIQ---
RPOA_IDILO       QEDVIEVLLNLKGLAVSVEG-------------KDEATLTLNKSG--AGPVTAGDFT---
RPOA1_PSYIN      QEEILEILLNLKGLAVKLEG-------------KNEVLVSLTKSG--AGPVIAADIT---
RPOA2_PSYIN      QEDILEILLNLKGLAVKLEG-------------KDNVLVSLTKSG--AGPVTAGDIT---
RPOA_ACIBT       QQDIVELLLNLKGLSIKLFD-------------QNEAYLTLEKQG--PGDITAADLR---
RPOA_PSYCK       QEDVLDLLLNLKGLAITLHD-------------QNEVFLTLDKQG--PGTITAADIT---
RPOA_HAHCH       QEDVIEILLNLKNLAIKMHN-------------RDEATLSLNKKG--AGPVLASDIQ---
RPOA_MARHV       QEDVIEILLNLKGVAVKMNG-------------RDDAELTLSKKG--PGVVTAGDIK---
RPOA_PSEE4       QEDVIEILLNLKGLAIKLHG-------------RDEVTLTLSKKG--SGVVTAADIQ---
RPOA_SACD2       QEDVIEILLNLKNVAVVMHG-------------KDQAVLSLSKQG--PGAVTAGDIQ---
RPOA_CHRSD       QEDVIEILLNLKDVAVKMHGN------------RDEVVLALSKQG--PSVVTAGDIA---
RPOA_ALCBS       QEDVINILLNLKGVALKMED-------------SEETTLELVKKG--PGVVTANDIQ---
RPOA_NITOC       QEDMTEILLNLKGVAVKLHG-------------RDEVTLNLSSKG--PVTVTAGDIQ---
RPOA_XANOM       QEDVLDVLLNLKDVAIRMHS-------------GDSATLSLSKQG--PGTVTAADIR---
RPOA_XYLFT       QEDVLEVLLNLKDVAIRIHS-------------GDTATLSLFKQG--AGVVTAADIK---
RPOA_ALKEH       QEDVVDILLNLKSLAVRMHD-------------RDEAELTVSVQG--PGPVTAGDIQ---
RPOA_HALHL       HEDTVDILLNLKDLAVRLNE-------------RDSVTLSVEKQG--PGSVTAADIA---
RPOA_AZOSB       REDIVDLLLNLKGVVLKLHN-------------RSEAMLTLSKSG--EGVVTARDIE---
RPOA_NITMU       QEDVVDILLNLKGIVLKLHN-------------RTEALLTLSKKG--EGTVTAGDIE---
RPOA_DECAR       QEDVVDILLNLKGVVFKLHN-------------RDVVNLKLVKEG--EGAVRAGDIE---
RPOA_POLNA       QEDVVNILLNLKGVVFKLHN-------------RDEVTLSLRKDG--EGPITAADIQ---
RPOA_RHOFT       QEDVVNILLNLKGVVFKLHN-------------RDEVTLSLRKDG--EGLVTASDIQ---
RPOA_METPP       QEDVVHVMLNLKGVVFRLHN-------------RDEVTLVLRKEG--EGPVKAGDIQ---
RPOA_RALSO       QEDVVNLLLNLKGVVFKLHN-------------RDEVTVSLRKEG--EGVVTAADIE---
RPOA_BORA1       REDVVDILLNLKGVVFKLHN-------------RDEVTLILRKNG--SGLVLASDIE---
RPOA_NEIG1       QEDVVDILLNIKGIVFKLHG-------------RSQVQLVLKKSG--SGVVSAGDIE---
RPOA_CHRVO       REDVVDILLNLKGVVLKLHG-------------RDSVVLTLKKEG--EGAVLASDIE---
RPOA_THIDA       QEDVVDILLNLKGIAFKMHG-------------KAEAILKVSKSG--EGVVTAGDIE---
RPOA_METFK       QEDVVDILLNLKGVALKLNS-------------KNEATLTLNKST--EGVVTAGDFD---
RPOA_NITEC       QEDIVDLILNLKGVVLKLHS-------------KNSTVLSLKKDT--EGIVTAGDIE---
RPOA_METCA       QEDVIDVLLNLKNLAIRLNG-------------PHDVYLNVDKHG--PGPVLAGDIE---
RPOA_LEGPA       QEDVVDLLLNLKSVAIKLTV-------------GNEAQVTLNKEG--PCQVTAGDIQ---
RPOA_COXBU       REDVVDVLLNLKGVAIKLEG-------------REDAKLTLHKKG--AGTVTAGDIQ---
RPOA_HYDCU       REDVLEIMLNLKEVAIKLNE-------------TSEAELTLSKKG--PAVVTAADIQ---
RPOA_DICNV       KEDVIDVLLNLKNIALLMPD-------------LERAEIRLSVTE--KGAITAGDFE---
RPOA_VESOH       QEDVLDILLNLKEVSVVLNT-------------VETAQVVIDKKG--PCEITVADIE---
RPOA2_FRAT1      DETVADIILNVKSLPVTLAEG------------VETGTITFELSGS-EEEIFSEEAK---
RPOA1_FRATN      KEDVVEIVSNLKKVAIKLDTA------------IDRLDLELSVNK--SGVVSAGDFK---
RPOA_NEOSM       REDFADLALNLKKVVLKSISG------------ATCGNLHLSVTD--GGAVFSNMIS---
RPOA_KORVE       VEDATDIILNLKQIPFRLN-------------GDAPKAIYLRAEQ--PGIVTSGMIE---
RPOA_SOLUE       VEDATDIILNLKQIPFKIS-------------SDGIKTVRLSVDS--HGDVRSGQIE---
RPOA_LEPBL       AEDVTRIILNLKQVRIKYEPE-E---------KDQSKIIHLELKG--AGYFRAGDLA---
RPOA_ANADE       AEDVTDIILNLKEVLLQIH-------------TNDVKTIRIEADG--PKEIKAGDLI---
RPOA_MYXXD       SEDVTDVVLNLKEVLLRMH-------------TNETKTLRIEAEG--PKEVKAGDII---
RPOA_GEOMG       TEDVTNIILNLKGVSLKMH-------------GNEARTVRIIHKG--DGIVKAGDIV---
RPOA_GEOSL       TEDVTNIILNLKGVSLKMY-------------GTEPKTVRIIHKG--DGIITAGDII---
RPOA_PELPD       TEDVTDIILNLKGVRLKLH-------------SVVQATIRVVHTG--EGVVKAGDFV---
RPOA_PELCD       TEDVTDIILNLKGVLLKLH-------------GSDSRNIRIVKKG--AGVITAADII---
RPOA_SYNFM       LEDVTDVILNLKEVRFKMH-------------SDGPRLVVIEKDG--EGEVAAGDIQ---
RPOA_BDEBA       LEDVTDIILNLKEVRFKQY-------------TADSLTLKISKKG--PGKVTAADIQ---
RPOA_SYNAS       KEDITDIILNLKGVRLKLL-------------SDGPRVIRIDTKK--EGVITAADII---
RPOA_DESPS       KEDVSEIILNLKQVRLKLN-------------CEESQTVRIEKQG--PGPVVAGDII---
RPOA_DESVV       LEDVTDVVLNLKQVRLAMD-------------TEEPQYLELKVDK--RGAITAGDVR---
RPOA_DESAG       LEDVTDIVLNLKQVRLAMD-------------TEEPQHLELHVNK--SGEVKAGDIK---
RPOA_LAWIP       LEDVTDIILNLKQVRLAMD-------------TDEPQHLSLFVSK--KGIVTAADIQ---
RPOA_RHILO       REDVTDIVLNIKEIAIRME-------------GDGPKRMVVRKQG--PGAVLAGDIQ---
RPOA_BRUME       REDVTDIVLNIKEIAIRME-------------GEGPKRMVVHKEG--PGVVTAGDIQ---
RPOA_BARQU       REDVTDIILNIKEIALRMQ-------------EEGPKRVVVCKEG--PGVVRAGDIN---
RPOA_BARBK       REDVADIILNIKEIAIRME-------------EEGPKRIVVCKEG--PGIVKAGDIR---
RPOA_NITWN       REDVTDIVLNIKDIAIRMQ-------------GEGPKRMVVKKQG--PGTVTAGDIQ---
RPOA_CAUVC       REDVVDIVLNIKQLAVRMH-------------AEGPKRMTLRATG--PGPVTAGQIE---
RPOA_MARMM       REDVTDIVLNIKQIALRMH-------------GEGPKRVVLKKSG--PGIVTAGDIE---
RPOA_MAGSA       REDVTDIILNIKTLGLRMH-------------GEGPKRMHLRAVG--PGEVTAGLIE---
RPOA_RHORT       REDVTDVILNIKGLALLMH-------------SEGPRRMTLKASG--PGEVTAAQIE---
RPOA_GRABC       REDVTDIVLNIKQLALRMH-------------GEGPKRMMLTATG--PGEVTAGQIQ---
RPOA_ROSDO       REDVTDIILNLKGVSIRME-------------VEGPKRLSISAKG--PGVVTAGDIS---
RPOA_JANSC       REDVTDIVLNLKGVAIRMD-------------AEGPKRVSISAKG--PRVVTAGDIS---
RPOA_PARDP       REDVTDIVLNLKGVTLKMD-------------VDAPKRLTLSAKG--PGEVKAGDIQ---
RPOA_HYPNA       REDVTTIVLNLKQVAIFME-------------SDTPKRMVLRAKG--PGEVKAGQIE---
RPOA_NOVAD       REDVTDIVLNVKQIALKMQ-------------GEGPKRLQLSATG--PGEVKAGDIA---
RPOA_SPHAL       REDVTDIVLNVKQIALKME-------------GEGPKRLQLSATG--PATVKAGDIM---
RPOA_ERYLH       REDVTDIVLNVKQIALKME-------------GEGPKRLQLSATG--PAEVKAGDIA---
RPOA_ZYMMO       REDVTDIVLNIKQVAIKMQ-------------GDGSRRLHISRTG--PGVVTAGDIA---
RPOA_PELUB       REDVTDIVLNVKSLALKSS-------------SETTKKLILDAKG--PGEIKASDIA---
RPOA_MAGMM       IEDVTDIILNIKGLALRME-------------STGIKNIYLRVDK--EGPVTAGMIE---
RPOA_RICTY       QEDVSEVILNIKGIEVKMH-------------VSEKRIMKLKATG--PCVVTAGMID---
RPOA_RICBR       KEDISEIILNVKGIEIKMH-------------VAEKRVIRLKATG--PGAITAGMIE---
RPOA_ANAMM       REDVADLVLNLSMLRVKLL-------------TSESRVLRLVAKG--PGEITAAAIG---
RPOA_ANAPZ       REDVADLVLNLSMLRVKLL-------------NSNQRVLRLVARG--PGEVTAASIV---
RPOA_EHRRW       REDVTDILLNISMIRLKLS-------------GMDNKVLSLKVKG--PCEVRSGMIA---
RPOA_WOLPM       REDVTDIVLNMGMLRCKLN-------------GASNKCLNLNAKG--PCQVLAGMIE---
RPOA_WOLTR       REDVTDIVLNMGMLRCKLN-------------GTSNKCLSLSAKG--PCQVLAGMIE---
RPOA_RHOBA       LEDVTDIVLNVKSLIVNSN-------------TDSTRVITVERNT--AGVVTGADVQ---
RPOA_TREDE       SEDTLEILNKLKQIRLRLS---D---------ESEQGDFHFEFKG--PASITSKDFA---
RPOA_TREPA       REDTLEILNNFKRLRFLLP---Q---------GAESSTFTYEFRG--AVSLTGKDFA---
RPOA_BORBP       SEDTLEVIANIKNIHLKLG---E---------GEQRKIISFSVSG--KDTKVLKASH---
RPOA_BACTN       KEDVTNIILNLKQVRFKQVVEE-----------FESEKVSITVEN--SSEFKAGDIG---
RPOA_PORGI       LEDVTNIILNLKQVRFKQIVPN-----------ADVEKATIVISN--SEVFRAGDLN---
RPOA_GRAFK       VEDVTEIILNLKQVRFKRQIDE-----------IDNESVTISVSG--EEQLTAGHFQ---
RPOA_CYTH3       REDVTEIILNLKQVRFKKISDV-----------NEN-KIVVSIKK--QASFKAGDIA---
RPOA_PELLD       REDVPEIVLNLKKVRFKSTCK-------------RSCKTTLSIVG--PKDFTAGDIV---
RPOA_CHLPD       REDVPEIVLNLKRVRFKSNCK-------------RSCKTSLSIAG--TKDFTAGDII---
RPOA_CHLTE       REDVPEIVLNLKKVRFKSNCK-------------RSCKTTLTLAG--PKDFLAGDIV---
RPOA_CHLCH       REDVPEIVLNLKKVRFRSQCK-------------RSCKTTVTLVG--PMEFTAGVIQ---
RPOA_SALRD       TEDVADLILNLKEVRFKADEM-------------QEGHLHLNLEG--PGNWTAADID---
RPOA_CAMJE       LEDVALFIINLKKLRFKIKGD------------SNKEIVEFSFKG--SKEIYGKD-----
RPOA_CAMFF       LEDVTLFIINLKNLRFKLKND------------SKREVIEYSFKG--PKEITGID-----
RPOA_HELHP       VEDVSHFITNLKNIRFLIKDTE-----------SDNVQLHYEFKG--PMVLSANE-----
RPOA_WOLSU       MEDVALFIVNLKSIRFKMRGD------------AERVTLDYSFKG--PATIKGSD-----
RPOA_HELAH       TEDVSLFIMNLKNIRFIAKALVGQDSP----LENQSVVVDYSFKG--PMELRARD-----
RPOA_SULDN       LEDISDFILNLKETRFKLLGG------------ATEAEINYNFTG--PCDIKGSN-----
RPOA_CHLMU       IEDVTNIVLNLKGSLLKKYPLQDCEGG----RASQKLRATISIDA--SDLAAAGGQKAIT
RPOA_CHLFF       IEDVTNIVLNLKGALLKKYPFQDSEDG----RRPQLLKSMISIDA--SDLAACGGQRAVT
RPOA_CHLPN       IEDVTNIILNLKGALLKKYPMQDSSLG----RTTQVLKASISIDA--SDLAAANGQKEVT
RPOA_PARUW       SEDMTNIILNFKGALLRKLPTEETP------RDTRILTKVVEVTQ--DDLDRNQGQYCVT
RPOA_AQUAE       QEDAIELIANLKKIKFLMKGD-----------SDVEI-LYLQKKG--EGEVKASDIK---
RPOA_THEMA       KEDILDIILNLKKVQFRINVT-----------VKGTIKMEVEKKG--PGELVAGDIK---
RPOA_COREF       KEDVSDIILNIKGLVLSSD-------------SDEPVIMHLSKEG--PGVVTAGDIE---
RPOA_CORDI       KEDVSDIILNIKGLVLSSD-------------SDEPVVMYLRKEG--AGVITAGDIE---
RPOA_CORJK       KEDVSDIILNIKSLVLSSD-------------SDEPVSMFIRKEG--PGEVTGADVE---
RPOA_BIFAA       EEDVTEILLNIKGIVLTSE-------------YDEPVVMYLRKSG--KGEATAGDIT---
RPOA_FRAAA       KEDVTDLILNLKELVVSSD-------------NDEPTVMYLRKQG--PGEVTAADIA---
RPOA2_STRAW      KEDVTDLILNIKQLVVSSE-------------HDEPVVMYLRKQG--PGLVTAADIA---
RPOA_THEFY       KEDVTEIILNLKGLVVSSE-------------HDEPVLMYLRKQG--PGVVTAADIA---
RPOA_ACIC1       KEDVTEMILNIKELVVSSE-------------HDDPQVIYLRKQG--PCEVTAADIV---
RPOA_ARTS2       KEDVTEIILNIKNLSVSSE-------------HDEPVVAYLRKQG--PGVVTAADIA---
RPOA_NOCSJ       KEDVTEVILNLKGLVVSSE-------------HDEPVTMYLRKSG--AGDVTAADIA---
RPOA_MYCLE       KEDVTEIILNLKGLVVSSE-------------EDEPVTMYLRKQG--PGEVTAGDIV---
RPOA_MYCS2       KEDVTDIILNLKGLVVSSD-------------DDEPVTMYLRKQG--PGVVTAGDIV---
RPOA_RHOJR       KEDVTDIILNLKGLVVSSE-------------EDEPVTMYVRKQG--PGAVTAGDIV---
RPOA_SACEN       KEDVTDVILNLKELVVSSE-------------EDEPVTMYLRKQG--PGEVTAADIV---
RPOA_CUTAK       VEDVTEIILNLKGLVLSSE-------------EDEPVAMYLRKTG--AGEITAADIN---
RPOA_LEIXX       KEDVTEIILNIKGLVVSSE-------------HDEPITAYLRKTG--AGQVTAADIS---
RPOA_TROWT       KEDVTEIVLNVKRLVISSE-------------IDEPFTVRLYKTG--EGEVLAKDIE---
RPOA_RUBXD       REDVVDIILNVKQLKFRLE-------------RDEPIELQISKDG--PGEVRGSDIE---
RPOA_GEOTN       VEDVTAIILNVKKLALKIY-------------SDEEKTLEIDVQG--EGVVTAADIT---
RPOA_BACHD       VEDVTTIVLNLKQLALKIY-------------SDEDKTLEIDTQG--EGVVTAGDLT---
RPOA_OCEIH       VEDVTTIILNLKKLALKIY-------------SEEPKTLEIDVQG--EGAVTAADLT---
RPOA_LISW6       VEDVTTMILNIKKLALKIY-------------SDEEKTLEIDMQG--PGVVTAADIN---
RPOA_STAS1       VEDVSTIIMNIKKLALKIY-------------SEEDKTLEIDVKD--EGDVTASDIT---
RPOA_LACPL       TEDVTAIILNVKKIALKLE-------------SDETKTLEIDVKG--PANVTAGDII---
RPOA_LACBA       VEDVTQIILNVKKIALKLNG-----------SDDQEETMEINVKG--PAQITAGDIV---
RPOA_LACS1       LEDVTLIILNLKKVALSME-------------SEDSQALEINVTG--PMEVTAGDIQ---
RPOA_LACP3       LEDVTQIILNIKKLALKMN-------------TDEDKNIEIDVNG--PAKVTAADIV---
RPOA_PEDPA       VEDVTQIILNLKKVSLKIE-------------SDEDKTLEINVAG--PANVTAGDIM---
RPOA_ENTFA       REDVTQIILNIKGLALKLY-------------AEEEKTLEIDITG--PATVTAGDII---
RPOA_CLONN       KEDVTELILNIKGLALKMN-------------GEGPSTIYIDAQG--PGEVTAADII---
RPOA_CLOAB       KEDVTELILNIKALCLKME-------------GEDSKVIYIDAHG--PGEVTGADIR---
RPOA_CLOTE       KEDVTEIILNIKLLALKMT-------------GEGPKTIYIDAKG--PGVVTAADIK---
RPOA_CLOPS       KEDVTEIILNLKMLALTME-------------GEGPKTIYIDAQG--PGVVTGADIK---
RPOA_CLOD6       KEDVTEIILTLKELSATID-------------GEGSRTLKIEAQG--PCSITGADII---
RPOA_CARHZ       VEDVTEIILNIKNLTLKLH-------------GDEEQVLRIEAEG--EGVITAKDII---
RPOA_MOOTA       VEDTTDIILNIKSLALKLH-------------SDEPRVIRIEADD--EGVVTAGDII---
RPOA_DESHY       LEDVTDIILNLKSLALKGH-------------TDEPKVLRLEAEG--EGVIKAGDII---
RPOA_HUNT2       IEDVTEIILNIKELSLNFH-------------GEGPKVIYIDAEG--EGEVKAKDIK---
RPOA_SYMTH       VEDVTDIILNLKQLSLRMH-------------SDEPKVLRLHAEG--EGEVTAGDIH---
RPOA_CALS4       KEDVVEIILNLKEVAVKLH-------------SDEPVIGRIDVEG--KGEVTAGHIK---
RPOA_SYNWW       LEDTTEIILNIKKLVLSYT-------------GSERKIIRLEQQG--PKEVKASDIT---
RPOA_LACGA       REDVTKIILNLKKLELKSL-------------SDEEKIAEIDVTG--PAIVTAADLK---
RPOA_LACAC       REDVTKIILNLKKLELKSL-------------SDEQKVIELDVEG--PATVTADDLK---
RPOA_LACDB       KEDVTKIILNLKKLELRAY-------------TEEVKTIELDVEG--PATVTAEDLK---
RPOA_STRSV       REDVMQIILNVKGIAVKSY-------------VQDEKIIELDVEG--PAEVTAGDIL---
RPOA_STRS2       REDVMQIILNIKGIAVKSY-------------VEDEKKIELDVVG--PAEVTAGDIL---
RPOA_LACLS       REDVIQIVLAVKGIAIKSY-------------VESEKQIELDVTG--PMDVTAGDIL---
RPOA_LEUMM       VEDVTQIILNLKKVVLAID-------------SDDERSLEIDIQG--PADVTAADLQ---
RPOA_OENOB       TEDVTQIILNLKKVAMRID-------------SDEQKTLEVDFSG--AGELTAGDIK---
RPOA_DEIGD       KEDVIRIILNLKELVVKFHA-----------PGPKTLTLRAQGEG----VVKASAFE---
RPOA_DEIRA       REDVIRLILNLKELVVKFHA-----------PGPKTLTLRAQGEG----EVRASAFE---
RPOA_THET8       KEDVVEIILNLKELVVRFLN-----------PSLQTVTLLLKAEG--PKEVKARDFL---
RPOA_FUSNN       KEAVTEIILNVKEIVVKAE-------------SSGERRMSLSIKG--PKVVKAADIV---
RPOA_MYCMS       IENVTKIILNIKQLVLKIDTSIYSDDEVV--------QLRIRSDI--QGPIYAGDLD---
RPOA_MESFL       EENVTRIVLNVKKLILRIDSAIYNDDETV--------ELKVGTST--IGPVTAGSLV---
RPOA_MYCGE       LEDVTEMVLNFKQLVVRISDLLFEDGEMIEPPLERWPVLKVTAEK--KGAVYAKDLE---
RPOA_MYCPN       KEDVTEVVLNFKQLVVKISDLLFEDGEMVEPPLERWPLLTVTAEK--AGPVYAKDLE---
RPOA_MYCGA       KEDVTQIILNIKNLVVWISDNMITDETLSETPIEKWPVMTIRANK--AGIIKAGDIE---
RPOA_MYCPE       KEDLTQIILNLKRLVVKIDQEIFGEEEQKETSLEKWPTLKIDFSK--GGVLKASDIE---
RPOA_UREPA       KEDITHIILNLKNLAIKIDELIYSEDYFNNLLIDKWPKMKINFKG--PGVITAKDIV---
RPOA_MYCMO       TEDVPQILLRLRDIKIAYNPEIFEDGKIYKL------SLKSNKE---AGDIYAKDFI---
RPOA_MYCPU       VEDVQMIMLNVKNIHLVYDENIFEDNKIYRG------VIETKNE---KITSSDLKFP---
RPOA_MYCH7       IEDVVTILNNLKRVRFFYNPSVFSQNSIHVA------SFLGQK----AGQIYARDIE---
RPOA_MYCS5       SEDIVTILSNLKKVVLNYDEDYVKDNQIIKL------SLNANEDN--RITSNHLTVT---
RPOA_AYWBP       YEDVMTIILNLKKIVFAVDDESDD----------FEEKLELIAKG--PQRLTAASFE---
RPOA_DEHMC       KEDTLDFLLNLKNIRVESLS-------------GLEGILYLRASG--SKVVTAADIE---
RPOA_OSTTA       RESVIEIFLNLRELIFTPTATCAQKVKQTKPFVYAKLNSELKIDNF-PYVVTAKDLH---
RPOA_SINAL       QESVHEILMNLNEIVLKS----------NLY-GTRNPFICVQGPGY----ITARDII---
RPOA_AETGR       QESVHEILMNLQEIVLRS----------NLY-GTCNALICVQGPGY----ITARDII---
RPOA_LIRTU       EESVHEILMNLKEIVLRS----------HLY-GTRDASICVRGPRY----VTAQDII---
RPOA_DRIGR       EESVHQILMNLKEIVLRS----------NLY-GTCDASIFVRGPRC----VTAQDII---
RPOA_ACOCL       EESVHEILMNLKEIVLRS----------NLY-GTRDASICVRGPRC----VTAQDII---
RPOA_VITVI       QESVHEILMNLKEIVLRS----------NLY-GTRGAFICARGPGY----VTAQDII---
RPOA_PLAOC       EESVHEILMNLKEIVLRS----------NLY-GTRNASICIRGPGY----VTAQDII---
RPOA_NANDO       EESVHEILMNLKEIVLRS----------NLY-GTCDASICVKGPIN----ITAKDII---
RPOA_RANMC       EESVHEILMNLKEIVLRS----------NLY-GTRDASICVKGPGY----VTAQDII---
RPOA_NICTO       QESVHEILMNLKEIVLRS----------NLY-GTSDASICVKGPGY----VTAQDII---
RPOA_PANGI       QESVHEILMNLKEIILKS----------NLY-GTCDASICIRGPGY----VTAQDII---
RPOA_COFAR       QESVHEILMNLKEIVFRS----------NLY-GTCDASICVRGPGY----VTAQDIV---
RPOA_LACSA       QESVHEILMNLKEIVLRS----------NLY-GTCEASICVRGPGY----VTAQDII---
RPOA_SPIOL       QESVHEILMNLKEIVLRS----------NLY-GTCEASICVRGPRG----VTAQDII---
RPOA_EUCGG       QESVHEILMNLKEIVLRS----------NLY-GTRNASICVKGPGC----VTAQDII---
RPOA_OENEH       QESVHEILMNLKEIVLRS----------NLY-GTCNASICVKGPGC----VTAQDIL---
RPOA_CITSI       QESVHEILMNLKDIVLRS----------NLY-GTCDALICVKGPGY----VTAQDIL---
RPOA_GOSBA       QESVHEILMNLKEIVLRG----------NLY-GTRNAFICAKGPGY----VTAQDII---
RPOA_POPTR       QESIHEILMNLKEIVLRS----------NLY-GTHDASICVKGPGC----VTAQDII---
RPOA_CUCSA       QESVHEILMNLKEIVLRS----------NLY-GTRDASICVKGPGC----VTAQDII---
RPOA_MORIN       QESVHEILMNLKEIVLRS----------NLY-GTRDASICVKGPGY----VTAQDII---
RPOA_JASNU       QESVHEILMNFKEIVLRS----------NLY-GTCDASICVRGPGY----VTAQDII---
RPOA_PHAVU       EESVHEIFMNLKEIVLKS----------NMY-GIQDASISFKGPGY----ITAQDII---
RPOA_LOTJA       QEPVHEILMNLKEIVLKS----------NLY-GIRDASICFKGPGY----VTAQNII---
RPOA_PIPCE       EESVHEIVMNLKEIVLRS----------NLY-GTLDASICIRGPRY----VTAQDII---
RPOA_AMBTC       EESVHEILMNLKEIIVRS----------DLY-GTRDAFICVRGPKY----VTAQDII---
RPOA_NYMAL       EESVHEILMNLKKMVFRS----------DLY-GTLDASICVRGPRH----VTAQDII---
RPOA_ORYSJ       EESVQEILLNLKEIVLRS----------NLY-GVRTASICVKGPRY----ITAQDII---
RPOA_PHAAO       EESVHEILLNLKDIVLRS----------NLY-GVRNASICVRGPKY----ITAQDII---
RPOA_PINTH       EESVHDILMNLKEIVFRS----------DSY-GIREASIYIVGPRN----VTAQDII---
RPOA_PSINU       KESIHDILINLKEIVLQS----------DSY-ETQKASISILGPRD----VTAGDIL---
RPOA_ANGEV       EESINDILINFKEIVLRS----------DSY-ETQKAYISITGPKD----ITAEDIL---
RPOA_MARPO       QESIHDILINLKEIVLKS----------ESF-EPQKAYISVLGPKK----ITAQDIK---
RPOA_ANTAG       QESVHDILINLKEIVLKS----------NSY-KTQEASISILGPKR----VTAEDIV---
RPOA_HUPLU       QESVHDILINSKEIVLKS----------KSS-EAQKAFISIVGPRR----VTAQDIE---
RPOA_ADICA       QETIHDVLVNLKEIVLRG----------DSKEDIQEAFLSVTGPKE----VTAGDLS---
RPOA_CHAGL       QESVHDILINLKKIILSS----------SFS-GIFEGFLSVVGPKT----VLASDLN---
RPOA_CHAVU       RESIQDILLNLKEIVFKG----------VCD-KTQKGFIFVKGPKK----ITASDIQ---
RPOA_STAPU       RESVDEILLNLKQIVIKGAKGASI---TPLDHKEYRASIFAQGPGV----VTAEHIK---
RPOA_ZYGCR       RESIHDILLNLKDIVFKS---------DTLERQE--GILLFNGPGI----VTAQHIK---
RPOA_MESVI       RESVLEILLNLKEIVFRTK----------SLD-VQKGYLSIQGPCV----VKAANL----
RPOA_CHLAT       REAVLDILLNLKEIVLKTQ----------SQE-TQRGHLSVQGPST----VLARDL----
RPOA_PYRYE       REDVLEILLNLKEVVFKSY----------NKE-SQIGRIRVQGPAI----VTAGLF----
RPOA_GRATL       REDVLEILLNLKKVVLKSH----------SDT-PQIGRIRLQGPAI----ITTGLF----
RPOA_GUITH       REDVLEILLNLKEIVFSGQ----------LQE-STIGRLTVQGPAI----VTARSF----
RPOA_CYAPA       KEDVLELLLNLKNIVLKSY----------TNE-PQIGRLKIQGACK----VTTANF----
RPOA_CYACA       KEDVLEILLNLKNIVLKGN----------VLK-NQIGRLKVQGPAI----VTSGQI----
RPOA_CYAM1       REDVLQIMLNLKQIVWRGQ----------LKKQPTITRLKVQGPAI----VTAAAFQS--
RPOA_TRICV       REDILEILLNLKGIVLKSK----------TND-LKFGRLKIKGPAV----VTANCI----
RPOA_THAPS       REDILEILLNLKGIVLKSK----------TPN-RQFGRLRLQGPAV----ITASSI----
RPOA_PHATC       REDILEILLNLKGIICTSQ----------IQD-TQFGHLKVQGPSV----VTADLI----
RPOA_TRIV2       REDVLEIIMRMKEVILKS-----------YSSQAQIGRLLVNGPTT----ITASHFD---
RPOA_TRIEI       REDVLEILLNMKEVVLKS-----------YSEQPQIGRLRVEGPAT----VTADRFD---
RPOA_SYNY3       REDVLEIMLNMKELVLKS-----------YTDQPQIGRLTAIGPGT----VTAAQFE---
RPOA_SYNE7       REDVLDILLNVRELVVHA-----------HSPQPQIGRLRVVGPAT----VTAADVD---
RPOA_SYNJA       REDVMEILLNMKELVLRS-----------NAPDTQVGRLVAQGPGE----VTAEKLQ---
RPOA_GLOVI       REDVLDILLNMKELVLRS-----------YTSDIQIGRLAVQGPKR----VTAADLE---
RPOA_THEEB       REDVMDILLQMKQLVIRS-----------HTSEPQMGRLFAQAPENEPLTVTAGMVQ---
RPOA_SYNS3       REDVLDILLNCKQLTVTS-----------RTDELEIGRLIVSGPAV----VKAKDLQ---
RPOA_SYNPX       REDVLDILLNCKELSVNS-----------RSPELEIGRLVVAGPAE----VTAKDLQ---
RPOA_PROMA       REDVLDILLNCKELTVNS-----------RSQELEIGRLVVTGPAE----VKARDLQ---
RPOA_PROM5       REDVLDILLNCKQLSINS-----------SNPELEIGRLVVSGPME----VKANDIQ---
RPOA_PROM1       REDVLDILLNCKQISVDS-----------RSQELEIGRLVVTGPAD----VKAKDIQ---
RPOA_EMIHU       KEDALEILLNLKQLVFKG-----------NLNEPIITRLNIQGPCI----VTAGDID---
                  :    .                                                     

RPOA_BUCAI       ----HDGD-VEIIKPQHVICHLTDE--NASIKMRIKVQRGRGYIPASSRVHLEED-----
RPOA_BUCAP       ----HDGD-VEIIKPDHLICHLTDE--NASIQMRIKVQRGRGYIPASSRIHMEDD-----
RPOA_ECOLI       ----HDGD-VEIVKPQHVICHLTDE--NASISMRIKVQRGRGYVPASTRIHSEED-----
RPOA_BAUCH       ----HDSD-VQIIKPQHILCHLTEE--NASINMRIKVQRGRGYVPASARIHKYD------
RPOA_WIGBR       ----HDGN-VEICHPEHVLCNLTHE--NSSINMRIKVQKGRGYVPAISRMHIED------
RPOA_BUCBP       ----HGND-VEIINLDHIICTLTCK--NASISMRIKVQCGRGYVPVISRTNVISDN----
RPOA_BLOFL       ----YDSSIISIVNPNHIICCITDQ--DTSIIMRIKVQRGRGYVPAFSRFSSDDQ-----
RPOA_BLOPB       ----YDSNSVKIVTPNHIICHITDK--NTSISMSIKVQRGRGYVPASSRFHSES------
RPOA_BUCCC       ----HDNS-TEIINNKHIICNLTCS--DASIDIRMKVTRGRGYITAKSRKENYDN-----
RPOA_COLP3       ----HDGD-VTIANPDHVICTLTG---EGSISMRIKVEMGRGYVPASARRDAEEE-----
RPOA_PSEA6       ----HDGD-VEIVNPSHVLCTLTG---EAELSMRIKVEMGRGYVPASTRRSSEED-----
RPOA_SHEAM       ----HDGD-VTIANPDHVICHLTG---NHDISMRIRVERGRGYVPASARAQNEDD-----
RPOA_AERS4       ----HGDE-VEIVNPEHVICHLTGA--NAEISMRLKVQRGRGYVPASARVHNDDE-----
RPOA_PSEHT       ----HDGD-VTIANPDHVICNLTTN--NSEISMRIRVERGRGYVPASSRLSSDDD-----
RPOA_IDILO       ----HDGD-VEIVNPEHVICHLTG---DYELVMRVKVERGRGYVPAASRQSADDD-----
RPOA1_PSYIN      ----HDSD-LEIVNPEHVICHLTG---NTEISMRIKIELGRGYVPASSRIHSEED-----
RPOA2_PSYIN      ----HGSD-VEIVNPEHVICHLTG---NAEISMRIKIESGRGYVPASSRIHTEED-----
RPOA_ACIBT       ----LPHN-VEVVNPEHLIGTLSA---TGSLKMRLKVSQGRGYETSDSR-FPEGE-----
RPOA_PSYCK       ----LPHN-VDIINPELVLGTLSD---RGHLKMRLRVVMGRGYEPANQR-REDGD-----
RPOA_HAHCH       ----LDHD-VEIANPDMVICNLNS---NGDVKMKLKVARGRGYEPADQRNSADDE-----
RPOA_MARHV       ----LDHD-VEIANPEHVICHLSE---NGEVNMRLRVARGRGYEPADQRGLDEDE-----
RPOA_PSEE4       ----LDHD-VEIVNPDHVIANLAS---NGALNMKLTVARGRGYEPADSRQTDEDE-----
RPOA_SACD2       ----VDHD-IEIKNPELVIANITS---DTSLSMRLTVSRGRGYQPVDARATDEDE-----
RPOA_CHRSD       ----VDHD-VEIVNPDHVIAHLND---SGELKMQLKVVRGRGYEPADTRASEEDE-----
RPOA_ALCBS       ----RDHS-VEIVNPDHLICTITG---DTELRVKLKVQKGRGYVAADSRQSEDDE-----
RPOA_NITOC       ----LEHD-VEVINPEHVIAHLTK---SGELNLTMKVVRGRGYQSASMRIPKEED-----
RPOA_XANOM       ----TDHN-VEIINGDHVICHLTK---DTALNMRLKIERGFGYQPAAARRRPDEE-----
RPOA_XYLFT       ----TDHN-VEIINDGHVICHLTK---DTTINMRLKIERGFGYQPAVVRRRPDDE-----
RPOA_ALKEH       ----TAHD-VEVKNPELLICTLTK---AVAFNAKLMVARGRGYEAATQRDGDEDR-----
RPOA_HALHL       ----TDHD-VEIQNPDLHIATITH---EQPFKASLKIERGRGYLPVTAREEEDTR-----
RPOA_AZOSB       ----GGHD-VEIINPDHVIAHLAP---GGKLEMQIKVEQGRGYVPGNARPVSA-E-----
RPOA_NITMU       ----GGHD-VEIINPDHVVAHLTS---GGKLDMQIKVEMGRGYVPGTVRQLAH-E-----
RPOA_DECAR       ----LPHD-VEIINPEHVIAHLSP---GGKLAMEIKVEKGRGYVPGNVRNLG--D-----
RPOA_POLNA       ----TPHD-VEIVNPDHVIMNLSH---GGKIDMQIKVENGRGYVPGNVRRYGDES-----
RPOA_RHOFT       ----TPHD-VEIINPDHVIAHLSQ---GGKLDMQIKVEKGRGYVPGTMRRHGDEP-----
RPOA_METPP       ----TPHD-VEIINPDHVITHLSQ---GGKLDMQIKVEKGRGYVPGTMRRFGDEP-----
RPOA_RALSO       ----LPHD-VEIINPGHVIASLSA---GGKLDMQIKVEQGRGYVPGNVRKFGDES-----
RPOA_BORA1       ----LPHD-VEIVNPEHPICNLTD---AGKLEMQIKVEKGRGYVPGNVRALSEDR-----
RPOA_NEIG1       ----LPHD-VEILNPGHVICHLAD---NGQIEMEIKVEQGRGYQSVSGRQVVRDE-----
RPOA_CHRVO       ----LPHD-VEVINPEHVICHISS---GGKIDMEVKVEKGRGYQPVSAR-TSHDD-----
RPOA_THIDA       ----VGHD-IEVLNPDHVIAHLTK---GGKLDMEIKIEAGRGYQPATARKVSE-E-----
RPOA_METFK       ----TGHD-AEIANPDHVIAHLTK---GGKLNLEVKVEMGRGYQPVPQRRKTEDE-----
RPOA_NITEC       ----SSHD-VEIVNPEHVIAHITS---GGRIEAQITVEKGRGYLPSVNRSREDKS-----
RPOA_METCA       ----ASHD-VEVLNPELLIAHING---NGRLRMTLHVQKGRGYQPVANRAIEGDS-----
RPOA_LEGPA       ----LTHG-QEIINPELVIANLNE---KGKLNMTLKVERGIGFHNTDAFVRYHDDE----
RPOA_COXBU       ----TESG-VKIVNPDHVIAHITK---DGEINMTLKAAMGRGYEPSSA--RSTGD-----
RPOA_HYDCU       ----LNHD-TEIMNPDLVIAHLGE---GAELSMKLKVEKGIGYRAAVQ---SSDS-----
RPOA_DICNV       ----LPAG-VEIVNPDCVIAHLTR---DIPFSLTAVVEKGRGYRVAPQ----ADDN----
RPOA_VESOH       ----TNGIDITTFNPDKVIATIND---EGHMRMTLKITAGIGYDAAASRTDEASS-----
RPOA2_FRAT1      ----LSEG--LAITEEVFICSYNG---GKKLKIEAKVEKGVGFRPAQDNFKD--------
RPOA1_FRATN      ----TTQG-VEIINKDQPIATLTN---QRAFSLTATVSVGRNVGILSAIPTELER-----
RPOA_NEOSM       ----PSHD-FEVVNGDLLICNVAE---GVSLEMEMKVSSGFGYVSSVSVRKDEYD-----
RPOA_KORVE       ----TDAD-VEILDKDVYIATISE---GGKLDMEMRLKKGRGYVSADKNF----------
RPOA_SOLUE       ----TDAD-VEVLDRDVHVATVSE---GGKLNIEMRLKSGRGYVSADKNF----------
RPOA_LEPBL       ----VDSS-IEIMNPDLHIATLNE---DANLVMDLEIQRGRGYVPAEEKK----------
RPOA_ANADE       ----TDAQ-VEVLNPGHHILTISE---GGRVRAEMTARRGRGYVPAERNK----------
RPOA_MYXXD       ----TDPD-TEILNPGHHICTISE---GGKLRMELTCRRGRGYTPANVNK----------
RPOA_GEOMG       ----TDAN-VEILNPDHHIATCSK---DANLEMEMVVKLGKGYVPSDRNR----------
RPOA_GEOSL       ----TDPQ-VEILNPEHHIATCSK---DANLEMEMVVKVGKGYVPADRNR----------
RPOA_PELPD       ----VGHN-VEIMNPEHHIATCGK---DAHFEMDMTVKMGKGYVSADKNR----------
RPOA_PELCD       ----TDSH-VDVLNPDHHILTCGK---DADIELDMVVAMGKGYVPAERNR----------
RPOA_SYNFM       ----GGPH-VEVLNPEQHICTLEK---DARLRMELTVKQGKGYLPADRNI----------
RPOA_BDEBA       ----TTDK-IEVLNPDLPIATLGA---NANFNAEIVVSFGRGYVPVE-NR----------
RPOA_SYNAS       ----TDGT-VEVLNEDHYIASLSG---DMPFRMEMVVNSGRGYVQAKKEK----------
RPOA_DESPS       ----PSAF-VEIMNEDHILCNLTS---DMTFCAELTVEWGKGYQPAENQE----------
RPOA_DESVV       ----TNQH-VMVLNPDQHIATLTE---DIELTFELEVRMGKGYVPADMHE----------
RPOA_DESAG       ----CNQH-VMVLNADQHLMTLTE---DVELTFELEVRMGKGYVPADMHE----------
RPOA_LAWIP       ----TNQH-VEVLNPEQHIATLTE---DIELRMEFEVRMGKGYVPAEMHE----------
RPOA_RHILO       ----TVGD-VEILNPDHVICTLDE---GAEIRMEFTVDTGKGYVPAERNR----------
RPOA_BRUME       ----TVGD-VEILNPEHVICTLDE---GAEIRMEFTVNTGKGYVPADCNR----------
RPOA_BARQU       ----TVGD-MEILNPEHVICTLDE---GAEIRMEFIVNTGKGYIPSDRNC----------
RPOA_BARBK       ----TVGD-MEILNPEHVICTLDE---GAEIRMEFIVNTGKGYVPSDRNC----------
RPOA_NITWN       ----TVGD-VVVLNPDLQICTLDD---GAEIRMEFTVASGKGYVAAERNR----------
RPOA_CAUVC       ----TPAD-IEILNPDHVLCTLDD---GASVRMEFTVNNGKGYVPADRNR----------
RPOA_MARMM       ----ETAD-VEIVNKDLALCTLDE---GAEIRMEFTINTGKGYVPSERNR----------
RPOA_MAGSA       ----VGHD-IEIMDPELVLCTLDE---GAKLNIEFTVETGKGYVPASQNR----------
RPOA_RHORT       ----MGSD-IEIMNPDLVICHLDE---GATLSMEFTVGMGKGYVPSTQNR----------
RPOA_GRABC       ----AGHD-IEIMNPDLVLCTLDD---GVKLGMEFTVNLGKGYVPASQNR----------
RPOA_ROSDO       ----ESAG-IEILNRDHVICHLDD---GADVYMELTVNQGKGYVSAEKNK----------
RPOA_JANSC       ----ESAG-IDVLNKDHVICHLDD---GADLYIELTVNTGKGYVAADKNR----------
RPOA_PARDP       ----ESAG-ITILNRDHVICHLDE---GAELHMELAVANGKGYVAADKNR----------
RPOA_HYPNA       ----TPGD-VKILNPDLVICTLDG---GSEVRMEFTVATGKGYVAAEAHR----------
RPOA_NOVAD       ----VTGD-IEVMNKDLVICHLDE---GATFNMELTVDTGKGYVPAVSNR----------
RPOA_SPHAL       ----VSGD-IKVMNPNHVICHLDE---GATLNMELVADTGKGYVPATANR----------
RPOA_ERYLH       ----VSGD-IEVMNKDLVICHLDE---GATLNMELTADIGSGYVPAVQNR----------
RPOA_ZYMMO       ----VSGD-IEVMNPELVICHLDQ---GAVFNAELTVDTGKGYVAAVANR----------
RPOA_PELUB       ----PVAD-IEILNPDLVICNLDE---NTHFHMEMNVGTGKGYVPAVMNK----------
RPOA_MAGMM       ----CETG-IEILNPDHHIATLNK---SGTLDITMTVTTGKGYVRAQLNR----------
RPOA_RICTY       ----TGHD-VEILNPNHVICNLAK---NKQLEMELTCKVGKGYVLSTNSY----------
RPOA_RICBR       ----AGHD-VEILNPDHVICNLAK---NKQFEMELTCKVGKGYTLSTNNN----------
RPOA_ANAMM       ----DSEG-CVVLNKDLHICTLGK---DVDFSMKIYVNSGKGYVPASEYRAASRSGA---
RPOA_ANAPZ       ----DSAD-HVVLNKDLHICTLGK---DVDFCMKIYVNSGKGYVPATEYRAASRSGG---
RPOA_EHRRW       ----DTPD-CTILNKDLLICTLDQ---DVDFNIKMYVNSGKGYVPAVKRKSINKFG----
RPOA_WOLPM       ----TDDQ-CSIVNKDLLICTLGQ---NVELNMTIYVASGKGYLPVTKYKENELLKL---
RPOA_WOLTR       ----TDDQ-CSIVNKDLLICTLGQ---DVELNMTIYVASGKGYLPVTKYKENEFLKP---
RPOA_RHOBA       ----TDAD-VEIINKDHVICTLTD---DVPFMMEMVVETGRGYVPSTEHS----------
RPOA_TREDE       ----VEGQ-LEILGEPFYVMELMK---GANVSFDVQVDFGRGYVPAEVNE----------
RPOA_TREPA       ----KKFQ-LEVLSQDLLIMEMMD---GAHVEVELHVEFGRGYVPAESHD----------
RPOA_BORBP       ----FERDGVEVFNRDLVIATLSQ---DVNLDLEFQINYGRGYVSSEQNS----------
RPOA_BACTN       ----KYLTGFEVLNPELVICHLDS---KATMQIDITINKGRGYVPADENR----------
RPOA_PORGI       ----AQLSNFEVLNSNLVICHLDK---SATLTMEFSINKGRGYVSAEENR----------
RPOA_GRAFK       ----KFISGFQVLNPDQVICHMDK---KVSLNMEITIEKGRGYVPAEENK----------
RPOA_CYTH3       ----KFTSAYQILNPELLICNVDS---NSNFDIELTLEKGRGYLPAEENK----------
RPOA_PELLD       ----AQEGEFEVLNKDLYIATVNE---GSTLNIDVYIGRGRGYTPAEESR----------
RPOA_CHLPD       ----AKEGEFEVLNKDLHIATVND---GSVLNIEIYIGRGRGYLPAEENH----------
RPOA_CHLTE       ----AQEGEFEVLNKDLHIATINS---EATVTIDIYIGRGRGYVPAEENR----------
RPOA_CHLCH       ----PQEGEFEVLNKDLHIATINA---GTTVTLDIFIGRGRGYVPAEENR----------
RPOA_SALRD       ----EATAEYDVLNPDQHVATLAE---DAVVNVDLRVGYGRGYVPSEENK----------
RPOA_CAMJE       ----LNNDQVEVVNKDAYLATINE---DAELKFTLIVEKGIGYVPSEEIKELIN------
RPOA_CAMFF       ----LNNDIVEIVNPDSYLATINE---DAELKFSLIVEKGIGYVPSEEIRDYI-------
RPOA_HELHP       ----LVNDMVGIVNPEAYLATINE---NASLSFSLIVQKGIGYVPSESIRGKI-------
RPOA_WOLSU       ----LVNDYVDVVTPNQHLATINE---DATLTFSLIVQKGIGYVPSEETRNLI-------
RPOA_HELAH       ----LNSEHIEIINPEMLLATINE---DAQLNFSLIIYKGMGYVPSEITRELM-------
RPOA_SULDN       ----LSNSEVEIVTPNTHLATLNE---DSTLNFSIRIAQGIGYVASEDTYDEL-------
RPOA_CHLMU       LGDLLQEGTFEAVNPEHVIFTVTR---PMQLDVMLRVAFGRGYTPSERIVLEER------
RPOA_CHLFF       LADLLQEGGFEAVNPEHVIFTVTQ---PMQVEVALRVAFGRGYSTSERIILEDK------
RPOA_CHLPN       LQDLLQEGDFEAVNPDQVIFTVTQ---PIQLEVVLRIAFGRGYTPSERIVLEDK------
RPOA_PARUW       LQDVVQEGNFEIVNPELHLFTVTK---PMRRQVDLRIAFGRGYVPSERHVVRDK------
RPOA_AQUAE       -----TPPNVEILNPDQYIATITDP--NKELNIEIRVERGRGYVPVEEME----------
RPOA_THEMA       -----TPAGIEVVNPDLHIATLNS---KADLFFEVYAEVGKGFVPVSERE----------
RPOA_COREF       -----PPADVEIHNPDLHIATLNE---NAKLDIELIVERGRGYVPATMT-ATG-------
RPOA_CORDI       -----PPAGVEIHNPDLHLATLNE---QGRLDIEMIVERGRGYVPATLY-SGP-------
RPOA_CORJK       -----VPAGVEVHNQDLHIATLNE---QGKLEIEMTVERGRGYVPAA---TAS-------
RPOA_BIFAA       -----PPAGVTIANPDMHIATLAE---DGELEIEFTVERGRGYVPAQMNKQDN-------
RPOA_FRAAA       -----PPAGVEVHSPELRLATLND---KGKLEIELTVERGRGYVSAAQNKQAG-------
RPOA2_STRAW      -----PPAGVEVHNPDLVLATLNG---KGKLEMELTVERGRGYVSAVQNKQVG-------
RPOA_THEFY       -----PPAGVEVHNPEMHIATLNS---KGKLEMEMTVERGRGYVSAAQNKQPG-------
RPOA_ACIC1       -----APAGVEVHNPDLHIATLND---KGKLEIEMVVERGRGYVPAAQNKLPG-------
RPOA_ARTS2       -----PPAGVEFHNPDLHIATLNS---KGKFELELTIERGRGYVSAAQNKSGD-------
RPOA_NOCSJ       -----PPAGVEVHNPDLKIATLSD---KGKLEMELVVERGRGYVSAVQNKGAD-------
RPOA_MYCLE       -----PPAGVTLHNPGMRIATLND---KGKIEAELVVERGRGYVPAVQNRALG-------
RPOA_MYCS2       -----PPAGVTVHNPDMHIATLND---KGKLEVELVVERGRGYVPAVQNKASG-------
RPOA_RHOJR       -----PPAGVTVNNPDLHIATLND---KGKLEIELVVERGRGYVPAVQNKASG-------
RPOA_SACEN       -----PPAGVTVHNPDLHIATLNG---KGKLEIELVVERGRGYVPAVQNKQTG-------
RPOA_CUTAK       -----PPAGVTIHNPELHIATLND---DGRFEMELIVERGRGYVSSALNDDPN-------
RPOA_LEIXX       -----APAGVEIHNPELVIATLND---KAKFEVELTIERGRGYVSAQQNRNEY-------
RPOA_TROWT       -----VPTGIEIGNGDLVIATLAK---DAVFDMQLTIERGRGYVSAEQNRNDG-------
RPOA_RUBXD       -----LKADVEVVNPDAYIASLSE---GGHLDMTLTVERGQGYVPAEQNKSDA-------
RPOA_GEOTN       -----HDSDVEILNPDLHIATLAE---GGRLRMRMTARRGRGYVPAEANKR---------
RPOA_BACHD       -----HDSDVDVLNPDLHIATLTT---GAHLRMRITAKRGRGYVPAEGNKS---------
RPOA_OCEIH       -----YDSDVEVMNPDLHIATLNS---KGNLHMKLIAERGRGYRPAEENKN---------
RPOA_LISW6       -----YDSDVEILNPDLHIATLSD---NAKFHVRLNATRGRGYTPADQNKR---------
RPOA_STAS1       -----HDSDVEILNPEIKIATVSK---GGHLKIRLVANKGRGYALAEQNKT---------
RPOA_LACPL       -----GDADVEVLNPDLPICTVAD---GAHFHMRMTANTGRGYVSAEDNKHRE-------
RPOA_LACBA       -----AGADVDILNPDLYIATVAD---GATFHMRMTADKGRGYVSADENKTRN-------
RPOA_LACS1       -----SNSDVEVLNPEQYICTVAD---GAELHVRMNANKGRGYVSANDNKALA-------
RPOA_LACP3       -----ADPDVEVLNPEQYICTVAD---GGHFHVRMTVKKGRGYVAADQNKS---------
RPOA_PEDPA       -----GDGDVVILNPELPICTVAE---GTTFHAVLTADTGRGYTSADENKARK-------
RPOA_ENTFA       -----VDSDVEILNKDLVICSVAE---GATFHARLTVKPGRGYVQADENKK---------
RPOA_CLONN       -----SDGNVEIMNKDMHIATLDD---DGKLYMEINVDNGRGYVTQNKNKK---------
RPOA_CLOAB       -----TDGSVEVINKDLHIATLDE---DGKLYMEIEVNRGRGYVTQNKNKR---------
RPOA_CLOTE       -----TDSDVEIINKDLHIATLDD---DGKLYIEMTVDRGRGYVSQNRNKV---------
RPOA_CLOPS       -----TDGDVEVVNKDLHIATLDN---DGKLYMEIVVNRGRGYVTQNKNKT---------
RPOA_CLOD6       -----CPPDVEILSKDLAIATLDD---NAKLNMEIFVDKGRGYVSAEENKT---------
RPOA_CARHZ       -----APPEVEILNPDLVIAHIAE---GGRLFMEMTVARGRGYVPAERNKK---------
RPOA_MOOTA       -----TGADVEILNPEQVIATVEK---GGRLYMEMTVEKGRGYVSADKNKK---------
RPOA_DESHY       -----TDADIEILNPDLKIATLDK---DGRLFMEMTAERGRGYVSADKNKK---------
RPOA_HUNT2       -----ADADVEILNPEHKIATLSG---DHRLYMEMTIDKGRGYVSAEKNKH---------
RPOA_SYMTH       -----TDADVEILNPDLHIATLDK---GGRLIAEITVSKGRGYVPADQNKT---------
RPOA_CALS4       -----GGPELEILNPDHHIATLSD---DGKIHMEIVFVKGKGYVPAEKNKE---------
RPOA_SYNWW       -----PDAEVEILNPDLHLASLDE---DGKVEIEMTVERGRGYVSSDQQPQ-K-------
RPOA_LACGA       -----VDSDIEVLNPDQYICSIAD---GGHLHMNVAIKNGRGYVPASENK--T-------
RPOA_LACAC       -----VDADVQVLNPDQYICTIAE---GGHLHMELAVKNGRGYVAASDNK--S-------
RPOA_LACDB       -----ADADVEVLNPDQYICTIAQ---GGHLHMWIDVCNGRGYVPASENK--T-------
RPOA_STRSV       -----TDSDIEIINPDHYLFTIGE---GASFKATMTVNSGRGYVPADENK--K-------
RPOA_STRS2       -----TDSDIEIVNPDHYLFTIAD---GATFKAVLTVNSGRGYVPAEDNK--K-------
RPOA_LACLS       -----TDSDIEIVNKDHYLFSIAE---GHSMRAVMTVKKGYGYVPADENK--V-------
RPOA_LEUMM       -----GGADVEVLNPDLHIATVAA---GKSLHMTVTAVKGRGYTSADENKKLR-------
RPOA_OENOB       -----SDGDVEILNPDLHIATVSA---GKSLHMALTAVRGRGYDSAEENK-AK-------
RPOA_DEIGD       -----VPSDAEIVNPDLTIATLAE---DGKLVMEVRVEEGEGYVPADKHAT---------
RPOA_DEIRA       -----VPTDAEIVNPDLVIANLAE---DGKLVMEVRVEEGEGYVSADKHAT---------
RPOA_THET8       -----PVADVEIMNPDLHIATLEE---GGRLNMEVRVDRGVGYVPAEKHGI---------
RPOA_FUSNN       -----ADIGLEIVNPEQVICTVTT---DRTLDIEFIVDTGEGFVVSEEIDK---------
RPOA_MYCMS       -----IPAGVEILNKDLLIATISE---GGVLDLVLYAKNSRGYKTFKDNKNEK-------
RPOA_MESFL       -----LPAGVEVLNKDLVIANVAE---GGNLDLVLYAKNSRGYKTFKENKELK-------
RPOA_MYCGE       -----CPAGFEVINKDLYLFSLQK---DMKLTVSVYVKQGRGFTSFLENREL--------
RPOA_MYCPN       -----CPAGFEVVNKDLYLFSLQT---DKKVTVNVYVKQGRGFVTFLENREM--------
RPOA_MYCGA       -----CPLGFEVFNKDLEICTLSE---DAEVAIDIYATRGRGFKTAAENRSE--------
RPOA_MYCPE       -----TPVGFEIINKDMYIATIES---GVKFKMELFVKTGRGFTTFSENKEL--------
RPOA_UREPA       -----CPVGFEIVNQDLYIAEVTK---PIDVEIEIFAKTGRGRVDFNTNKDF--------
RPOA_MYCMO       -----LPIGAEIVNPGLLIATTAA---ANVLEIDVFVRAGRGYVDFEENKKYIDEIKTNL
RPOA_MYCPU       -----ENPEIEIVNKDLEIATNNG---QKPFVMEVYFHVGRGYISFEDNKKLIEEKVALL
RPOA_MYCH7       -----SHSGLKIVNPDLYIADVSK---VGALKFELFITNGKGFVDFETNKKYVNEVISRL
RPOA_MYCS5       -----NAPRVEVQNKDVEIATLSK---PGVLKLEMFLRAGRGYVDFEDNKKFIEEKEKEL
RPOA_AYWBP       -----LPAGVKIINPDHYITTLSD---DVCFHMTVTIKKGIGYVGAKENKVHI-------
RPOA_DEHMC       -----PSNDFEVVNPELYLLTLDSD--DAVLNVELEVELGRGYRPPESAE----------
RPOA_OSTTA       ------IPEYEFVDPNQQIATILSPTAAENFKLTLLIGQGRGYQSWKKLPGVPQLMDQRF
RPOA_SINAL       -----LPPSVEIVDNTQHIATLTE---PINLCIGLKIERNRGYSLKMSNN----------
RPOA_AETGR       -----LPPSVEIMDNTQHIATLTE---PIDLCIGLQIERNRGYSLKMPNP----------
RPOA_LIRTU       -----PPPSVEIVDTTQHIASLTE---PIDLCIELQIERDRGYRMKTPNN----------
RPOA_DRIGR       -----SPPSVKMVDTTQHIASLTE---PIDLCIGLQIERDRGYRMKTPNN----------
RPOA_ACOCL       -----SPPSVEVVDTTQHIASLTE---PIDLCIGLQIQRDRGYRMKTTKN----------
RPOA_VITVI       -----SPPSVEIVDNTQHIARLME---PIDLCIGLQIERNRGYSIKRPNN----------
RPOA_PLAOC       -----SPPSVETVDNTQHIANLTE---PIDFCIELEIERNRGYRMKTPNN----------
RPOA_NANDO       -----SPPSVEIVDTTQHIASLTE---PFDLCIGLQIERNRGYRMKTPNK----------
RPOA_RANMC       -----SPPSVEIVDTTQHIASLTE---PVDFCIGLQIESNRGYRMKTPNN----------
RPOA_NICTO       -----LPPYVEIVDNTQHIASLTE---TIDFCIGLQIKRNRGYLIKTPHN----------
RPOA_PANGI       -----SPPYVEIVDNTQHIASLAE---PIDLCIGLQIERNRGYLIKTPNNN---------
RPOA_COFAR       -----LPPYVEIVDNTQHIARLME---PINLCIRLEIERNRGYLIKTPQN----------
RPOA_LACSA       -----LPPYVEILDNTQHIASLTE---PIELVIGLQIEKNRGYLIKAPNT----------
RPOA_SPIOL       -----LPPYVEIVDNTQHIASLTE---PIDLCIGLQLERNRGYHIKAPNN----------
RPOA_EUCGG       -----LPTSVEIVDNTQYIANLTE---PINLCIGLQIERNRGYHIKTPKN----------
RPOA_OENEH       -----LPPSVEIIDNTQHIASLME---PIHLCIGLQIERNRGYHIKSPNN----------
RPOA_CITSI       -----LPPSVEIVDNTQHIASLTE---PIDLSIGLQIERSRGYNIKTPNT----------
RPOA_GOSBA       -----LPPSVEIVDNTQHVASLTE---PIDLCIGLQIERNRGYGIKTPKN----------
RPOA_POPTR       -----LPPSVEIIDNTQHIASLRE---PIDLHIGLEIERNRGYCMKPPKN----------
RPOA_CUCSA       -----LPPSVEIVDNTQHIANLME---PINLCIELKIERNRGYHIQTPNN----------
RPOA_MORIN       -----LPPSVEIVDNTQHIANLTE---PITLCIELQIERNRGYRIKTPNN----------
RPOA_JASNU       -----LPPYVEIVDNTQHIASLTE---PIDLCIGLQIERNRGYLMKMPHN----------
RPOA_PHAVU       -----LPPSVEIVDNRQHIANVTE---PVHLCIELKIERNRGYRIKTLKN----------
RPOA_LOTJA       -----LPPSVVIVDNTQHIANVTE---PIQLCIGLQIERDRGYRINTLKN----------
RPOA_PIPCE       -----LPPSVEIVDATQHIANLTE---RVDLCIKLQIERDRGYSMKTPHN----------
RPOA_AMBTC       -----SPPSVKIVDTTQHIASITE---PINFCIGLEIERNRGYRTRTTN-----------
RPOA_NYMAL       -----SPPSVEIVDTTQHIAVLTE---PVDLCIELKIERGRGYCTRTQNN----------
RPOA_ORYSJ       -----LPPSVEIVDTAQPIANLTE---PTDFRIELRIKRDRGYHTEVRKN----------
RPOA_PHAAO       -----SPPSVEIVDTTQHIANLTE---PINLCIELQIKRDRGYRMKSTND----------
RPOA_PINTH       -----LPPSVKIIDTTQHIARLTK---SITSDIRLQIEKNRGYIIHSPNN----------
RPOA_PSINU       -----LPTSVKIIDASQHIATITT---AIPLDVELRIERDCGYRTLNLKE----------
RPOA_ANGEV       -----LPPSVQAIDDSQHIATITK---DITLDIEIEIQKDRGYRIQDSKE----------
RPOA_MARPO       -----GPSCIKIMIIAQYIATLNK---DILLEIELNIEKDRGYRIENLQK----------
RPOA_ANTAG       -----LPSSVEVIDATQHIATITK---AVYFNIKLGIRKDRGYRIENPVK----------
RPOA_HUPLU       -----LPTSVEVIDPMQHIATITK---KVKLNIELKIEKDSGYRRQNIVE----------
RPOA_ADICA       -----LPPGVEAIDNSQYIATITQ---PISLTIELEIEKDCGYRIENLAK----------
RPOA_CHAGL       -----LPSFIKIVNPDQYIATVNK---PINFNLQIYIQKGKGYSLKNPIS----------
RPOA_CHAVU       -----IEPCIEILDSNQIIAHLTE---PIDFKVELTIEKSMGFRLQNATQI---------
RPOA_STAPU       -----FPSSILAVDPDQSIATLLN---ETQLCIELFIRQ-GIAKQLTRTKK---------
RPOA_ZYGCR       -----LPPVVQVVDNTQYIARLEM---PTSIEIHITLENTKTCTSLNTMPT---------
RPOA_MESVI       ----QLPTSIEVVDGGQYIATLSG---NANLDMEFVINTGKGYQMADYAI----------
RPOA_CHLAT       ----QLPSSIELVDPDQYIATISG---RVSLNMEFTVEVGKGYQLPDYEK----------
RPOA_PYRYE       ----ELSSDIEVVDPRQYIATICN---NTIFEMEFKIEKNCGYRLAEKA-----------
RPOA_GRATL       ----EVPPEILIIDPQQYIATICN---NTIFEMEFRIEKGSGYKLVNKG-----------
RPOA_GUITH       ----ELPPEIKLIDPEQYIATICG---NNTLEMEFKIEVGSGYKIVEKD-----------
RPOA_CYAPA       ----ELPSEVEIIHGTQYVATVAE---NAILEMEFKIEKGRGYKIIDKK-----------
RPOA_CYACA       ----EFPLDITVVDPCQYIATISG---NDYLEMELKVEKSSGYKLVETF-----------
RPOA_CYAM1       ----EANSSANIIDTCQYIATIDT---QDILEMECQLEQSSGYRLAK-------------
RPOA_TRICV       ----QLPSEVEIVNPNHYIATITT---SNVLEIEFKIESGTGYKLAGQT-----------
RPOA_THAPS       ----QLPPEIEIINPNHYIATISS---SHILEIEFKIESGSKYRLANEL-----------
RPOA_PHATC       ----QLPPGVEIINPNHYIATIST---SNILEIEFKFEYGSGYHLASQN-----------
RPOA_TRIV2       -----LPSEVEVIDPTQYVATIAE---GGKLEMEFRIERGKGYRTVERGR----------
RPOA_TRIEI       -----VPSEVEVIDRSQYIATLSP---GSILEMEFRIEKGTGYKAVDRTR----------
RPOA_SYNY3       -----VPSEVEVIDPNQYIATLAE---GAKLEMEFRVERGVGYRVIERGK----------
RPOA_SYNE7       -----FGPEVEVINPNHYIASLSE---GATLEMELKVEWGTGYRAIDRSH----------
RPOA_SYNJA       -----LPSEVEVINPRHHIATLAE---GAILEMEFMIGRGRGYRAVDYSD----------
RPOA_GLOVI       -----LPTEVQVVHPRHYIATLAE---DGQLEMEFQIERGKGYRAIERGS----------
RPOA_THEEB       -----LGSEVEVVNPNHYIATLMP---GATLEMEFKIEKDRGYRSVERVR----------
RPOA_SYNS3       -----FSSQVQVVDGERPIATVSE---GHSLELEVHVERGVGYRPVDRHN----------
RPOA_SYNPX       -----FSSQVEVVDGNRSIATVAD---GYSLELEVHVERGVGYRPVDRHS----------
RPOA_PROMA       -----FSSQVQIVDVDRPIATVHS---GHSLELELHVERGVGYRPVDRRN----------
RPOA_PROM5       -----FSSQVEIVDGDKPIATIQE---GHNLELEIHVERGVGYRPVDRRN----------
RPOA_PROM1       -----FSSQVEVVDGDRPIATVQE---GHNLELEIHVERGVGYRPVDRKN----------
RPOA_EMIHU       -----IPTDLELIDPQQYIATITD---FSHLEMEFILEQGESYVLSEKTA----------
                                   :                                         

RPOA_BUCAI       ---------SRPIGCLLVDACYSPINRISYNVEAARVEQRTD----LDKLVIEMETNGTI
RPOA_BUCAP       ---------LRPIGCLLVDACYSPINRISYNVEAARVEQRTD----LDKLIIEMKTNGTI
RPOA_ECOLI       ---------ERPIGRLLVDACYSPVERIAYNVEAARVEQRTD----LDKLVIEMETNGTI
RPOA_BAUCH       ----------RPIGRLLVDACYSPVENISYNVEAARVEQRTD----LDKLILEIETNGTI
RPOA_WIGBR       ----------RPIGRLLLDACYSPIERISYNVEAARVEQRTD----LDKLIIEMETNGTI
RPOA_BUCBP       --------KENYVGKLLVDACYSPVERMIYKVEAARVEKRTD----LDKLVIEMETNGTL
RPOA_BLOFL       --------HDLPIGRLLLDACYSPVERISYTVEAARVEKRTD----LDKLIIDMETNGTI
RPOA_BLOPB       --------DILPIGRLLLDACYSPVERISYNVEAARVEQRTD----LDKLIIDMETDGTI
RPOA_BUCCC       ---------EHIIGKLFLDVTYSPIERIMYTVESARVEQRTD----LDKLIIEMETNGTI
RPOA_COLP3       ---------DRAIGRLLVDASFSPVVRIAYDVDSARVEQRTD----LDKLVLDMETNGTL
RPOA_PSEA6       ---------DRPIGRLLVDASFSPVSRISYNVESARVEQRTD----LDKLIIDMETNGTI
RPOA_SHEAM       ---------DRPIGRLLVDASFSPVARIAYNVEAARVEQRTD----LDKLVIDMTTNGTI
RPOA_AERS4       ---------ERPIGRLLLDSAFSPIVRIAYNVEAARVEQRTD----LDKLVIDMETNGTL
RPOA_PSEHT       ---------ERPIGRLLLDASFSPVERIAYSVESARVEQRTD----LDKLIIDMETNGTL
RPOA_IDILO       ---------ERPIGRLLVDASFSPVERIAYSVDAARVEQRTD----LDKLVIEMETNGTL
RPOA1_PSYIN      ---------KSANGRLFVDATFSPVERIAYSVESARVEQRTN----LDKLVIDMETDGTL
RPOA2_PSYIN      ---------ERPIGRLLVDATFSPVERIAYSVESARVEQRTD----LDKLVIDMETDGTL
RPOA_ACIBT       ---------TRPVGRLQLDASYSPIKRVSYTVENARVEQRTD----LDKLVIDLETNGTV
RPOA_PSYCK       ---------TKAIGRLKLDASFSPVLRVAYQVENARVEQRTD----LDRLIIELETNGTI
RPOA_HAHCH       ---------TRAIGRLQLDSSFSPVLRVAYNVESARVEQRTD----LDKLVIDLETNGTI
RPOA_MARHV       ---------TRAIGRLQLDATFSPVRRVAYAVESARVEQRTD----LDKLVIDLETNGTI
RPOA_PSEE4       ---------SRSIGRLQLDASFSPVRRIAYVVENARVEQRTN----LDKLVIDLETNGTL
RPOA_SACD2       ---------TRAIGRLQLDASFSPVRRLAYSVESARVEQRTD----LDKLVLDLETNGTI
RPOA_CHRSD       ---------SRAIGRLQLDATFSPVRRVSYSVEAARVEQRTD----LDKLIIDLETDGTL
RPOA_ALCBS       ---------TRGIGRLQLDASYSPVRRVAYVVEAARVEQRTD----LDKLVIDLETDGTI
RPOA_NITOC       ---------ERSIGHLILDASFSPIRRVTYEVDSARVEQRTD----LDKLIIEIETNGTI
RPOA_XANOM       ---------TRTIGRLMLDASFSPVRRVAYAVEAARVEQRTD----LDKLVIDIETNGTI
RPOA_XYLFT       ---------NRTIGRLILDASFSPVRRVAYVVEAARVEQRTD----LDKLIIDIETNGTI
RPOA_ALKEH       -----------VIGRLQLDASYSPVKRVAYTVESARVEQRTN----LDKLVLDVETNGVL
RPOA_HALHL       -----------TIGHLALDASFSPVRRVSYAVESARVEQRTD----LDKLVLDVETNGVV
RPOA_AZOSB       ---------NKTIGRIVLDASFSPVRRVSYLVESARVEQRTD----LDRLVIDIETNGAV
RPOA_NITMU       ---------SRAIGSILLDASFSPVRRVSYAVESARVEQRTD----LDKLVMDIETNGVV
RPOA_DECAR       ---------AKTIGKLVLDASFSPIRRVAYAVESARVEQRTD----LDKLIVDIETNGVV
RPOA_POLNA       ---------PKSIGRIVLDASFSPVKRVSYTVESARVEQRTD----LDKLVLEIETNGAV
RPOA_RHOFT       ---------TKSIGRIILDASFSPVKRVSYTVESARVEQRTD----LDKLVVDIETNGAI
RPOA_METPP       ---------TKSIGRIVLDASFSPVRRVSYTVESARVEQRTD----LDKLVMEIETNGAI
RPOA_RALSO       ---------SKVIGRIVLDASFAPVRRVSYAVESARVEQRTD----LDKLVMNIETNGVI
RPOA_BORA1       ---------THTIGRIILDASFSPVRRVSYAVESARVEQRTD----LDKLVLDIETNGVI
RPOA_NEIG1       ---------NRQIGAIQLDASFSPISRVSFEVEPARVEQRTD----LDKLVLDIETDGSI
RPOA_CHRVO       ---------NRSIGTIQLDASFSPVRRVSFAVESARVEQRTD----LDRLVLDIETNGVI
RPOA_THIDA       ---------TRAVGSILVDASFSPVRRVAYAVESARVEQRTD----LDRLVIDIETNGVV
RPOA_METFK       ---------DRVLGFIQVDASFSPISKVSYQVESARVEQRTD----LDKLIMDVETNGII
RPOA_NITEC       ---------LSSIGDILLDASFSPVRRVSYTIENARVEQRTD----LDKLIIDIETNGSV
RPOA_METCA       -----------AIGTLHLDASFSPIKKVSYVVESARVEQRTD----LDRLVIELQTNGTV
RPOA_LEGPA       -------IEKKTVGKLKIDNSFSPVKKVAYFVDSARVENRTD----LDKLTIELETNGTI
RPOA_COXBU       --------QSRSVGLLLLDASYSPIRRVTYSVENARVEKRTD----LDKLIIDLETDGTL
RPOA_HYDCU       --------ESANIGVLKLDASFSPVKTVSYEVQNARVEQRTD----LDKLILNVVTDGTL
RPOA_DICNV       -------SESTRSNVLRLDASFSPVRRIAYRVEQARVEQRTD----LDKLIIEIESNGTI
RPOA_VESOH       ------------IGGMQLDASFSPIKRVSFTVDAARVKQKVN----LDKLNIMIETNGSV
RPOA2_FRAT1      -------------GEFLLDATFSPVVFCDFEIKDARVGRRTD----LDKLELNIKTNGNV
RPOA1_FRATN      ------------VGDIAVDADFNPIKRVAFEVFD-----NGD----SETLEVFVKTNGTI
RPOA_NEOSM       -----------LEGAVPIDAIYNPVRAVNFTVKPTSAGSFAG----HDKLILYVETNGAM
RPOA_KORVE       -------DEDLGLGFIPIDSVHSPVRKCNYSVEAARLGQITD----YDKLSIELWTNGSV
RPOA_SOLUE       -------DEDLALGYIPIDSVHSPVRKVNFAVEAARLGQMTD----YDKLTLEVWTNGAV
RPOA_LEPBL       -------KDIEVLGTIPVDSIFSPVQKVVFEVSETRVAQRSD----YEKLTLEVWTDGSV
RPOA_ANADE       -------VPGSPIGTIPIDALFSPIRKVNYQVTNARVGQQTD----YDKLTLEVWTDGSV
RPOA_MYXXD       -------VAGSPIGTIPIDSLFSPIRKVNYQVTNARVGQVTD----FDKLSLEVWTDGSV
RPOA_GEOMG       -------DEKAPVGTMPIDAIFSPIKKVNFTVSNARVGQMTD----YDKLTLEVWTNGSV
RPOA_GEOSL       -------DEKAPVGTIPIDALFSPIRKVNFTVSNARVGQMTD----YDKLTLEVWTNGSV
RPOA_PELPD       -------DEKAPVGTIPIDSIFSPIKKVNFTISNARVGQMTD----YDKLTLEIWTDGSV
RPOA_PELCD       -------DDKAPVGTIPIDSLFSPVKKVNFTVTNARVGQITD----YDKLILEVLTDGSV
RPOA_SYNFM       -------EENQPIGTIPIDAIFSPIRKVSYTVTQARVAQITD----YDKLTMEIWSDGSV
RPOA_BDEBA       -------ETDLPVGFIGVDALYSPIRKVNYNVSNARVGQRTD----YDALTLEVWTDGSL
RPOA_SYNAS       -------DVDQPEGTINIDALYSPIKKVNYTVTHARVGQIAD----YDKLSLEVWTDGNV
RPOA_DESPS       -------KDDLTVGQIPIDAIFTPVKKIQYVVSSARVGQQTD----YDKLTYEIETDGSV
RPOA_DESVV       -------GLSEEIGLIKLDASFSPVRKVAYTVEQARVGQMTN----YDKLILEVWTDGSV
RPOA_DESAG       -------GLSDEIGLIALDASFSPVRKVAYTVEQARVGQMTN----YDKLILEVWTDGSI
RPOA_LAWIP       -------DLHEEIGLIKLDSSFSPIRNVTYVVEQARVGQMTN----YDKLVLEVWTDGSV
RPOA_RHILO       ------AEDA-PIGLIPVDSLYSPVKKVSYKVENTREGQVLD----YDKLTMTIETDGSI
RPOA_BRUME       ------AEDA-PIGLIPVDSLYSPVRKVSYKIENTREGQVLD----YDKLTLNIETNGSV
RPOA_BARQU       ------VDDG-RIGLIPVDSLYSPIRKVSYKVENTREGQVLD----YDKLTLTIETNGAV
RPOA_BARBK       ------FDDA-PIGLIPIDSLYSPINKVSYKVENTREGQVLD----YDKLTLTIETNGAV
RPOA_NITWN       ------PEDA-PIGLIPVDSLYSPVRKVSYKVENTREGQILD----YDKLTMTIETNGGV
RPOA_CAUVC       ------PEDA-PIGLIAVDALYSPVKRVAYRVEPTRQGQSLD----YDKLILEVETNGAV
RPOA_MARMM       ------PEDA-PIGLIGVDALYSPVKRVSYKVENTREGQVLD----YDKLTLEVETDGTV
RPOA_MAGSA       ------PEDS-PIGLIPIDAIFSPVRKVAYKVENTRVGQVTD----YDKLSMTVETNGAV
RPOA_RHORT       ------PEDA-PIGYIPIDSIFSPVTKVSYRVENSRVGQVTD----YDKLSMVVETDGSV
RPOA_GRABC       ------QEDS-PIGLIPIDAIYSPVRRVSYKVEPTRVGQVTD----YDKLLLTVETNGAV
RPOA_ROSDO       ------PEDA-PIGLIPIDAIYSPVKKVSYDVQPTREGQVLD----YDKLTMKVETDGSL
RPOA_JANSC       ------PEDA-PIGLMPIDAIYSPVKKVSYDVQPTREGQVLD----YDKLTLKLETDGSL
RPOA_PARDP       ------PEDA-PIGLIPIDAIFSPVKRVSYEVTPTREGQVLD----YDKLTMKVETDGSL
RPOA_HYPNA       ------PEDA-PIGYIPIDAIYSPVRRVGYQVEDTREGTVLD----YDKLTLDIETDGSL
RPOA_NOVAD       ------PVDA-PIGLIPVDSLYSPVRQVSYKVENARIGQELD----YDKLNLTVETDGTV
RPOA_SPHAL       ------PADA-PIGLIPVDSLYSPVRQVAYKVDNARIGQELD----YDKLNLTVETDGTV
RPOA_ERYLH       ------PADA-PIGLIPVDSLYSPIRQVSYKVEKARVGQELD----FDKLSLTIETDGTV
RPOA_ZYMMO       ------PADA-PIGLIPVDALYSPVRQVAYKVENARVGQELD----YDKLLLTIETDGTI
RPOA_PELUB       ------PEEP-PLGLIAIDSLYSPVKKVSYSISTAREGKALD----YDKLIMEVETNGSI
RPOA_MAGMM       ------EDESYAIGDIPIDASYNPVKKVAYRVENARVGQQTD----YDKLIMDIETNGVV
RPOA_RICTY       ------EDN-LPIGEIAIDALFNPVKSVTYKVENTRVGQVTD----YDKLIIFVETNGDV
RPOA_RICBR       ------EDNNLPIGEIAIDALFNPVKSVTYKVENTRIGQVTD----YDKLIMFVETNGDI
RPOA_ANAMM       ------TSEVG-PGFIATNALYSPVKKVAFRIESSRIGQFTD----YDRLVISVETDGSI
RPOA_ANAPZ       ------ASEVG-SGFIATNALYSPVKKVALKIESSRIGQFTD----YDRLMLTVETDGSV
RPOA_EHRRW       ------LNDVP-VNFIATNALYSPIKKASFRVESSRIGQFTD----YDRLIMSVETDHSI
RPOA_WOLPM       ------MSEQDLIGFIPVNALYSPVNRVSYRVENSRVGQVTD----KDKLILSIETDGTI
RPOA_WOLTR       ------MNEQDLISFIPVNALYSPINRVSYRVENSRVGQVTD----KDKLILSVETDGTI
RPOA_RHOBA       -------SVDHEIGIIPIDAVFSPIVRVRYEVEATRVGQKTN----YDRLNLEIWTDGTI
RPOA_TREDE       -------KYIEIVGTIPMDAIYGPVLKVSYAIEPCRVGQRND----YDKLILEIWTDSTV
RPOA_TREPA       -------RYADLVGVIPVDAIFSPVLRVRYDIQSCRVGQRGD----YDQLSLEVWTDGTV
RPOA_BORBP       -------KYLEEVNVIALDSIFSPIEKVSYSVEDTRVGQRSD----YDKLVMEIWTTGVI
RPOA_BACTN       -------EYCTDVNVIPIDSIYTPIRNVKYAVENFRVEQKTD----YEKLVLEISTDGSI
RPOA_PORGI       -------AEHNELSTIAIDSIYTPIRNVKYAVENFRVEQKTD----YEKLLMEVTTDGSI
RPOA_GRAFK       -------KANAPLGTIFVDSIYTPIKNVKYSIENFRVEQKTD----YEKLVFEIISDGSI
RPOA_CYTH3       -------PAEQIFGYIPIDAIFTPIKNVKYSVENTRVEQRTD----YEKLILEILTDGSI
RPOA_PELLD       -------PDSMPIGYIAIDAIYTPIRNVKFAVENTRVGQRTD----YEKMVLDVETDGSI
RPOA_CHLPD       -------PEGMPIGFIAIDAIFTPIRNVKFTVENTRVGQRTD----YEKMILDVETDGSI
RPOA_CHLTE       -------SDGMPIGFIAIDSIYTPIKNVKLTVENTRVGQKTD----YEKMILDVETDGSI
RPOA_CHLCH       -------AEGMPLGFIPIDSIFTPIRNVKFTVENTRVGQRTD----YEKMILEVETDGSI
RPOA_SALRD       -------REDDPIGVIAIDSIFTPIKNVNYEVKPTRVGQKID----YEELLLDVETDGSL
RPOA_CAMJE       -----------DPKFIALDAFFTPVREATYDIEKVLFEDNPD----YEKVVLTVTTDGQI
RPOA_CAMFF       -----------DSEYIALDAFFTPVKKAVYEIENVLVEDNPD----YEKIVLTVTTDGQV
RPOA_HELHP       -----------SEDYIPLDAYFTPVKKAVYEIENVLVEDNPN----YEKIVFDIETDGQI
RPOA_WOLSU       -----------PEGYIPLDAYFTPVKKATYEIENVLVEDNPT----YEKIVLEIETDGLI
RPOA_HELAH       -----------PEGYMPLDGSFTPIKNVVYEIENVLVEGDPN----YEKIIFDIETDGQI
RPOA_SULDN       -----------QDGYIALDAYFTPVRSATYKIENVLVEDNPN----FERVILNIKTDGQI
RPOA_CHLMU       -----------EMNEIVLDAAFSPVVLVNYFVEDTRVGQDTD----FDRLILQVETDGRV
RPOA_CHLFF       -----------GVNEIVLDAAFSPVVLVNYFVEDTRVGQDTD----FDRLILYVETDGRV
RPOA_CHLPN       -----------GVYEIVLDAAFSPVTLVNYFVEDTRVGQDTD----FDRLVLIVETDGRV
RPOA_PARUW       -----------TSDEILVDAAFSPVRLINYFIENTRVGQDTD----FDRLIMEVTTDGRI
RPOA_AQUAE       --------AIGEVGWILVDADFSPVKKVGFRVDNVRVGKKST----YERLTLEIFTNGIK
RPOA_THEMA       --------ERPDVGWIPIDGVFSPVIKVNFLTENVRVGKRTD----YDKLILEIWTKKSI
RPOA_COREF       --------GD--IGRIPVDQIYSPVLKVSYKVEATRVEQRTD----FDKLIIDVETKNSI
RPOA_CORDI       --------AE--IGRIPVDQIYSPVLKVSYKVEATRVEQRTD----FDKLIIDVETKNSM
RPOA_CORJK       --------SE--IGRIPVDQIYSPVLKVSYKVEATRVEQRTD----FDKLILDVETKNSI
RPOA_BIFAA       --------AE--IGRIPVDSIYSPVLKVSYRVEATRVEQRTD----FDKLILDVETKPAI
RPOA_FRAAA       --------QE--IGRIPIDSIYSPVLKVTYKVEATRVEQRTD----FDRLIVDVETKPSI
RPOA2_STRAW      --------QE--IGRIPVDSIYSPVLKVTYKVEATRVEQRTD----FDKLIVDVETKQAM
RPOA_THEFY       --------QE--IGRIPIDSIYSPVMRVTYKVEATRVEQRTD----FDRLILDVWTKPAI
RPOA_ACIC1       --------HE--IGRIPIDSIYSPVLKVTYKVEATRVEQRTD----FDRLIMDVETKPSM
RPOA_ARTS2       --------SE--IGRIPVDSIYSPVLKVTFRVEATRVEQRTD----FDKLIVDVETKQAI
RPOA_NOCSJ       --------NE--IGRMPVDSIYSPVLKVTYKVEATRVEQRTD----FDKLVIDVETKPSI
RPOA_MYCLE       --------AE--IGRIPVDSIYSPVLKVTYKVDATRVEQRTD----FDKLILDVETKSSI
RPOA_MYCS2       --------AE--IGRIPVDSIYSPVLKVTYKVEATRVEQRTD----FDKLIIDVETKNSI
RPOA_RHOJR       --------AE--IGRIPVDSIYSPVLKVTYKVEATRVEQRTD----FDRLVLDVETKNSI
RPOA_SACEN       --------AE--IGRIPVDSIYSPVLKVTYKVEATRVEQRTD----FDKLILDVETKPSI
RPOA_CUTAK       --------AE--IGRIAVDSIYSPVLKVTYKVEATRVEQRTD----FDKLVVDVETKPSI
RPOA_LEIXX       --------SE--AGQIPIDSIYSPVLKVTYRVEATRAGERTD----FDRLVVDVETKPAI
RPOA_TROWT       --------MSL-AGHIPVDSIYSPVHKVTYRVEATRAGERTD----FDRLIIDVETKPSI
RPOA_RUBXD       --------DP--IGVIAVDSLFSPVEKVQYRVSETRAGARVD----LDALTLEVFTDGRL
RPOA_GEOTN       --------EDQPIGVIPIDSIYTPVSRVSYQVENTRVGQVTD----YDKLTIDVWTDGSI
RPOA_BACHD       --------DELAIGVIPIDSIYTPVSRVNYQVENTRVGQVTN----YDKLTLDVWTDGSI
RPOA_OCEIH       --------DDQPIGVIPIDSIFTPVSRVTYQVENTRVGQVAN----YDKLTMDVSTDGSI
RPOA_LISW6       --------ENMPIGVLPVDSIFSPVIRVNYQVENTRVGQSTN----YDKLTFDVLTDGSI
RPOA_STAS1       --------SDLPIGVIPVDSLYSPVERVNYTVENTRVGQSSD----FDKLTLDVWTNGSI
RPOA_LACPL       --------DDMPIGVLAVDSLYSPIERVNYQVENTRVGQRDD----FDKLTLDVWTNGSI
RPOA_LACBA       --------TDMPIGVLAVDSIYTPIERVNYQVENARVGQRAD----YDKLTLDVWTNGSI
RPOA_LACS1       --------DDMPIGVLPIDSIYTPIERVNYQVEKTRVGQKND----YDKLTLDVWTNGSI
RPOA_LACP3       --------DDMPIGVLPIDSIFTPISRVNYQVESTRVGRRND----FDKLTLDVWTNGSI
RPOA_PEDPA       --------VDMPIGVLPIDSIYTPIERVNYQVENTRVGQRDD----YDKLTLDIWTDGSI
RPOA_ENTFA       --------EDMPIGVLPVDSIYTPVLRVNYQVENTRVGRRDD----FDKLTMEIWTDGSI
RPOA_CLONN       --------EDLPIGTIPVDSIYTPVKRVNFTVENTRVGQITD----YDKLSIEVWTNGTI
RPOA_CLOAB       --------DDMPIGTIAVDSIYSPIKRVNFTVENTRVAQITD----YDKLTIEVWGNGTI
RPOA_CLOTE       --------EGMPIGTIPIDSIYTPVKRVNFTVANTRVGQITD----YDKLTLEIWTNGTI
RPOA_CLOPS       --------EDLPLSAIAIDSIYTPVKRVNFSVQNTRVGQITD----YDKLTLEIWTNGTI
RPOA_CLOD6       --------ENVPIGVLPVDSIYTPVEKVSYHVENTRVGQKTD----YDKLVLEVWTNGSI
RPOA_CARHZ       --------GEHVIGVIPVDSIFSPVLKVNFQVENTRVGQITD----YDKLTLEVWTDGSI
RPOA_MOOTA       --------EDQPIGIIPVDSLFSPIHKVNYTVENTRVGQITD----YDKLTLEVWTDGSI
RPOA_DESHY       --------PDQAIGIIPIDSIFAPIYKVNYTVEDTRVGMVTD----YDKLTLEVWSNGSI
RPOA_HUNT2       --------PGQPIGVIPVDSIFTPVHKVNYTVENTRVGQVTD----YDKLTLEVWTNGSI
RPOA_SYMTH       --------PDMPIGVIPVDSIFSPIRRVNYTIEHTRVGNKTN----YDKLTLEVWTNGAI
RPOA_CALS4       --------PNQPIGVIPVDSIFTPIRKVNYTVENTRVGHVTD----YDKLTLEVWTNGTI
RPOA_SYNWW       --------NDDIVGLIPIDSIFTPVSRVNYTVENARVGKRTD----YDRLNLEVWTNGSI
RPOA_LACGA       --------DDMPIGVIPVDSLFSPIKKVNYQVESARVGKRDD----YDKLTLEIWTDGSI
RPOA_LACAC       --------DDMPIGVIPVDSLFSPIKKVNYQVESTRVGKRDD----FDKLTFEIWTDGSI
RPOA_LACDB       --------AEMSIGDIPVDSLFSPIEKVNYQVESTRVGKRED----FDKLTMEIWTNGSI
RPOA_STRSV       --------DDAPVGTLAVDSIYTPVTKVNYQVEPARVGSNDG----FDKLTLEILTNGTI
RPOA_STRS2       --------DDAPVGTLAVDSIYTPVKKVNYQVEPARVGSNDG----FDKLTLEINTNGTI
RPOA_LACLS       --------DGAPIGTIAVDSIYTPVSKVNYQVEPARVGGDSS----YDKLTLEITTNGTI
RPOA_LEUMM       --------DEMPIGVLAVDSIYTPIERVNYQVENTRIGARDD----YDKLTFDIWTNGSI
RPOA_OENOB       --------MELGIGVLAIDSIYTPISKVNYTVEKTRVGHRDD----YDKLTLEVWTDGSV
RPOA_DEIGD       ---------KDRINSIPVDAVFSPVRRVAYHVENTRVGQQTD----LDRLILRIWTDGSV
RPOA_DEIRA       ---------KDRINSIPVDAMFSPVRRVAYHVENTRVGQQTD----LDRLILRVWTDGSA
RPOA_THET8       ---------KDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTD----LDKLTLRIWTDGSV
RPOA_FUSNN       --------KDWPVDYIAVDAIYTPIRKVSYEIQDTMFGRMTD----FDKLTLNVETDGSI
RPOA_MYCMS       ---------NIEPGMITIDSNYSPIIKVAYSVDSAKIGRAID----LEKLELEVTTDGSI
RPOA_MESFL       ---------DVVPGMITIDSNYSPIIKVAYGSTPINLGKAQD----FEKLILEVETDGSI
RPOA_MYCGE       ---------INSLGIIATDANFSPVLHCGYEVQEVKTSKQKL----TDHLTFKIATNGAI
RPOA_MYCPN       ---------INSLGIIATDSNFSPVLHCGYEVQELKTSKQKI----TDHLTFKIATNGAI
RPOA_MYCGA       ---------IGSLSIIPIDSNFNPIIKVGYHVEEETS--DVI----TDKLIIEVGTNGLI
RPOA_MYCPE       ---------INAINVIAVDSNFSPVLKVGYKVSDIKTTKNEI----NDVLELEVATNGAV
RPOA_UREPA       ---------VSTLHIIATDSNYSPVLHYAYNVEMIKDSKSSM----SEILTIDIATNGTI
RPOA_MYCMO       T------SSISNGQYIAVDSNFSPIEKVSFSSSELNTSSVIV----QEKLEMEIVTKGTI
RPOA_MYCPU       N------STIKRGKFLAIDSDFSPVEKVKVKVQEINSSSLNI----EEELEIEIKTKGTI
RPOA_MYCH7       E------SQIE-GSVLAVDSDFSPVLNANYQAVEINSASPII----EEKLNFSIKTDGSI
RPOA_MYCS5       KE----LSSLSKGAFIAMDSVFSPVVNVAWKVTELNTASLKI----EEQLELELETKLGV
RPOA_AYWBP       ---------ENQVGVIAIDSLFTPVVNVSYQVEKKLGN--------KDELTIEITTNGAL
RPOA_DEHMC       ---------NTPIGTIPVDAIFTPIRKVNFTTEPMHVGRETS----LERLVLEVWTDGTV
RPOA_OSTTA       FEQFDSTQTNSKSVTFPIDAIFMPIRQVNFTVQEHSV----D----GEYIYFEVWTNGSI
RPOA_SINAL       -------FEDR-SYPI--DAVFMPVQNANHSIHSYGNGNE-----KQEILFIEIWTNGSL
RPOA_AETGR       -------FEDG-SYPI--DALFMPVQNANHSIHSYGTGNE-----NQEILFLEIWTNGNL
RPOA_LIRTU       -------YQDG-SYPI--DAVSMPVRNANHSIHSYGNRNE-----KQEILFLEIWTNGSL
RPOA_DRIGR       -------DQDG-SYPIPIEAVSMPVRNANHSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_ACOCL       -------SQDG-SYPI--DAVSMPVRNANHSIHSYGNGNQ-----KQEILFLEIWTNGSL
RPOA_VITVI       -------FQDG-SYPI--DAVFMPVRNANHSIHSYGNGNE-----RQEILFLEIWTNGSL
RPOA_PLAOC       -------SQDG-SYPI--DAVFMPVRNANHSIHSYANGNE-----KQEILFLEIWTNGSL
RPOA_NANDO       -------AQNG-SYPI--DAVFMPVRNANHSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_RANMC       -------AQKG-SYPI--DAVFMPVRNANHSIHSYGNGNE-----NQEILFLEIWTNGSL
RPOA_NICTO       -------FQDG-SYPI--DAVFMPVRNANHSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_PANGI       -------FQDG-SYPI--DAVFMPVRNANHSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_COFAR       -------FQDG-SYPI--DAVFMPIRNANYSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_LACSA       -------FQDG-SYPI--DPVFMPVRNANHSIHSYENGN-------KEILFLEIWTNGSL
RPOA_SPIOL       -------FQDG-SFPI--DALFMPVRNVNHSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_EUCGG       -------FQDG-SYPI--DAVFMPVRNANHSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_OENEH       -------FQDG-SYPI--DAVFMPVRNANHSIHSYGNQNE-----KQEILFLEIWTNGSL
RPOA_CITSI       -------FQDGNCYPI--DAVFMPVRNANHSIQSYGNGNE-----KQEILFLEIWTNGSL
RPOA_GOSBA       -------FHDG-SYPI--DAVFMPVRNANHSIHCYGNDNE-----KQEILFLEIWTNGSL
RPOA_POPTR       -------FQDG-SYSI--DAVFMPVRNANHSVHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_CUCSA       -------FQDA-SYPM--DAIFMPVRNVNHSIHSYVNGNE-----KQEILFLEIWTNGSL
RPOA_MORIN       -------FQNG-SYPI--DAVFMPVRNANHSIHSYVNGNE-----NQEILFLEIWTNGSL
RPOA_JASNU       -------SQDG-SYPI--DAVFMPVRNANHSIHSYGSGNE-----KHEILFLEIWTNGSL
RPOA_PHAVU       -------FQDG-SYDI--DARFMPVRNVNYSIHSYVNGNE-----KQEILFLEIWTNGSL
RPOA_LOTJA       -------FQDG-SYNI--DAIFMPVRNANHSIHSYVNGNE-----KQEILFLEIWTNGSL
RPOA_PIPCE       -------DEDG-SYPI--DAIFMPVRNANHSVHSYGNGNE-----KQEILFIEIWTNGSL
RPOA_AMBTC       --------QDA-SYPI--DAVSMPVRNANYSIQCYGNENE-----KQEILFLEIWTNGSL
RPOA_NYMAL       -------YQDG-SYPI--DAVSMPVRNANHSIHSYGNGNE-----KQEILFLEIWTNGSL
RPOA_ORYSJ       -------TQDG-SYPI--DAVSMPVRNVNYSIFACGNGNA-----KYEILFLEIWTNGSL
RPOA_PHAAO       -------SHDG-SYPI--DIVSMPVRNANHSIHSYGNGNE-----KQEILFIEIWTNGSL
RPOA_PINTH       -------YQDG-IFPI--DAVFMPVRDANYSIHSYGSGNE-----IREVLFLEIWTNGGL
RPOA_PSINU       -------SQSG-EFFI--DALFTPIRNANYSIHSFESNNK-----VREILFLEVWTNGSL
RPOA_ANGEV       -------SQAG-EFFI--DAVFMPIRKANYSVHSFGNNKK-----FQEILFIEIWTDGSL
RPOA_MARPO       -------YQEG-LFPV--DAVFMPIRNANYSVHSFESEKK-----IKEILFLEIWTDGSL
RPOA_ANTAG       -------YEDG-NFAV--NAAFTPIRNANYSVHSFENEKE-----KQEILFIEVWTNGSL
RPOA_HUPLU       -------YKDG-NFTV--DAVFTPIRSVNYSIHCFESHDKSI---MKEMLLYEIWSNGSI
RPOA_ADICA       -------SGKG-QFPI--DAVFMPVRNVNYSIHLFGSGRA-----TQEILFIEIWTNGSL
RPOA_CHAGL       -------IKQG-FFLV--DPVFIPIRSVNYSIHSFEDEKA-----TKEFLIVEVWTNGSI
RPOA_CHAVU       -------SKDS--FSI--DAIFMPIRNVNYSIHPVEKAGDW----KSELLILEIWTNGSI
RPOA_STAPU       -------NHQGFFI----DANFTPVQKANFSIHSVGDPKG-----LQQLLLLEIWTNKTL
RPOA_ZYGCR       -------TKGRFIL----DAALKPVRNMNYSIHSLGEGDM-----RQEMLVLEVWTNGSL
RPOA_MESVI       -------KKNSYISSLPVDAIFMPIHKVNYMVEQDHTSKF-----LTERVILEIWTNGSI
RPOA_CHLAT       -------KKTFQVDVLPIDAVFMPVTKVNYTVEENYGGDR-----SQERVIIEVWTNGSI
RPOA_PYRYE       -------VDELSVDFLQVDSVFMPVNKVNYKVEEVRIGSNS----IKDRLIIQIWTNGSI
RPOA_GRATL       -------FDKKSIDFLQIDAVFMPVTKFNYTVEEKKISPIL----IQEKLFLEVWTNGSL
RPOA_GUITH       -------NSTEHFEFLQVDSVFMPVKKVNFRIEETRGENNI----LNEQLILDIWTNGSI
RPOA_CYAPA       -------QTENSIDFLPIDAIFMPVRKVNYMVEEIFLRNSE----IKERLILEIWRNGSV
RPOA_CYACA       -------SKKSPLDFLPIDSIFMPVKKVNYYVEEI-LDSKV----AYEKLILELWTNGSL
RPOA_CYAM1       --------PSEMIDWLPIDGVFMPVKRVNFWVDKALVDKVL----VDKALHLEIWTNGSI
RPOA_TRICV       -------FCKKSQDYLQIDAIFMPVQKVDFKIENIYDNSND----LTERLFLDIWTNGSM
RPOA_THAPS       -------FSDKFEDFIETDAIFMPVQKVDFKVENVYDNSNN----IKERLLIDIWTNGSI
RPOA_PHATC       -------FVEEDENYLQLDTIFMPVQKVDFKIENIYDATNN----ISERLFLDIWTNGSI
RPOA_TRIV2       -------EEATSLDFLQIDSIFMPVRKVNYSVEEVRADGSIP----KDRLLLEVWTNGSI
RPOA_TRIEI       -------DDVATLDFLQIDAIFMPVRKVNYTIEDAHIGSSLE----QDRLIMDIWTNGSY
RPOA_SYNY3       -------DENSSLDFLQIDSVFMPVTKVNYTVEDIRADGMSP----KDRLILDIWTNGSI
RPOA_SYNE7       -------DETTALDFLQLDAVFMPVRRVNYSVEDARVGESTA----IDRLVLEVWTNGSL
RPOA_SYNJA       -------SKSMAIDFLQIDSVFMPVRKVNYTVEAARVGQSLE----KDRLILEIWTNGSL
RPOA_GLOVI       -------EDGAAIDYLSIDAIFMPVRKVNWTVESERSAANVE----QDRLTLEIWTSGSL
RPOA_THEEB       -------DDRLALDYLQLDAVFMPVRRVNYTVDSVRSAGAEGDRQLQDYLKLEIWTNGSL
RPOA_SYNS3       -------EDTSAIDLLQIDAVFMPVHRVNFTTDETAVAEGGSA---RERLRMEVVTDGSM
RPOA_SYNPX       -------EDTSAIDLLQIDAVFMPVIRVNFTIDETAVAEGGSA---RERLRMEIVTDGSI
RPOA_PROMA       -------EATTAIDLLQIDAVFMPVKKVNFTIDETAVSEGGST---RERLRMEIVTDGSI
RPOA_PROM5       -------QETTSVDLLQIDAVFMPVKRVNFSIDETAVAEGGTG---RERLTMEVVTDGST
RPOA_PROM1       -------EETSAIDLLQIDAVFMPINRVNFTIDETAVAEGGST---RERLKMELVTDGST
RPOA_EMIHU       --------SNNPRGFLAVDAVFTPIKKVNFFVETSSSKERLE----KERLIIEIETNGSI
                                   :    *:                      . :   :      

RPOA_BUCAI       DPEEAIRRAATILAEQLEAFVDLRD-IREPE-----------------FKEEKPE-----
RPOA_BUCAP       DPEEAIRRAATILSEQLEAFVDLRD-VKEPE-----------------IKEEKPE-----
RPOA_ECOLI       DPEEAIRRAATILAEQLEAFVDLRD-VRQPE-----------------VKEEKPE-----
RPOA_BAUCH       DPEEAIRRAATILAEQLEAFVDLRD-ISQPE-----------------VKEEKPE-----
RPOA_WIGBR       DPESAIRRAATILSEQLEAFIDLRD-IRKPE-----------------IKEEKPE-----
RPOA_BUCBP       DPEEAIRRAATILSNQLESFVYLRD-IREPE-----------------IKEEKPE-----
RPOA_BLOFL       DPEEAIRRAATILSDQLSSFIDLKD-VHQPE-----------------VKEEKPE-----
RPOA_BLOPB       EPEEAIRRAATILSEQLEAFIDLRD-IHQPE-----------------HKEEKPE-----
RPOA_BUCCC       DPEDAIRKAATILAQQLEAFVDLRG-VREPE-----------------IKEEKPE-----
RPOA_COLP3       DPEEAIRRASTILAEQLDAFVELRD-IKEVE-----------------QVEEKPL-----
RPOA_PSEA6       DPEEAIRRSATILAEQLDAFVELRD-MSEPV-----------------EKEEKPE-----
RPOA_SHEAM       DPEEAIRRSATILAEQLDAFVELRD-VSVPE-----------------QKEEKPE-----
RPOA_AERS4       DPEEAIRRSATILAEQLEAFVDLRD-VSVPE-----------------KKEEKPE-----
RPOA_PSEHT       DPEEAIRRASTILAEQLDAFVDLRD-VTEPE-----------------EKEEKPE-----
RPOA_IDILO       DPEEAIRRAATILAEQLDAFVELRD-ISEPE-----------------EKEEKPE-----
RPOA1_PSYIN      EPEEAIRQAAMILAGQLDEFVDERI-ISAPV-----------------EVEEKPE-----
RPOA2_PSYIN      DPEEAIRRAATILAEQLDAFVDLRK-VSEPV-----------------AKEEKPE-----
RPOA_ACIBT       DPEEAIRKAATILQQQIAIFVDLQK-DQTPV-----------------AQEPREE-----
RPOA_PSYCK       DPEEAIRKAATILQQQISIFVDLEA-EEAPE-----------------PVKEKEE-----
RPOA_HAHCH       DPEEAIRRAATILQQQLAVFVDFDQ-QNEPE-----------------KVEEQEE-----
RPOA_MARHV       DPEEAIRRAATILQQQLAVFVDFDH-EKEPE-----------------RVEEEEE-----
RPOA_PSEE4       DPEEAIRRAATILQQQLAAFVDLKG-DSEPV-----------------VVEQEDE-----
RPOA_SACD2       DPEEAIRRAATILQQQLAVFVDLEG-EKEAE-----------------PEQKEDQ-----
RPOA_CHRSD       DPEEAIRRSATILQEQLAAFVDLEA-DKEQE-----------------VEEEEDQ-----
RPOA_ALCBS       EPEEAIRRAATILQQQIAVFVDLEQ-DAKPE-----------------PKQEREE-----
RPOA_NITOC       APDEAVRKAATILQDQLTAFVELEG-KIETA-----------------KEKKAAE-----
RPOA_XANOM       DAEEAVRTAADILSDQLSVFGDFTH-RDRGA-----------------AKPAASG-----
RPOA_XYLFT       DAEEALRTAADILTDQLSVFGDFTH-RDRGT-----------------VKPASSG-----
RPOA_ALKEH       EPEEAVRFAAGLLRDQLSVFVDLEGGEFEAE-----------------QEEQEPD-----
RPOA_HALHL       TPEEAVKFAASLLRDQLSVFVDLEGGLLEGG-----------------DEQEEPE-----
RPOA_AZOSB       DPEEAIRYAARVLMDQLSVFADLEGTPVAVV------------------PEKTPS-----
RPOA_NITMU       DPEEAIRYAAKVLVEQLSVFADLKGTPLPVE------------------QPKLPQ-----
RPOA_DECAR       EPEEAIRYAARVLMEQLSVFADLEGTAPVAE------------------ASKPAQ-----
RPOA_POLNA       TAEDAVRASAKILVEQLAVFAQLEGNELGAIIN-----------D--PAPRSSQQ-----
RPOA_RHOFT       SAEDAVRASAKILVEQLAVFAQLEGSELAAF-D-----------T--PSPRGSTQ-----
RPOA_METPP       TPEEAIRASAKILVEQLAVFAQLEG-QINDIFD-----------A--QPAQRSTQ-----
RPOA_RALSO       SPEEAIRQSARILVDQLSVFAALEGTESAAE----------------AAAARAPQ-----
RPOA_BORA1       SPEEAVRQSARILMDQISVFAALEGAGDSYE----------------APVRGTPQ-----
RPOA_NEIG1       DPEEAVRSAARILIDQMSIFADLQGTPVEEV------------------EEKSPP-----
RPOA_CHRVO       EPEQAVRNAARILMDQLSIFADLQGTAVEEV------------------VEKAPP-----
RPOA_THIDA       EPEEAVRTAARILVSQLSVFADLEGTPAESE------------------SPRSPQ-----
RPOA_METFK       EPEQAIRDAARILMGQLSVFADLEGAPSEVE------------------VKQAPQ-----
RPOA_NITEC       DPEEAIRYAARVLVEQFSFFADLESTLLPTE------------------QPRAPA-----
RPOA_METCA       QPEEAVKHAANILNQHLAILVDLKGEDLPLFG------------------EDGPQ-----
RPOA_LEGPA       DAEEAIRISASILQRQLHAFVDMKFEESRAD------------------NKERND-----
RPOA_COXBU       DPEEAIRFAAAVLQHQLAAFVDLKQESDRDG------------------GGKEGK-----
RPOA_HYDCU       DPEDAIKQAATVLHYQLIAFVDLKHKEIVVQ------------------EEEENE-----
RPOA_DICNV       DPEQAIRDAATILHNQIKVFVDLESTEEETE------------------EEEEIY-----
RPOA_VESOH       NAEVAIKRVATILQEQLSSFVELELVEEEVS------------------LPTSED-----
RPOA2_FRAT1      NCEEALRLAATKIQNQLRNILDIEEINKGIF-----------------VEDPTKD-----
RPOA1_FRATN      EPLAAVTKALEYFCEQISVFVSLRVPSNGKT----------------GDVLIDSN-----
RPOA_NEOSM       DPKTAVLEASKILSTQARCFLNIADPEHRVHGV-----------PCGVSTSDRND-----
RPOA_KORVE       NPADALGLAAKLLKDHMNIFINFEEEIE---------------ASHAE-DRKPEI-----
RPOA_SOLUE       SPQDSIGYAAKLLKDHMTIFINFEEVPE---------------QTEEISERGMDK-----
RPOA_LEPBL       SPDDAVAQAAKILKEHLTVFINFEEELE---------------EEDDELDEADEK-----
RPOA_ANADE       APADAVAFAAKIVKEQLSIFINFD-----------E---AEEPAEEIKPVEEQ-K-----
RPOA_MYXXD       SPQDAVAYAAKIIKEQLTVFVNFD-----------E---TEEPVVAEAPKEEA-K-----
RPOA_GEOMG       VPEDAVAFAAKILKEQLSIFINFD-----------E---EAEPAEEAETEEERER-----
RPOA_GEOSL       IPEDAVAFAAKILKEQLSIFINFD-----------E---EAEPSGEAEVGEGESP-----
RPOA_PELPD       KPDDALAYSAKIMKEQLSIFINFD-----------E---EAEPQAPEESQDEIDK-----
RPOA_PELCD       RPDDGVAYAAKILKEQLQIFINFD-----------E---ETETVVEEESEESR-K-----
RPOA_SYNFM       KPDDALAYSAKILKDQLTIFINFE-----------E---EMETTEEEVRAEPV-------
RPOA_BDEBA       KPEEAVALSSKIMKEQLQIFLTFD-----------E---TMEPAEEARELGSP-T-----
RPOA_SYNAS       LPEDAVAFAAKILKKQLQVFVGLHTVIGT------E---EVEEEEEGEAVSEKEN-----
RPOA_DESPS       RPEDALAYSAKILKEQLDIFINFD-----------E---TAVEPEKKAVETEEKQ-----
RPOA_DESVV       SPEDAIAYSAKIIKDQISVFINFD---------------ERISGENSNGSADSGE-----
RPOA_DESAG       SPEDAIAYSAKIIKDQISVFINFD---------------ERISEQENEGRSSASD-----
RPOA_LAWIP       SPEDAIAYSAKIIKDQISVFINFD---------------ERISGSGGNEGSGSSD-----
RPOA_RHILO       SGEDAVAFAARILQDQLGLFVNFDEP-Q---------------KEVAAEAVTELA-----
RPOA_BRUME       TGEDAVAYAARILQDQLSIFVNFEEP-Q---------------KEAPQEQVAELA-----
RPOA_BARQU       NGEDAVAFAARILQDQLSLFVNFEEP-Q---------------KEIVDESDSELT-----
RPOA_BARBK       NGKDAVAFAARILQDQLSVFVNFKEP-Q---------------KELVEEQTSELS-----
RPOA_NITWN       TPEDAVAFAARILQDQLNVFVNFEEP-R---------------KEVTTEIIPDLA-----
RPOA_CAUVC       TPVDAVAYAARILQDQLQIFITFEEP-K---------------AKSADESKPELP-----
RPOA_MARMM       TPEDSVAFAARILQDQFQIFINFEEAVE---------------ARPAEDDKPELD-----
RPOA_MAGSA       TPDDAVALAARILQDQLQLFINFEEP-T---------------AVVEEEKKDELP-----
RPOA_RHORT       GPEDAVALAARILQDQLQLFINFEEP-Q---------------AVSEEKKDDELP-----
RPOA_GRABC       TPEDSVALAARILQDQLQLFINFEEP-Q---------------QVRHDEPQDDLP-----
RPOA_ROSDO       TPDDAVAFAARILQDQLGIFVNFEEPES---------------ASR-ADEDDGLE-----
RPOA_JANSC       SPDDAVAYAARIIQDQLSIFVNFDEPES---------------ATR-QDDEDDLE-----
RPOA_PARDP       TPEDAVAYAARIIQDQLSVFVNFDEPET---------------ATR-SDAEDGLE-----
RPOA_HYPNA       SPEDSVAYAARILQDQLQLFINFEEPTL---------------ETGGAADETDLG-----
RPOA_NOVAD       TPEDAVAYAARILQDQLALFVHFDDQVP--VGHVPM---VAGVPAHAPEESDANQ-----
RPOA_SPHAL       TPEDAVAYAARILQDQLQVFVHFEEAMSD-SGLIGM---AA--PSAASDESDVNQ-----
RPOA_ERYLH       TPEDAVAYAARILQDQLTLFVHFEDGIP--QPQSAM---IG--VAAEPQQDDANQ-----
RPOA_ZYMMO       SPEDAIAYSARILQDQLQLFVHFDDGLAPPTSAIGQ---SSLPSSSSEAENSANQ-----
RPOA_PELUB       SAEDAVAYSARIFQDQLNMFVNFDEPVE----------------VPVKEVSSEPE-----
RPOA_MAGMM       TPEDALALAAKILQDQLNPFINFDDVPT----------------AHDHEMEDRPQ-----
RPOA_RICTY       LPEMAVGLAARILQEQLQLFIAFEEQEE-------------DKQVKT----DSLP-----
RPOA_RICBR       LPEMAVGLAARILQEQLQLFISFEEQEE-------------DKQVKT----DALP-----
RPOA_ANAMM       SPDEAVAVSARVLQDQLQSFIGSEEVEG-------------ESRKKVDKEEGALP-----
RPOA_ANAPZ       APDDAVAVAAKILQDQLQSFISFDEVE--------------ETRKSVDKEEGVLP-----
RPOA_EHRRW       LPDEAVALAARILQDQFQQFINFDETD--------------EPHQKVDTKD-VLP-----
RPOA_WOLPM       SPSQAVDSAARILQEQLQPFISSDVSYK-------------KSQVSSSSGAKDLG-----
RPOA_WOLTR       SPSQAVDSAARILQEQLQPFISSDISYK-------------KSQVSSPSGYKDLG-----
RPOA_RHOBA       NPEMALTEAAKILRKHLNPFVQYRELGP-----------SIFSAARGGAGSPEAQ-----
RPOA_TREDE       RPEDVLGEAAKIAKDHFSIFINFNENDY---------------LGEDEDDNEEAV-----
RPOA_TREPA       RPEDAIAEAAKIIKEHFTVFVNFDETAL---------------DLEDEPEEDDPA-----
RPOA_BORBP       SAKDAIKKAASIIREFLFPLIDFEDNIN---------------TSFEKSKSES-------
RPOA_BACTN       HPKEALKEAAKILIYHFMLFSDEKITLESN-----------DTDGNEEFDEEVLH-----
RPOA_PORGI       RPVDALREAAQILISHFSLFAENKIAIEYV-----------DIVDTDEFDEDSLH-----
RPOA_GRAFK       HPKDALTEAAKTLIHHFMLFSDERITLEAD-----------EIAQTETYDEESLH-----
RPOA_CYTH3       HPEDALKGAANILIKHFMLFSDQTMTFEAV-----------KAEEEETVDEEFLH-----
RPOA_PELLD       TPDDSISLAGRIINEHVTFFANFSPTEEEF-----------TEEEYKQQDDEFET-----
RPOA_CHLPD       APDDSISLAGKIINDHIMYFANFSPTEEEF-----------TEEEFKQQDDEFES-----
RPOA_CHLTE       TPDDAISLAGKIINDHITFFANFSPTEEEF-----------SEEEYKQLDDEFES-----
RPOA_CHLCH       TPDDSISLAGRVISDHVLLFADFSPAEEEY-----------TEEEFKQQDDEFET-----
RPOA_SALRD       TPEEAITQGASILRDHVSFFIQLEEEPEP-------------VVEEQEVDEEVKR-----
RPOA_CAMJE       TPNEAFQNALEAMYKQLSVFDKITNVRSVIK------------NQATSNELE--------
RPOA_CAMFF       SPIEAFKHSIEAMYKQMSIFNNVLNIDVNMA------------LTSSQNSNE--------
RPOA_HELHP       EPITAFKEAIAIMHKQMSIFGVDLSTASSGT------------RNISEDSGE--------
RPOA_WOLSU       EPIAAFKDALGVMQKQMSVFNSEWSVSSAES------------TSSDEEDPE--------
RPOA_HELAH       DPYKAFLSAVKVMSKQLGVFG-EKPIANTEY------------SGDYAQRDD--------
RPOA_SULDN       TPLDAFRNSLEVMYAQLAVFNSEISVKAPAT------------IERAEESPD--------
RPOA_CHLMU       APKEAVAFATQILSKHFSVFEKMDEKRIVFE------------EAISVEKENKDD-----
RPOA_CHLFF       SPKEALAFSTQILTKHFSIFEKMDEKKIVFE------------EAISIEKENKDD-----
RPOA_CHLPN       TPKEALAFSTQILTKHFSIFENMDEKKIVFE------------EAISIEKENKDD-----
RPOA_PARUW       TPAEALSFAVQIGLKHFEVFNQFNNYALSFD------------EKDGDRNGDQDE-----
RPOA_AQUAE       TPDQCMQEAIEILKKHYELL-----------ENIFT---EKPTVPQKVAVDELAE-----
RPOA_THEMA       RPEEALRKAADILINHFKIVTEGLPELKISEEYIITSEEEEAEVPASEHEEEHRE-----
RPOA_COREF       SARDALASAGKTLVELFGLARELNVAA---------------EGIEIGPSPQETE-----
RPOA_CORDI       APRDALASAGKTLVELFGLARELNTAA---------------EGIEIGPSPQETE-----
RPOA_CORJK       TARDAMASAGKTLVELFGLAQELNHEA---------------EGIEIGPSPQESE-----
RPOA_BIFAA       SPRDAVASAGSTLVELFGLCRELNTQA---------------EGVEVGPAPVAEE-----
RPOA_FRAAA       SPRDAMASAGKTLVGLFGLAQELNAEA---------------EGVDIGPSAADAA-----
RPOA2_STRAW      RPRDAMASAGKTLVELFGLARELNIDA---------------EGIDMGPSPVDAA-----
RPOA_THEFY       RPRDAVASAGKTLVELFGLARELNVDA---------------EGIDMGPSPTDAA-----
RPOA_ACIC1       RPRDAMASAGKTLVELFGLVRELNVDA---------------EGIDIGPSPSDAA-----
RPOA_ARTS2       APRDAVASAGTTLVELFGLARELNTAA---------------EGIEIGPSPTDAA-----
RPOA_NOCSJ       RPRDAIASAGKTLVELFGLARELNVEA---------------EGIDIGPSPVDEQ-----
RPOA_MYCLE       TPRDALASAGKTLVELFGLARELNVEA---------------EGIEIGPSPAEAD-----
RPOA_MYCS2       SPRDALASAGGTLVELFGLARELNADS---------------EHIEIGPSPAEAD-----
RPOA_RHOJR       TARDALASAGKTLVELFGLARELNVEA---------------EGIEIGPSPAEAD-----
RPOA_SACEN       TPRDAVASAGRTLVELFGLARELNVDA---------------EGIEIGPSPAEAD-----
RPOA_CUTAK       LPRDAIASAGKTLVELFGLTRELNVEA---------------EGIEIGSGPVDEE-----
RPOA_LEIXX       SPRDAIASAGRTLVELFGLARELNSAA---------------EGIEIGPAPVDQV-----
RPOA_TROWT       LPRDAVASAGKTLCELFGLARELNSQA---------------EGVEFGVDSMIPE-----
RPOA_RUBXD       GPREALREASRKLIDFFGLFAEGYQGA---------------GAAEE-PGRSGGR-----
RPOA_GEOTN       GPKEAISLGAKILTEHLNIFVGLTDEA---------------QNAEIMVEKEDDQ-----
RPOA_BACHD       RPEEAVSLGAKILTEHLNIFVGLTDQA---------------QNAEIMVEKEEDQ-----
RPOA_OCEIH       RPEEAVSLGAKIITEHLNIFVGLTDEA---------------QNAEIMVEKEEDQ-----
RPOA_LISW6       SPEEAVSLGAKILSEHLSIFVNLTDEA---------------QKAEIMIEKEESH-----
RPOA_STAS1       TPQESVSLAAKILTEHLNIFVGLTDEA---------------QNAEIMIEKEEDQ-----
RPOA_LACPL       TPSEAISLSAKILTDHLSIFVNLTDEA---------------KNTDVMVEKEETH-----
RPOA_LACBA       NPSEAIALAAKILTEHLAMFVDLTDEA---------------KNAEIMVEKEETH-----
RPOA_LACS1       TPSEAISLSAKILTEHLALFVDLTDEA---------------KNAEIMVEKEETH-----
RPOA_LACP3       SPREAISLAAKILTEHLDIFVNLTDEA---------------KNAEIMVEKEETH-----
RPOA_PEDPA       TPSEATSLSAKILTEHLAIFVNLNDQA---------------KETEIMVEKEETH-----
RPOA_ENTFA       IPQEALSLAAKIMTEHLDIFVNLTDEA---------------KNAEIMVEKEETQ-----
RPOA_CLONN       QPEEAISLSAKILIEHFKLFMTLTDHA---------------DNVEIMVEKEEDK-----
RPOA_CLOAB       RPEEAISLAAKILIEHFKLFMTLTDHA---------------DDVEIMVEKEEDK-----
RPOA_CLOTE       MPDDAISLSAKILIEHFKLFMTLTDHA---------------DDVEIMVEKEEDK-----
RPOA_CLOPS       RIEEAISLSAKILIEHFKLFMTLTDNA---------------NDVEIMIEKEEDK-----
RPOA_CLOD6       NPQEGISLAAKVLVEHLNLFIDLTEHV---------------SSVEIMVEKEEDQ-----
RPOA_CARHZ       RPDEAVSLAARIMVEHLQLFVNLNERA---------------TGVEIMVEKEEDA-----
RPOA_MOOTA       APDEAVSSAAKILIEHMRLFLGLTERV---------------SDEVTMVEKEEET-----
RPOA_DESHY       TPEEATSLAAKILSEHLRLFIGLTDKL---------------NNVEIMVEKEEEA-----
RPOA_HUNT2       KPDEAISLGAKILSEHLNLFIDLSDNA---------------KNAEIMVEKEETK-----
RPOA_SYMTH       RPDEACSWAAKILKEHLELFISLTEDA---------------DEIEVMQEKEDDE-----
RPOA_CALS4       TPKEAVSMAADMLIKYFQKFISFTGEY---------------KSPDVFVEKQEKK-----
RPOA_SYNWW       SPEEAISLSAQILIEYLKLFTEIDDTY---------------AEVEILVEKEEEK-----
RPOA_LACGA       TPNDALSFAAKILVEHFKVFMSTDMDA---------------QFDDVMVEKEDDK-----
RPOA_LACAC       KPNDALSFAAKILVEHFKVFESADANT---------------KFSEVMVEKEDDK-----
RPOA_LACDB       APNDALNFAARVLVEHFKAFESADAAA---------------EIGEVMVEQENDQ-----
RPOA_STRSV       IPEDALGLSARILTEHLNLFTNLTEVA---------------IAADVMKEAEKTS-----
RPOA_STRS2       IPEDALGLSARILMEHLGLFTDLTEVA---------------KSAEVMKEAEVAS-----
RPOA_LACLS       VSDEALSLSAKILTDHLNLFVDLSEVA---------------AEAETLVVKDEVK-----
RPOA_LEUMM       KPSDALSLGAKILAEHLGLFMDISPVA---------------AEASVMVEAEPVA-----
RPOA_OENOB       SPSESLSLGSKILSEHLALFIDLSNAG---------------KKE-MMLDPDAVE-----
RPOA_DEIGD       GPQEALDRAVEILRDELTVFGNVETVSA-----------AAPELPSVYTPAAPIV--SGY
RPOA_DEIRA       GPQEALDKAVEILRDELSVFGNVEPMPALESSY------AAATPAAVYDPATATLPASVY
RPOA_THET8       TPLEALNQAVEILREHLTYFSN-------------------PQAAAVAAPEEAKE-----
RPOA_FUSNN       EIRDALSYAVELLKLHLDPFLEIGNKME-----------NLRDDIEEMIEEPMDI-----
RPOA_MYCMS       TAIDAISIASRILVAHLEFFID--LNREI-------------SVLEVIGTNQTDDK----
RPOA_MESFL       LASDAVSLASKILISHFDVFTT--LAEEV-------------EEVAIMGVETVEEK----
RPOA_MYCGE       KAVDAFAMAAKILIEHLNPIVS--VNESI-------------KNLTIIQEKAEERKV---
RPOA_MYCPN       SAVDAFAMAAKILIEHLNPIVN--VNESI-------------KALNIIQEKAEERRV---
RPOA_MYCGA       KSGDAIAIASKILSDHLKPLID--INKSL-------------HDIQVLNEKNVEEKN---
RPOA_MYCPE       SAAEAVAMSAKILLEHYKPIVTELFDNYN-------------DLRIINEEATVSSSK---
RPOA_UREPA       SGSEAIAIAAKIMQAHLEPIVN--IDKTI-------------NEMIIMREREEEEKR---
RPOA_MYCMO       DAKNAIAQAAKILVAHLNIIGDVNSLN---------------IKDIFEEGNTEKEHS---
RPOA_MYCPU       DTKNILSQAAQILIAHLQVIGDVKNLD---------------AVDVFEQKKQEKVEP---
RPOA_MYCH7       FAKDALSQGAKILIAHLNLLADVENLNKF-------------SADFFGDQEIKEEPI---
RPOA_MYCS5       TPESAIKLACKILVAHFQTIGDLTDLD---------------SDEIFQSEK-QSLEK---
RPOA_AYWBP       LAKEALATAASILVDHFNVLVE--LSQKP-------------AHVEFVSESKKEAHN---
RPOA_DEHMC       EPATAVSRSADILVKQFASLVSHSKVVAEIE--------------ASEPVKYTIP-----
RPOA_OSTTA       NPFDAVKSAAKVGMKLMTACLTTLQDQQVYLDE----SKLPETPNFVQVNYNKMES----
RPOA_SINAL       TPKEALYEASRNLINLFI----PFLHVEEE----------TFYLENNQ-HQVTLPVF-PF
RPOA_AETGR       TPKEALHEASRNLINLFI----PFLHVEEE----------TFYLENNE-DKVTLPLF-PF
RPOA_LIRTU       TPKEALHEASRNLIDLFI----PFLHAEEQ----------DIVLEDNP-NRFTVPLF-TF
RPOA_DRIGR       TPKEALHEASHNLIDLFI----PFLHGEEE----------DINLEDSL-NRGTLPFF-TF
RPOA_ACOCL       TPKEALHEASRNLIDLFI----PFLHAEEE----------DINFEENQ-NRFTVPPF-TF
RPOA_VITVI       TPKEALHEASRNLIDLFI----PFLHAEEE----------TLHLEYNQ-HKSTLPPL-TF
RPOA_PLAOC       TPKEALHEASRNLIDLFI----PFLHAQEE----------NILLEDNQ-NGVTLPFF-TF
RPOA_NANDO       TPKEALHEASRNLIDLFI----PFLHAEEQ----------DIILEDNQ-NRVTLPFF-TF
RPOA_RANMC       TPKEALYEASRNLIDLFI----PFLHAEEQ----------DQNLKDNQKNGVTLPFF-TF
RPOA_NICTO       TPKEALHEASRNLIDLFI----PFLHIEED----------NLYLQDNQ-HTVPLSPF-TF
RPOA_PANGI       TPKEALHQASRNLIDLFI----PFLHTEEE----------NLHLADNQ-HTVPLPPF-TF
RPOA_COFAR       TPKEALHQASRNLIDLFI----PFLHMEEQ----------NSHLENNQ-HTVPLAPF-FF
RPOA_LACSA       TPKEALYEASRNLIDLLI----PFLHTKEE----------NLNLEGNQ-HMVPLPPF-TF
RPOA_SPIOL       TPKEALYEASRNLIDLLI----PFLHA-EE----------NVNLEDNQ-HKVSLPLF-TF
RPOA_EUCGG       TPKEALHEASRNLIDLFI----PFLHAEEE----------NLHLENNQ-YKVTLPFF-TF
RPOA_OENEH       TPKEALHEASRNLIDLFL----PFLHAEEE----------NLHLGKNK-YNVTFPLF-TF
RPOA_CITSI       TPKEALHEASRSLIDLFI----PFLQAEDE----------NLPLENNQ-YKVTLPFF-TF
RPOA_GOSBA       TPKEALHEASRNLIDLFI----HFLHAKEE----------NLHLENNQ-HDVTLHFFFPF
RPOA_POPTR       TPKEALHEASRNLIDLFI----PFLHAEEE----------NFHLEKNQ-HKITLPLF-AF
RPOA_CUCSA       TPKEALHEASRNLIDLFI----PFLHAEEEK--------ENFHLKNNK-KKVTLPLF-TF
RPOA_MORIN       TPKEALHEASRNLIDLFI----PFFHAEE-------------HLENNQ-HKGTLPLF-NF
RPOA_JASNU       TPKEALHEACRNLIDLFI----PFLHKEEE----------TSPLEDNH-HTVPLSPL-TF
RPOA_PHAVU       TPKEALYEASQNLIELFI----PFLHAEED----------NFHLEKNQ-HKVTLPLF-TF
RPOA_LOTJA       TPKEALYEASRNLIDLFI----PFLHAEEE----------KLNFENNE-HKVTLPLF-TC
RPOA_PIPCE       TPKEALYEASRNLIDLFI----PFLHAEER----------EIHLEDNA-NGVPLALF-TF
RPOA_AMBTC       TPKEALYEASRNLIDLFI----PFLHAEER----------DLHLDDDQ-NIFTAPFF-PF
RPOA_NYMAL       TPKEALYEASRNLIDLFI----PFLHAEEQD--------INRNMEDNL-KRASVPFF-AF
RPOA_ORYSJ       TPKEALYEASRNLIDLFL----PFLHTEEE----------GTRFQENK-NRFTSPLL-SF
RPOA_PHAAO       TPKEALYEASRNLIDLLI----PFLHAEEE----------DMNFKENE-NRWNLPPF-SF
RPOA_PINTH       TPREALYEASRNLIDLFI----PFLHGEEQ----------NIDGMNNK-KGSNMLPF-PL
RPOA_PSINU       TPGAALSEASRDLIDLFI----IFLNMEKEE--------SIKEIE-NNELNIKNFPSTSI
RPOA_ANGEV       TPKEALYEASRNLIDLFL----PFLHTEEEE--------IISDRDEKSESNGNILLSNSI
RPOA_MARPO       TPKEALYEASRNLIDLFI----PLINSEKKE--------KNFGIEKTNESNMSYFPFQSV
RPOA_ANTAG       TPKEALREASQSLINLFI----PLLHEKKER--------ENRKLENKDEYNV--LRSCFS
RPOA_HUPLU       TPEEAIYEASRSSINLFL----PFLQAEKEK--------EDFKGEDIHESNA---LHPSV
RPOA_ADICA       TPHEALRKASEKLMDLLT----TFLYVRGG----------DVSLFENGEDSLDLTKSPSL
RPOA_CHAGL       EPKEAIKEASYNLVNLFT----PLVSQEYQQ--------LKNQLFKEDEKNKELNFIETN
RPOA_CHAVU       TPKEAFHQASEKIMNIFL----SLSNSSDN----------QIQEKSTKNFEEKEEFIFQN
RPOA_STAPU       TPAEALYQAHASLLNLFHQISPPLLHKELSPSKN----ILNQNSDSNSLGGSSFGRVVSL
RPOA_ZYGCR       TPQEVISQASQNLNDLLK----PLLKVER-----------YFQAKQNIHKKRMFTPTQSE
RPOA_MESVI       SPRDALDIGIKKVIDLFN------------------------PLHHCSSEYSTNKNDFST
RPOA_CHLAT       NSRQAIDLSVNKIINLFS------------------------PLQNVRSIEHEPLVK-EK
RPOA_PYRYE       SPQEAISQGATVLTNLFC------------------------SLRNLDFKSADNYRS-KE
RPOA_GRATL       SPQEAISEGAQVLHSLFY------------------------PLTNLNFQNANNTDN-EY
RPOA_GUITH       SAKEAISNAADNLINLFS------------------------PLKTIDGESETDYET-NE
RPOA_CYAPA       TPQDSISQAAEVLLNLFN------------------------PFKKINFENTDDSTE-QT
RPOA_CYACA       SPQQSINYASDNLVKLFN------------------------PLRVLDFSKESSSVY-EQ
RPOA_CYAM1       SPQEALHQAARILTHWFN------------------------PLQTLEWKTSHTKNE-QT
RPOA_TRICV       SPEEAVSSASRFIISFFS------------------------SLLENKLPQETKESENKT
RPOA_THAPS       SPEQAIFSGSNLIINLFK------------------------SIGEQKINKEKENIKEKN
RPOA_PHATC       SPNDALESAAQVIIDLFT------------------------LLINNKNINNNNRLELKP
RPOA_TRIV2       SPQEALSSAAGILVDLFN------------------------PLKDISL-EPTDTNSDIP
RPOA_TRIEI       TPQDALSNAAGILMSLFE------------------------PLKDIT--NMADIPSGET
RPOA_SYNY3       QPREALSEASDIIANLFI------------------------PLKDLNELEAAHSDYQDE
RPOA_SYNE7       SPQEALSQAASCLVALFE------------------------PLKNVSV--GSTHTADPE
RPOA_SYNJA       TPQEALSQAARILVGLFS------------------------PLQEVSF-DTPPEPRQAE
RPOA_GLOVI       SPQEALSQAAKILVDQLR------------------------PLQEITF-EPPAEPQRSA
RPOA_THEEB       TPQDALNQAATILVDLFS------------------------PLKEVPL-HTSEATATDD
RPOA_SYNS3       TPDDAIAQAANQLIELFQ------------------------PLATVTM--VEEPGIEPE
RPOA_SYNPX       TPDDALAQSANYLIELFQ------------------------PLATVTL--VEEPGIEPE
RPOA_PROMA       TPDDAVAEAANQLIELFQ------------------------PLATVTM--VEEVPQEPE
RPOA_PROM5       SPDDAIAEAANQLIELFQ------------------------PLATVTM--VEEIPEEPE
RPOA_PROM1       SPDDALAEAANQLIELFQ------------------------PLATVSM--VEEIPEEPE
RPOA_EMIHU       LPLEALNLAAERLSSLFK-------------------------LVNSADLTAEFPTEVEN
                                                                             

RPOA_BUCAI       ----------------------------------------FEPILLRPVDDLELTVRSAN
RPOA_BUCAP       ----------------------------------------FEPILLRPVDDLELTVRSAN
RPOA_ECOLI       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_BAUCH       ----------------------------------------FDPVLLRPVDDLELTVRSAN
RPOA_WIGBR       ----------------------------------------FDPVLLRPVDDLELTVRSAN
RPOA_BUCBP       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_BLOFL       ----------------------------------------FDPSLLNLVDDLELTVRSAN
RPOA_BLOPB       ----------------------------------------FDPILLRLVDDLELTVRSAN
RPOA_BUCCC       ----------------------------------------FEPVLLRPVDDLELTVRSAN
RPOA_COLP3       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_PSEA6       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_SHEAM       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_AERS4       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_PSEHT       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_IDILO       ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA1_PSYIN      ----------------------------------------FDPILLRPVNDLELTVRSAN
RPOA2_PSYIN      ----------------------------------------FDPILLRPVDDLELTVRSAN
RPOA_ACIBT       ----------------------------------------VDPILLRPVDDLELTVRSAN
RPOA_PSYCK       ----------------------------------------VDPVLLRPVDDLELTVRSAN
RPOA_HAHCH       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_MARHV       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_PSEE4       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_SACD2       ----------------------------------------IDPVLLRPVDDLELTVRSAN
RPOA_CHRSD       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_ALCBS       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_NITOC       ----------------------------------------IDPVLLQPIDDLELTVRSAN
RPOA_XANOM       ----------------------------------------VDPVLLRPIDDLELTVRSAN
RPOA_XYLFT       ----------------------------------------VDPVLLRPIDDLELTVRSAN
RPOA_ALKEH       ----------------------------------------VDPILLRPIDELELTVRSAN
RPOA_HALHL       ----------------------------------------IDPVLLRPIDDLELTVRSAN
RPOA_AZOSB       ----------------------------------------IDPVLLRPVDDLELTVRSAN
RPOA_NITMU       ----------------------------------------IDPVLLRPVDDLELTVRSAN
RPOA_DECAR       ----------------------------------------VDPVLLRPVDDLELTVRSAN
RPOA_POLNA       ----------------------------------------FDPILLRPVDELELTVRSAN
RPOA_RHOFT       ----------------------------------------FDPILLRPVDELELTVRSAN
RPOA_METPP       ----------------------------------------FDPILLRPVDELELTVRSAN
RPOA_RALSO       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_BORA1       ----------------------------------------IDPVLLRPVDDLELTVRSAN
RPOA_NEIG1       ----------------------------------------IDPVLLHPVDDLELTVRSAN
RPOA_CHRVO       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_THIDA       ----------------------------------------VDPLLLRPVDDLELTVRSAN
RPOA_METFK       ----------------------------------------VDPILLRPVDDLELTVRSAN
RPOA_NITEC       ----------------------------------------IDPILLRPVDDLELTVRSAN
RPOA_METCA       ----------------------------------------FDPLLLHPVDDLELTVRSAN
RPOA_LEGPA       ----------------------------------------FDPVLLRSVDDLELTVRSAN
RPOA_COXBU       ----------------------------------------VNPLLLRPVEDLELTVRAAN
RPOA_HYDCU       ----------------------------------------FDPIFLQPVDDLELTVRSAN
RPOA_DICNV       ----------------------------------------IDPVLLRPVDDLELTVRSAN
RPOA_VESOH       ----------------------------------------FDPQLLAAVDELELTVRSAN
RPOA2_FRAT1      ----------------------------------------INPILLKHVEELNLTARSSN
RPOA1_FRATN      ----------------------------------------IDPILLKPIDDLELTVRSSN
RPOA_NEOSM       ----------------------------------------ASDLLSARIDRLYLSARARK
RPOA_KORVE       ----------------------------------------RNENLNRSVEELELSVRSYN
RPOA_SOLUE       ----------------------------------------MNEVLNRSVEELELSVRSYN
RPOA_LEPBL       ----------------------------------------LKASLSKHVEELELSVRSLN
RPOA_ANADE       ----------------------------------------LNENLFRSVDELELSVRSAN
RPOA_MYXXD       ----------------------------------------LNENLFRSVDELELSVRSAN
RPOA_GEOMG       ----------------------------------------VNENLYRSVDELELSVRSAN
RPOA_GEOSL       ----------------------------------------INENLYRSVDELELSVRSAN
RPOA_PELPD       ----------------------------------------INENLYRTVEELELSVRSAN
RPOA_PELCD       ----------------------------------------INENLYRSVEELELSVRSAN
RPOA_SYNFM       ----------------------------------------FNDHLFRSVDELELSVRSAN
RPOA_BDEBA       ----------------------------------------LNENLFRSVDDLELSVRSAN
RPOA_SYNAS       ----------------------------------------LNDILLRHVEDLELSVRSAN
RPOA_DESPS       ----------------------------------------ENPYLDKPVEDLELSVRSAN
RPOA_DESVV       ----------------------------------------FNEHLFKSIDELELSVRATN
RPOA_DESAG       ----------------------------------------VNENLFKGIDELELSVRATN
RPOA_LAWIP       ----------------------------------------LNDNLFKGIDELELSVRATN
RPOA_RHILO       ----------------------------------------FNPALLKKVDELELSVRSAN
RPOA_BRUME       ----------------------------------------FNPALLKKVDELELSVRSAN
RPOA_BARQU       ----------------------------------------FNPALLKKVDELELSVRSAN
RPOA_BARBK       ----------------------------------------FNPALLKKVDELELSVRSAN
RPOA_NITWN       ----------------------------------------FNPAFLKKVDELELSVRSAN
RPOA_CAUVC       ----------------------------------------FNPALLKKVDELELSVRSAN
RPOA_MARMM       ----------------------------------------FNPALLRKVDELELSVRSAN
RPOA_MAGSA       ----------------------------------------FNKNLLRKVDELELSVRSAN
RPOA_RHORT       ----------------------------------------FNKNLLRKVDELELSVRSAN
RPOA_GRABC       ----------------------------------------FNRNLLRKVDELELSVRSAN
RPOA_ROSDO       ----------------------------------------FNPLLLKKVDDLELSVRSAN
RPOA_JANSC       ----------------------------------------FNPLLLKKVDELELSVRSAN
RPOA_PARDP       ----------------------------------------FDPRLLKKVDELELSVRSAN
RPOA_HYPNA       ----------------------------------------FNPVLLKKVDELELSVRSAN
RPOA_NOVAD       ----------------------------------------LNRYLLKKVDELELSVRSAN
RPOA_SPHAL       ----------------------------------------LNRFLLKKVDELELSVRSAN
RPOA_ERYLH       ----------------------------------------LNRYLLKKVDELELSVRSAN
RPOA_ZYMMO       ----------------------------------------LNRNLLKKVDELELSVRSAN
RPOA_PELUB       ----------------------------------------FNKNLLRKVDELELSVRSMN
RPOA_MAGMM       ----------------------------------------WNPNLFRKVDELELSVRSAN
RPOA_RICTY       ----------------------------------------FSPYLLKRVDELELSVRSAN
RPOA_RICBR       ----------------------------------------FSPYLLKRVDELELSVRSAN
RPOA_ANAMM       ----------------------------------------YDHNLLRKVDELELSVRSHN
RPOA_ANAPZ       ----------------------------------------YDHNLLRKVDELELSVRSHN
RPOA_EHRRW       ----------------------------------------YDSNLLRKVDELELSVRSYN
RPOA_WOLPM       ----------------------------------------YDPVLLRKVDEMELSVRSHN
RPOA_WOLTR       ----------------------------------------YDPILLRKVDEMELSVRSHN
RPOA_RHOBA       ----------------------------------------LEAKLNMTLADLRLSVRANN
RPOA_TREDE       ----------------------------------------IKQLLATSINTLDFSVRAKN
RPOA_TREPA       ----------------------------------------VLELLNTKIADVDFSVRARN
RPOA_BORBP       -----------------------------------------SNLLDMSIEKLDLSVRSLN
RPOA_BACTN       ----------------------------------------MRQLLKTKLVDMDLSVRALN
RPOA_PORGI       ----------------------------------------MRQLLKSKLSGLDLSVRALN
RPOA_GRAFK       ----------------------------------------MRQLLKTKLVDMDLSVRALN
RPOA_CYTH3       ----------------------------------------MRKLLKTSLADLDLSVRAYN
RPOA_PELLD       ----------------------------------------MRRLLNTKIEDLDLSVRSHN
RPOA_CHLPD       ----------------------------------------MRKLLHTKIEDLDLSVRSHN
RPOA_CHLTE       ----------------------------------------MRKLLQTKIEDLDLSVRSHN
RPOA_CHLCH       ----------------------------------------MRRLLATKIEDLDLSVRSHN
RPOA_SALRD       ----------------------------------------IRELLAQPVDELDLSVRSHN
RPOA_CAMJE       -----------------------------------------NTKLLQNITDLNLSARSYN
RPOA_CAMFF       -----------------------------------------HSKLLESVENLNLSARSFN
RPOA_HELHP       -----------------------------------------LKTLMIKIDTLNLSARCFN
RPOA_WOLSU       -----------------------------------------LKPLLQKIEALNLSARSFN
RPOA_HELAH       -----------------------------------------AKDLSAKIESMNLSARCFN
RPOA_SULDN       -----------------------------------------LKKLTAHIDSLGLSARSFN
RPOA_CHLMU       ----------------------------------------ILHKLVLGINEIELSVRSTN
RPOA_CHLFF       ----------------------------------------ILHKLVLGINEIELSVRSTN
RPOA_CHLPN       ----------------------------------------ILHKLILGINEIELSVRSTN
RPOA_PARUW       ----------------------------------------LMDKLSLGIDEIELSVRSAN
RPOA_AQUAE       ----------------------------------------K---LSLSIEELDISQRALN
RPOA_THEMA       ----------------------------------------NSDVYNRKIDELELSVRSLN
RPOA_COREF       ----------------------------------------YIAAYSMPIEDLDFSVRSYN
RPOA_CORDI       ----------------------------------------YIAAYGMPIEDLNFSVRSYN
RPOA_CORJK       ----------------------------------------HIAAYSMPIEDLNFSVRSYN
RPOA_BIFAA       ----------------------------------------TNPEMNIPIEDLNLTQRSYN
RPOA_FRAAA       ----------------------------------------LAADLALPIEEMDLTVRSYN
RPOA2_STRAW      ----------------------------------------LAADLVMPIEELELTVRSYN
RPOA_THEFY       ----------------------------------------LAADLALPIEDLNLTVRSYN
RPOA_ACIC1       ----------------------------------------LAADLALPIEDLNLTVRSYN
RPOA_ARTS2       ----------------------------------------LAADMALPIEDLDLTVRSYN
RPOA_NOCSJ       ----------------------------------------LAADLALPVEDLQLTVRSYN
RPOA_MYCLE       ----------------------------------------HIASFALPIDDLDLTVRSYN
RPOA_MYCS2       ----------------------------------------HIASFALPIDDLDLTVRSYN
RPOA_RHOJR       ----------------------------------------HIASFGLPIEDLDLTVRSYN
RPOA_SACEN       ----------------------------------------TIAAYAMPIEDLDLTVRSYN
RPOA_CUTAK       ----------------------------------------YAESLGTPVEELNLTVRSYN
RPOA_LEIXX       ----------------------------------------LSSELSMPIEDLDLSVRSYN
RPOA_TROWT       ----------------------------------------SDEDLRIPIEDLGLSVRSYN
RPOA_RUBXD       ----------------------------------------PVITDERPIEDLELTVRSYN
RPOA_GEOTN       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_BACHD       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_OCEIH       ----------------------------------------KEKVMEMTIEELDLSVRSYN
RPOA_LISW6       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_STAS1       ----------------------------------------KEKVLEMSIEELDLSVRSYN
RPOA_LACPL       ----------------------------------------KEKMLEMTIEELDLSVRSYN
RPOA_LACBA       ----------------------------------------KEKMLEMTIEELDLSVRSYN
RPOA_LACS1       ----------------------------------------KEKMLEMTIEELDLSVRSYN
RPOA_LACP3       ----------------------------------------KEKMLEMTIEELDLSVRSYN
RPOA_PEDPA       ----------------------------------------KEKMLEMTIEELDLSVRSYN
RPOA_ENTFA       ----------------------------------------KEKMLEMTIEELDLSVRSYN
RPOA_CLONN       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_CLOAB       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_CLOTE       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_CLOPS       ----------------------------------------KEKALEMTIEELDLSVRSYN
RPOA_CLOD6       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_CARHZ       ----------------------------------------KEKLAEMPIEDLDLSVRSYN
RPOA_MOOTA       ----------------------------------------RDRLMDMSIEELDLSVRSYN
RPOA_DESHY       ----------------------------------------KDKILEMTIEDLDLSVRSYN
RPOA_HUNT2       ----------------------------------------KEKVLEMTIEELDLSVRSYN
RPOA_SYMTH       ----------------------------------------RNKLMEMTIEELDLSVRSYN
RPOA_CALS4       ----------------------------------------VEKPLDMTIEELDLSVRSYN
RPOA_SYNWW       ----------------------------------------KDKILEMSIEELELSVRASN
RPOA_LACGA       ----------------------------------------NEKKLEMTIEELDLSVRSYN
RPOA_LACAC       ----------------------------------------KEKKLEMTIEELDLSVRSYN
RPOA_LACDB       ----------------------------------------KEKKLEMTIEDLDLSVRSYN
RPOA_STRSV       ----------------------------------------DDRILERTIEELDLSVRSYN
RPOA_STRS2       ----------------------------------------DDRMLDRTIEELDLSVRSYN
RPOA_LACLS       ----------------------------------------TERVLDKIIEEMDFSVRAYN
RPOA_LEUMM       ----------------------------------------ASASDSAPIEDLDLSVRSYN
RPOA_OENOB       ----------------------------------------TVMENKEPIEELELSVRSFN
RPOA_DEIGD       DLPRQP---ELSIN--------------------PQPYPADLDTPRVTLEGLGLTTRVLH
RPOA_DEIRA       DSPRQPDLGSLSIN--------------------PQPFPTDQDTPRVTLEGLGLTTRVLH
RPOA_THET8       ----------------------------------PEAPPEQEEELDLPLEELGLSTRVLH
RPOA_FUSNN       -------------------------------------QVIDDKSHDMKIEELDLTVRSFN
RPOA_MYCMS       -------------------------------------------ELDRTVEELDFTQRSLN
RPOA_MESFL       -------------------------------------------ELDKPVEELEFTQRSLN
RPOA_MYCGE       ------------------------------------------KSFAKQIEELDFTVRTFN
RPOA_MYCPN       ------------------------------------------RSFAKQIEELDFTVRTFN
RPOA_MYCGA       ------------------------------------------KKLSIPIEQLDLTVRSYN
RPOA_MYCPE       ------------------------------------------SSLAISIDELELSVRSYN
RPOA_UREPA       ------------------------------------------QNASISIDDLDLTVRAYN
RPOA_MYCMO       ------------------------------------------KTQNILIQSLDLSIRSFN
RPOA_MYCPU       ------------------------------------------SIHSVDITSLDLSVRSIN
RPOA_MYCH7       ------------------------------------------RRFSNSIDALDLSVRSLN
RPOA_MYCS5       ------------------------------------------EEDDMEIRLLNLSMRSQN
RPOA_AYWBP       ------------------------------------------YVLDLEIEQLDLSVRLFN
RPOA_DEHMC       -----------------------------------------EEKYNMPIEQLDLSVRAVN
RPOA_OSTTA       ----------------------------------------ESNFDQIFIEQLELSLRAYN
RPOA_SINAL       HNKLVN--LRQK--------------------------KKELAFQYIFIDQLELPPRIYN
RPOA_AETGR       HNRLVK--LRKK--------------------------KKELVFQYIFIDQLELPPRIYN
RPOA_LIRTU       HDRLAN--IRKN--------------------------KKGIALKCIFIDQSELPPRTYN
RPOA_DRIGR       QDKLAN--LRKN--------------------------KKAIALECIFIDQSELPPRTYN
RPOA_ACOCL       PDRLAN--LKKN--------------------------KKEIALKCIFIDQSELPPRTYN
RPOA_VITVI       HDRLAK--LRKN--------------------------KKEIELKYIFIDQLELPPRIYN
RPOA_PLAOC       HDRLAK--IRKN--------------------------EKEIALKYIFIDQSELPPRTYN
RPOA_NANDO       HDGLAK--LKK---------------------------KNEIALKFIFIDQSELPSRTYN
RPOA_RANMC       HDGFDK--LKKN--------------------------KKEIELKCIFIDQSELPSRTYN
RPOA_NICTO       HDKLAK--LIKN--------------------------KKKIALKSIFIDQSELPSRIYN
RPOA_PANGI       HEKLTK--LRKN--------------------------KKKIALKSIFIDQSELPPRIYN
RPOA_COFAR       HDKLDK--LRKN--------------------------KKEIALKSIFIDQSELPPRIYN
RPOA_LACSA       YDKLAK--LTKN--------------------------KKKMALKSIFIDQSELPPRIYN
RPOA_SPIOL       HNRLAE--IRKN--------------------------KKKIALKFIFIDQLELPPRIYN
RPOA_EUCGG       HDRLAK--LRKT--------------------------KKEIALKSIFIDQFELPPRTYN
RPOA_OENEH       HKKLAK--LRKP--------------------------KNEIALKSIFIDQLELPPRIYN
RPOA_CITSI       HDRLAK--LTKK--------------------------KKEIALKSIFIDQSEMSPRIYN
RPOA_GOSBA       HYRLVK--LTKK--------------------------KKEIALKYIFIDQSELPPRIYN
RPOA_POPTR       HDRLAK--LRKN--------------------------QKEIALKSIFIDQLELAPKIYN
RPOA_CUCSA       HEKLAK--LRKK--------------------------KKEIALKYIFIDQSELPPRIYN
RPOA_MORIN       HGRLAK--PRKT--------------------------KKEIALKYIYIDQSELPPRVYN
RPOA_JASNU       HDKADK--LRKRK----------------------KEIKKKIALKSIFIDQSEL-PKVYN
RPOA_PHAVU       HDILVKDKLRKN--------------------------QKEIALKSIFIDQLELPPRIYN
RPOA_LOTJA       HDLLAKTKLKKK--------------------------KKEIAFKSIFIDQLELPPKIYN
RPOA_PIPCE       HDEFAITNIRKN--------------------------KKKMALKSIFIDQSELPSKTYN
RPOA_AMBTC       HEGLAYIGIGES--------------------------KKRIALKRIFIDQLELSPRTYN
RPOA_NYMAL       DDGLDNI-------------------------------KREIILKRIFIDQLELPPRTYN
RPOA_ORYSJ       QKRLTN--LKKN--------------------------KKRIPLNCIFIDQLELPSRTYN
RPOA_PHAAO       QDKFTN--FKKN--------------------------KKGIPLTCIFIDQSELSSRTYN
RPOA_PINTH       SHVLTD--TGET--------------------------KEKIAFQLIFIDQLELPPKTYN
RPOA_PSINU       SVDIDRM-------------------------------AKEVAFKQIFIDQLELPARAYN
RPOA_ANGEV       STDIDRM-------------------------------AKEVAFKHIFIDQLELPARAYN
RPOA_MARPO       SLDIEKM-------------------------------TKDVAFKHIFIDQLELPARAYN
RPOA_ANTAG       LTNIGEV-------------------------------RKEISFKHIFIDQLELPARAYN
RPOA_HUPLU       SIVVDQM-------------------------------AKKVTFQHIFIEQLELSPKAYN
RPOA_ADICA       QPQFGD---TNN--------------------------LEERVLENRFIDQLELPARAFN
RPOA_CHAGL       SNAISD----NE--------------------------NSYNLYNQIFLDQLELSSRAYN
RPOA_CHAVU       IDGFKQDKETKV--------------------------QESLGWKKISINQLELSARAYN
RPOA_STAPU       ETRRDSTQTNNSSIPKEIQPSVRLKSYTDTNLSIDKQMNDSVNKENLSIDELELSPRISN
RPOA_ZYGCR       NLNMDQIEMIGG---NKLIDQPLLPADSHLNSSLSLNIDNLVHLEGISIDDLQISVRASN
RPOA_MESVI       ESK----------------------------------------INDILVEELELSVRAYN
RPOA_CHLAT       DSK----------------------------------------MTEVLVEELDLSVRAYN
RPOA_PYRYE       DKK----------------------------------------ISQVLIEELQLSVRAYN
RPOA_GRATL       EEE----------------------------------------INQVLIEELQLSVRAYN
RPOA_GUITH       TSH----------------------------------------INQILIEELQLSVRAYN
RPOA_CYAPA       EDK----------------------------------------ISQIPIEELQLSVRAYN
RPOA_CYACA       NSL----------------------------------------IKQKLIEELCLSVRAYN
RPOA_CYAM1       MAQ----------------------------------------LSNMLIEELDLSVRAYN
RPOA_TRICV       LSAPKNP------------------------------------HTNIAIEELHLSVRAYN
RPOA_THAPS       HIKPIDP------------------------------------YTHIAIEELQLSVRPYN
RPOA_PHATC       ETISIEP------------------------------------YTNIAIEELQLSVRAYN
RPOA_TRIV2       DDP----------------------------------------TAQIPIEELQLSVRAYN
RPOA_TRIEI       TDP----------------------------------------TSQIPIEELQLSVRAYN
RPOA_SYNY3       VNP----------------------------------------ESQIPIEELQLSVRAYN
RPOA_SYNE7       PTP----------------------------------------ESQTPIEDLQLSVRAYN
RPOA_SYNJA       DNQ----------------------------------------KNQIPIEELQLSVRAYN
RPOA_GLOVI       PNT----------------------------------------VGQVPIEELQLSVRAYN
RPOA_THEEB       HDE----------------------------------------TGQIPIEQLNLSVRAYN
RPOA_SYNS3       PSA----------------------------------------EAQIPLEELNLSVRAYN
RPOA_SYNPX       PSA----------------------------------------EAQIPLEELNLSVRAYN
RPOA_PROMA       PTA----------------------------------------EAQIPLEELNLSVRAYN
RPOA_PROM5       PSP----------------------------------------EAQIPLEELNLSVRAYN
RPOA_PROM1       PAA----------------------------------------EAQIPLEELNLSVRAYN
RPOA_EMIHU       IVQVSQ-----------------------------------TDVTGVLIEELELSVRAYN
                                                                 :    :  :  :

RPOA_BUCAI       CLKA--EAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRSLSLGMRLEN-----
RPOA_BUCAP       CLKA--ESIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDILA-ARNLSLGMKLEK-----
RPOA_ECOLI       CLKA--EAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_BAUCH       CLKA--EAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_WIGBR       CLKA--ESIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLS-TRNLTLGMRIEN-----
RPOA_BUCBP       CLKA--EMIHYIGDLVQKTEVELLRTPNLGKKSLTEIKDVLA-AKNLSLGMNLEN-----
RPOA_BLOFL       CLKA--ESIHYIGDLVQKTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLDN-----
RPOA_BLOPB       CLKA--ESIHYIGDLVQRTEIELLKTPNLGKKSLTEIKDVLA-SRGLSLGTRLEN-----
RPOA_BUCCC       CLKA--ESIHYIGDLVQKTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMKLDN-----
RPOA_COLP3       CLKA--EAIQYIGDLVQRAEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_PSEA6       CLKA--EAIQYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_SHEAM       CLKA--EAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_AERS4       CLKA--EAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_PSEHT       CLKA--EQIQYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_IDILO       CLKA--EAIQYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA1_PSYIN      CLKA--ESIYYIGDLVQRTEVELLKMPNLGRKSLTEIKDDLV-SRGLYLGMRLEN-----
RPOA2_PSYIN      CLKA--ETIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_ACIBT       CLKA--ENIYYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SKGLQLGMRLEN-----
RPOA_PSYCK       CLKA--ENIYYIGDLVQRSETELLKTPNLGKKSLTEIKDVLA-SKDLELGMRLDN-----
RPOA_HAHCH       CLKA--ENIYYIGDLIQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLEN-----
RPOA_MARHV       CLKA--ENIYYIGDLIQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLDN-----
RPOA_PSEE4       CLKA--ENIYYIGDLIQRTEVELLKTPNLGKKSLTEIKDVLA-SRGLSLGMRLDN-----
RPOA_SACD2       CLKA--ENIYYIGDLIQRTEVELLKTPNLGKKSLTEIKDILA-SRGLSLGMRLEN-----
RPOA_CHRSD       CLKA--ENIYYIGDLIQRTEVELLKTPNLGKKSLNEIKDVLA-ARGLSLGMRLEN-----
RPOA_ALCBS       CLKA--ENIYYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLA-SKGLSLGMRLEN-----
RPOA_NITOC       CLKA--ENIYYIGDLIQKTEVELLKTPNLGKKSLTEIKDVLT-LRGLSLGMRLEN-----
RPOA_XANOM       CLKA--ESIYYIGDLIQKTEVELLKTPNLGKKSLTEIKEVLA-QRGLALGMKLEN-----
RPOA_XYLFT       CLKA--ESIYYIGDLIQKTEVELLKTPNLGKKSLTEIKEVLG-QRGLGLGVKLEN-----
RPOA_ALKEH       CLKA--ESIHYVGDLVQRTEVELLKTPNLGKKSLTEIKETLA-SHGLSLGMRLEN-----
RPOA_HALHL       CLKA--ESIHFVGDLVQRTEVELLKTPNLGKKSLNEIKDTLA-EHGLSLGMQLDN-----
RPOA_AZOSB       CLKA--ENIYYIGDLIQRTETELLKTPNLGRKSLNEIKEVLA-SRGLTLGMKLEN-----
RPOA_NITMU       CLKA--ENIYYIGDLIQRTETELLKTPNLGRKSLNEIKEVLA-SRGLTLGMKLES-----
RPOA_DECAR       CLKA--ENIYYIGDLIQRTENELLKTPNLGRKSLNEIKEVLA-ARGLTLGMKLEN-----
RPOA_POLNA       CLKA--ENIYYIGDLIQRTENELLKTPNLGRKSLNEIKEVLA-SRGLTLGMRLES-----
RPOA_RHOFT       CLKA--ENIYYIGDLIQRTENELLKTPNLGRKSLNEIKEVLA-SRGLTLGMKLES-----
RPOA_METPP       CLKA--ENIYYIGDLIQRTETELLKTPNLGRKSLNEIKEVLA-SRGLTLGGRLEN-----
RPOA_RALSO       CLKA--ENIYYIGDLIQRTENELLKTPNLGRKSLNEIKEVLA-SRGLTLGMKLEN-----
RPOA_BORA1       CLKA--ENIYYIGDLIQRTENELLKTPNLGRKSLNEIKEVLA-ARGLTLGMKLEN-----
RPOA_NEIG1       CLKA--EDIYYIGDLIQRTETELLKTPNLGRKSLNEIKEVLA-SKGLTLGSKLEA-----
RPOA_CHRVO       CLKA--ENIYYIGDLIQRTETELLKTPNLGRKSLNEIKEVLA-SKGLTLGMKLEN-----
RPOA_THIDA       CLKA--ENIYFIGDLIQRSETELLRTPNLGRKSLNEIKDVLA-SKGLSLGMKLEN-----
RPOA_METFK       CLKA--ENIYYIGDLIQRTENELLKAPNLGRKSLNEIKDVLA-SKGLTLGMKLEN-----
RPOA_NITEC       CLKV--ENIFYIGDLIQRTEAELLRTPNLGRKSLNEIKEVLA-SRDLSLGMKLEN-----
RPOA_METCA       CLKA--ENIFYIGDLIQRSEADLLKTPNLGKKSLTEIKDVLA-TKGLSLGMRLEN-----
RPOA_LEGPA       CLKA--ENIHYIGDLVQRTESELLKTPNLGKKSLTEIKDVLA-SRSLSLGMKLEN-----
RPOA_COXBU       CLKA--ESINYIGDLVQCTENDLLKTPNLGKKSLLEIKSVLA-QKGLSLGMDLKG-----
RPOA_HYDCU       CLKA--EQIYYIGDLVQRAESSLLKTPNLGKKSLQEIKDVLA-QRGLGLGTKLEN-----
RPOA_DICNV       CLKA--ENINNIGDLVRRTEVELLKTPNLGKKSLNEIKEVLA-AHNLELGMDIEN-----
RPOA_VESOH       CLKA--EQIYYIGDLIQKSEQDLLRTPNLGRKSLNEIKEVLT-EKGLSLGTNIEN-----
RPOA2_FRAT1      CLKA--VNIRLIGELVQKTENELLKAPNFGKKSLTEIKDKLS-ELGLSLGTLIEN-----
RPOA1_FRATN      CLRA--ENIKYLGDLVQYSESQLMKIPNLGKKSLNEIKQILI-DNNLSLGVQIDN-----
RPOA_NEOSM       CLNG--ENIVYIRDLVSRTEADLLKAPNFGRRSLEEVKKELF-SKGLSLGMNLDS-----
RPOA_KORVE       CLKN--ANIQTIGELVQKTEAEMLKTKNFGRKSLNEIKEILA-SMGLSLGMKIDE-----
RPOA_SOLUE       CLKN--ANIQSIGELVQKTEAEMLRTKNFGRKSLNEIKEILA-NMGLSLGMRIDQ-----
RPOA_LEPBL       VLRS--LEIDFIGDLVKRSEEEMSKSKHYSDQCLQELKGKLS-TLGLSFGMRDF------
RPOA_ANADE       CLQN--ANIKTIGDLVQKTEAEMLKTKNFGRKSLKEIKEILA-EMGLSLGMKLEN-----
RPOA_MYXXD       CLQQ--ANIKSIGDLVQRTEAEMLKTKNFGRKSLKEIKEILA-EMGLSLGMKLEN-----
RPOA_GEOMG       CLKN--AGIKMIGELVSRSEAEMLKTQNFGRKSLNEIKDILA-DMGLTLGMKLDG-----
RPOA_GEOSL       CLKN--AGIKLIGELVSRTEAEMLKTQNFGRKSLNEIKDILA-EMGLTLGMKLEG-----
RPOA_PELPD       CLKN--AGIKLIGELVSKTEAEMLKTQNFGRKSLNEIKDILS-DMGLTFGMKLDS-----
RPOA_PELCD       CLKN--ANIHLIGDLVQRSEAEMLKTQNFGRKSLNEIKDILA-EMGLSLGMMLEN-----
RPOA_SYNFM       CLKN--ADIRYIGELVQKTEAEMLKTKNFGRKSLNEIKEILT-EMGLSLGMKLEN-----
RPOA_BDEBA       CLKN--ANIRYIGELVVRSEAEMLKTKNFGRKSLNEIKEILG-EMGLGLGMKIEG-----
RPOA_SYNAS       CLKN--AGINLIGELVQKSEAEMLKTKNFGRKSLSEIKEILA-EYGLTFGMKLEF-----
RPOA_DESPS       CLKN--ADINFIGDLVQRTDQEMLKTKNFGRKSLNEIKTLLQ-DMDLTLGVKLEG-----
RPOA_DESVV       CLKS--ANIALVGELVQKSENEMLKTKNFGRKSLDEIRRVLG-DMGLDFGTKVDG-----
RPOA_DESAG       CLKS--ANISLVGELVQKSEGEMLKTKNFGRKSLDEIRRVLG-EMSLDFGMKVDG-----
RPOA_LAWIP       CLRS--ANISTVGELVQKAEADMLKTKNFGKKSLDEIKALLT-SMGLDFGMKIDG-----
RPOA_RHILO       CLKN--DNIVYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLA-AMGLHLGMEVPD-----
RPOA_BRUME       CLKN--DNIVYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLA-SMGLHLGMEIPA-----
RPOA_BARQU       CLKN--DNIVYIGDLIQKTESEMLRTPNFGRKSLNEIKEVLA-CMGLHLGMEIPT-----
RPOA_BARBK       CLKN--DNIVYIGDLIQKTESEMLRTPNFGRKSLNEIKEVLA-CMGLHLGMEISA-----
RPOA_NITWN       CLKN--DNIVYIGDLVQKSEAEMLRTPNFGRKSLNEIKEVLA-QMGLHLGMEVPG-----
RPOA_CAUVC       CLKN--DNIVYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLA-GMGLHLGMDVPN-----
RPOA_MARMM       CLKN--DNIVYIGDLIQKSEAEMLRTPNFGRKSLNEIKEVLA-QMGLHLGMEAPN-----
RPOA_MAGSA       CLKN--DNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLA-QMGLHLGMEIAN-----
RPOA_RHORT       CLKN--DNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLA-QMGLHLGMEISN-----
RPOA_GRABC       CLKN--DNIVYIGDLVQKSEQEMLRTPNFGRKSLNEIKEVLA-NMGLSLGMSVSG-----
RPOA_ROSDO       CLKN--DNIVYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLS-GMGLHLGMDVED-----
RPOA_JANSC       CLKN--DNIVYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLS-GMGLHLGMDIVD-----
RPOA_PARDP       CLKN--DNIVYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLS-GMGLHLGMDVVD-----
RPOA_HYPNA       CLKN--DNIVYIGDLIQKSEAEMLRTPNFGRKSLNEIKEVLA-GMGLHLGMEVPD-----
RPOA_NOVAD       CLKN--DNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLS-SMGLRLGMDIPG-----
RPOA_SPHAL       CLKN--DNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLS-SMGLRLGMDIPG-----
RPOA_ERYLH       CLKN--DNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLS-SMGLRLGMDIPG-----
RPOA_ZYMMO       CLKN--DNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLS-GMGLRLGMEIPG-----
RPOA_PELUB       CLKN--DNIIYIGDLVQKSEGEMLRTPNFGRKSLNEIKEVLT-GMSLYLGMEIPN-----
RPOA_MAGMM       CLKN--DDIVYIGDLVQKSESEMLKTPNFGRKSLNEIKEVLD-EMGLSLGMTLDT-----
RPOA_RICTY       CLKN--DNIIYIGDLVKRTESDMLRTPNFGRKSLNEIKEILA-KFNLRFGMDVPD-----
RPOA_RICBR       CLKN--DNIIYIGDLVKRTEADMLRTPNFGRKSLNEIKEILA-KFSLRFGMDVPD-----
RPOA_ANAMM       CLKN--DNITYIGDLVQKTESDMLRTPNFGRKSLNEINEVLA-SMNLHLGMKVPN-----
RPOA_ANAPZ       CLKN--DNITYIGDLVQRTESDMLRTPNFGRKSLNEINEVLA-SMNLHLGMKVPN-----
RPOA_EHRRW       CLKN--DNITYIGDLVQKTESDMLRTPNFGRKSLNEINELLA-SMNLHLGMKIAN-----
RPOA_WOLPM       CLKN--ENITYIGDLVQKTEGEMLRTANFGRKSLNEIKAVLT-NFGLSLGMNVLN-----
RPOA_WOLTR       CLKN--ENITYIGDLVQKTESEMLRTANFGRKSLNEIKAVLN-NFGLSLGMDIPD-----
RPOA_RHOBA       CLES--ENIMTVRDLVQRTEDSLLEVRNFGDTTLNEVREKLS-QYGLHLGMRVPN-----
RPOA_TREDE       CLDS--AGIKTLGELAQKSEDEIESMRNVGRMTLNEIHAKLA-EYNLRLGMTDYS-----
RPOA_TREPA       CLLT--MGIKTLGELTRISEQTLANTRNVGKKSLSEIQGKLQ-EYNLRLGMADYN-----
RPOA_BORBP       CLAK--ENVRTLGELISKNAEELSKARNFGKKSLEEIIEKLS-SYQLFLGMSKED-----
RPOA_BACTN       CLKA--ADVETLGDLVQFNKTDLLKFRNFGKKSLTELDDLLE-SLNLSFGTDISK-----
RPOA_PORGI       CLNA--AGVDTLGDLVSLSRSDLMKIRNFGKKSLTELDELLA-TLNLSFGMDISK-----
RPOA_GRAFK       CLKA--AEVDTLGDLVSYNKNDLMKFRNFGKKSLTELEELVS-NKGLNFGMDLSK-----
RPOA_CYTH3       CLKA--ADIKTLGELATLDISDMMKFRNFGKKSLNELEQLII-DKNLSFGMDTAK-----
RPOA_PELLD       CLRL--AEIDTIGDLVSRKEDELLNYKNFGKKSLTELKEQLE-KFELKFGMDITR-----
RPOA_CHLPD       CLRL--AEIDTIGDLVSRKEDELLNYKNFGKKSLTELKEQLE-KFDLKFGMDITR-----
RPOA_CHLTE       CLRL--AEIDSLGDLVSRREEELLNYKNFGKKSLTELKEQLE-KFNLKFGMDITR-----
RPOA_CHLCH       CLRL--AEIDTLGELVSHKEDELLNYKNFGKKSLTELKEQLD-KFDLKFGMDITR-----
RPOA_SALRD       CLKA--ANIKTIGDLVRREEDEMLKFRNFGRKSLQELVEVLD-ERGLQFGMDVEE-----
RPOA_CAMJE       CLEK--AGVVYIGELALMSVSELAGLKNLGKKSLDEIKNIME-SIGFPVGTSKLS-----
RPOA_CAMFF       CLDK--ADIRYIGELALMEESELKDLKNLGKKSLDEIKAVMA-EIGYPFGENTLG-----
RPOA_HELHP       CLDR--SGLKYVGELVIMSENELKNIKNMGKKSYDEIADKLE-ELGYPVGGEIAD-----
RPOA_WOLSU       CLDR--AGMKFVGELVLLGENELKEVKNLGKKSFDEIKDKLE-EIGYPVGSDLAE-----
RPOA_HELAH       CLDK--IGIKYVGELVLMSEEELKGVKNMGKKSYDEIAEKLN-DLGYPVGTELSL-----
RPOA_SULDN       CLDR--SNIKLIGEIALMSTNDLKNVKNLGKKSYDEIVEKLQ-EFGYEVGGDLAD-----
RPOA_CHLMU       CLSN--ANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLK-EMKLELGMDLSQFGVGL
RPOA_CHLFF       CLSN--ANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLK-EMKLELGMDLSQFGVGL
RPOA_CHLPN       CLSN--ANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLK-EMKLELGMDLTQFGVGL
RPOA_PARUW       CLTG--ANIETLAELVCIPERRMLEFRNFGKKSLNEIKAKLH-EMSLHLGMDLSRFGVSP
RPOA_AQUAE       SLKR--IGITTIGDLVRMTEDELKSTKNIGRKALAEIKEALH-KLGLELGMNIETQR---
RPOA_THEMA       CLKR--AKIETIGDLLSKTEEELLKIKNFGQKSLDEVKEKLKEKFGLELRKGE-------
RPOA_COREF       CLKR--EDIHTVGELAERAESDLLDIRNFGQKSINEVKIKLA-GLGLTLKDAPEDFDPST
RPOA_CORDI       CLKR--QEIHTVGELAECTESDLLDIRNFGQKSINEVKIKLA-GLGLTLKDAPEDFDPTQ
RPOA_CORJK       CLKR--EEIHTVGELAARTESDLLDIRNFGQKSINEVKVKLA-GLGLGLKDAPEGFDITD
RPOA_BIFAA       CLKR--EGIHTIGELVAHTEQDLLDIRNFGMKSIDEVKEKLQ-SLGLALKASPLG----N
RPOA_FRAAA       CLKR--EGIHTIGELVSRSEADLLDIRNFGQKSIDEVKTKLG-AMGLQLKDSPPGFDPRQ
RPOA2_STRAW      CLKR--EGVHSVGELVARSEADLLDIRNFGAKSIDEVKAKLA-GMGLGLKDSPPGFDPTA
RPOA_THEFY       CLKR--EGIHTVGELVARTEQDLLDIRNFGAKSIEEVKQKLS-DMGLALKDAQGGFDPGS
RPOA_ACIC1       CLKR--EGIHTVGELVARSEADLLDIRNFGQKSIEEVKTKLA-EMGLSLKDSPPGFDPGR
RPOA_ARTS2       CLKR--EGIHTVGELVARSEADLMDIRNFGAKSIDEVKAKLV-ELGLSLKDSPPGFDLAA
RPOA_NOCSJ       CLKR--EGIHTVGELISRSEQDLLDIRNFGAKSIDEVKAKLV-EMGLSLKDSAPGFDPHA
RPOA_MYCLE       CLKR--EGVHTVGELVSRTESDLLDIRNFGQKSIDEVKVKLH-QLGLSLKDSPDSFDPSE
RPOA_MYCS2       CLKR--EGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLH-QLGLSLKDSPATFDPSE
RPOA_RHOJR       CLKR--EGVHTVGELVGRTESDLLDIRNFGQKSIDEVKVKLH-SLGLALKDSPASFDPTT
RPOA_SACEN       CLKR--EGIHTVGELVSRSEADLLDIRNFGAKSIDEVKLKLV-GLGLSLKDSPPGFDPSA
RPOA_CUTAK       CLKR--EGIHTVGELVSRSEQDLLAIRNFGSKSIDEVKEKLT-ELGLALKDSAPGFDPLA
RPOA_LEIXX       CLKR--EGINTVSELVSLSETQLMNIRNFGQKSVDEVKDKLT-EMGLSLKDSVPGFDGAH
RPOA_TROWT       CLKR--EGVNYVSELLGFSEQELLDIRNFGQKSADEVQEKLA-ELGHSLKGSVPGFDGSY
RPOA_RUBXD       CLKR--EGVDTIGQLATMTEEELMNIRNLGMKSVDEIRSKLE-EYGYTLESGRE------
RPOA_GEOTN       CLKR--AGINTVQELTQKTEEDMMKVRNLGRKSLEEVKAKLA-ELGLSLRKDD-------
RPOA_BACHD       CLKR--AGINTVQELTQKTEEDMMKVRNLGRKSLEEVQEKLG-ELGLGLRKEE-------
RPOA_OCEIH       CLKR--AGINTVQELANKSEEDMMKVRNLGRKSLEEVKVKLE-DLGLGLRDDD-------
RPOA_LISW6       CLKR--AGINTVQELADKSEDDMMKVRNLGRKSLEEVKVKLA-DLGLSLRNEN-------
RPOA_STAS1       CLKR--AGINSVQELADKSEADMMKVRNLGRKSLEEVKYKLE-DLGLGLRKED-------
RPOA_LACPL       CLKR--AGINTVQELTNKTEADMMKVRNLGRKSLEEVKAKLA-DLGLSLRKED-------
RPOA_LACBA       CLKR--AGINTVQELNNKTEADMMKVRNLGRKSLEEVKAKLA-DLGLSLRKED-------
RPOA_LACS1       CLKR--AGINTVQELTNKSEADMMKVRNLGRKSLDEVKAKLA-DLGLSLRHDD-------
RPOA_LACP3       CLKR--AGINTVQELTNKTEADMMKVRNLGRKSLEEVKNKLA-DLGLGLRKED-------
RPOA_PEDPA       CLKR--AGINSVQELTDRTDAQMMKVRNLGRKSLVEIQEKLS-LLGLGFRSED-------
RPOA_ENTFA       CLKR--AGINTVQELTNKSEPEMIKVRNLGRKSLEEVKLKLH-DLGLGLRKDD-------
RPOA_CLONN       CLKR--AGINTVQELTERTIDDMMKVRNLGKKSLEEVQEKLA-ALGLGLKKSDE------
RPOA_CLOAB       CLKR--AGINTVQELTQRSMEDMMKVRNLGRKSLEEVEQKLK-ALGLSLKLNDE------
RPOA_CLOTE       CLKR--AGINTVQELTERTVEDMMKVRNLGRKSLEEVEQKLE-ALELGLKQSEE------
RPOA_CLOPS       CLKR--AGINTVQELAGKSMDDMMKVRNLGKKSLEEVERKLN-ELGLNLRLNDE------
RPOA_CLOD6       CLKR--AGINTVEELANKSEDDMMKVRNLGKKSLEEVIQKLE-ELGLGLKPSEE------
RPOA_CARHZ       CLKR--AGINTVGELIQKTEADMMKVRNLGKKSLEEVISKLN-SMGLSLRKEEE------
RPOA_MOOTA       CLKR--AGINTVAELLQRSEEDMMKVRNLGKKSLEEVTQKLS-ELGLSLRSSEE------
RPOA_DESHY       CLKR--AGINSVEELTQKTEEDMIKVRNLGRKSLEEVESKLK-ELGLGFRKADD------
RPOA_HUNT2       CLKR--AGINTVEDLISRTEEDMMKVRNLGRKSLEEVVNKLK-ALGLSLAPSED------
RPOA_SYMTH       CLKR--AGINTIAELVSKTDEEMMKVRNLGKKSLEEVKTKLA-AFGLSLRQPDD------
RPOA_CALS4       CLKR--AGINTVQELTQKTEEEMMKIRNLGKKSLEEVKQKLA-ALGLSLKNSDE------
RPOA_SYNWW       GLKR--ASINTVGDLIAKNREEMSKIRNLGQKSLEEIERKLK-ELNLSFRKSED------
RPOA_LACGA       CLKR--AGINTVQELTDKSEADMMRVRNLGRKSLEEVKNKLA-ELGLSLRQDD-------
RPOA_LACAC       CLKR--AGINTLQELTDKTESDMMRVRNLGRKSLEEVKNKLT-DLGLSLRQED-------
RPOA_LACDB       CLKR--AGINTLQDLTVKSEAEMMRVRNLGRKSLEEVKNKLA-DLGLSLRQED-------
RPOA_STRSV       CLKR--AGINTVFDLTEKSEPEMMKVRNLGRKSLEEVKVKLA-DLGLGLKNDK-------
RPOA_STRS2       CLKR--AGINTVFDLTEKTEPEMMKVRNLGRKSLEEVKVKLA-DLGLGLKKDK-------
RPOA_LACLS       GLKR--AGINTVTDIVEMSEADMIKVKNLGHKSVEEVKVKLT-ELGLSLKKRK-------
RPOA_LEUMM       CLKR--AGINTIVELTDRTEADMMKVRNLGRKSLDEIQEKLT-DMNLGFRKED-------
RPOA_OENOB       CLKR--AGINTIEDLTDKTLHDMGEVRNLGRKSLEEIIQKLA-ERGQSFKQETEN-----
RPOA_DEIGD       SLKE--EGIDSVDALCALSDRDLKKVPGIGERSLDEIKQQLA-QFGLALRD---------
RPOA_DEIRA       SLKE--EGIDSVDALCALSDRDLKKVPGIGERSLDEIKQQLA-QFGLALRD---------
RPOA_THET8       SLKE--EGIESVRALLALNLKDLKNIPGIGERSLEEIKEALE-KKGFTLKE---------
RPOA_FUSNN       CLKK--AGIEEVSQLASLSLNELLKIKNLGKKSLDEILEKMK-DLGYDLEKNGSPE----
RPOA_MYCMS       CLKR--AGINTLRELVSKNEDEIGSIRNLGRKSLKEIKDKVA-SL-GLAFRQS-------
RPOA_MESFL       CLKR--AGISTLRELVSKTEDEIQDIRNLGRKSLKEIKDKVA-AL-ELTFKQN-------
RPOA_MYCGE       CLKR--SGIHTLQELLSKSLTDIREIRNLGKKSEREIIKKVQ-EL-GLKFRS--------
RPOA_MYCPN       CLKR--SGIHTLQELLSKSLADIREIRNLGKKSEREIIKKVH-EL-GLKLRS--------
RPOA_MYCGA       CLKR--HGIQTVEELVTRSKSEIENIRNLGKKSVREINKKLS-ELYDLKLKNN-------
RPOA_MYCPE       CLKR--AGIHTITQLTDKTKGEIEKIRNLGKKSFKEIIKKIQ-DR-NLKLKEEQN-----
RPOA_UREPA       ALKQ--SGINTTAELIELTKSQLEKIKNLGRKSVTEIIQKLT-ER-SLELKKD-------
RPOA_MYCMO       ALKR--ANYTTVQQLEALSLDDLKNIKNLGEKSINEIVEKLE-KYNVFLDKGEE------
RPOA_MYCPU       ALKR--QGYTKLADILTLTEDDLVAVKNLGKKSVEEIIQKLK-EYNVTLNRGEK------
RPOA_MYCH7       ALRR--AQYYKISDIEKLSQDDFENIKNLGRKSVQEIMEKLQ-NYK-NENKGEN------
RPOA_MYCS5       ALAK--SGIKTLNELASYPIEKLKEIKNLGEKSREEIIRKLN-EYGKLKN----------
RPOA_AYWBP       SLKR--AGIDTVASLVKLSEKEVVKLKSLGRKSFQELKDKFL-EYGLEFNDYLKEALHHS
RPOA_DEHMC       CLRH--AGITTVGEVINRGTKELLTLRNFGLKSLTELEDRLK-TIGLSLNPEDELFEEAE
RPOA_OSTTA       CLKR--ANILTLADLSQQSFRDLMKLRNFGQKSADEVRAALS-TYGIELKED--------
RPOA_SINAL       CLKK--SNIHTLLDLLNNSQEDLIKMEHFHIEDVKKLLDILEKK----------------
RPOA_AETGR       CLKK--SNIHTLLDLLNNSQEDLIKIEHFHIEDVKKILDILEKNRKFISN----------
RPOA_LIRTU       CLKR--SNIHTLLDLLSNSQEDLMRIEHFRIEDVKQILDILQKHFT-IDLPKNKF-----
RPOA_DRIGR       CLKR--SNIHTLLDLLSNSQEDLMRIEHLRIEDVKRILDILQKHFT-IDLPKNKF-----
RPOA_ACOCL       CLKR--SNIHTLLDLLSNSQEDLMKIEYFRIEDVKQILDTLQKHFA-IDLPKNKF-----
RPOA_VITVI       CLKR--SNIHTLLDLLNKSQKDLMKIEDFRIEDVKQLLGILEKHFT-ID-----------
RPOA_PLAOC       CLKR--SNIHTLLDLFNNSQEDLMKIEDFRIEDVKQILGILQKHFT-VDLPKNKF-----
RPOA_NANDO       CLKK--SNINTLLDLLNKSQEDLLKIEHFRIEDVKRVLGILQKRFV-IDLPKNKFSN---
RPOA_RANMC       CLKR--ANIHTLLDLLNKSQEDLMKIEHFRIEDVKQILDIIQKHFVVIDLPKNKFLIGNP
RPOA_NICTO       CLKM--SNIYTLLDLLNNSQEDLMKIEHFRSEDVKQILGILEKYFV-IDLAKNEF-----
RPOA_PANGI       CLIR--SNIYTLLDLLNNSQEDLMKIEHFRIEDVKAILGILEKHFA-IDLPKKLKIGFES
RPOA_COFAR       CLKR--SNIYTLLDLLNNSQENLMKIEHFHIEDVKEILGILEKQLV-IFLPKK-------
RPOA_LACSA       CLKR--SNIYTLLDLLNNSQEDLMKMEHFRIEDVKQILGILEKNFV-IDLPKNKF-----
RPOA_SPIOL       CLKK--SNIHTLLDLLNNSQEDLIKMKHFRIEDVKQIFGTLEKHFV-IDLKNKR------
RPOA_EUCGG       CLKR--YNIHTLFDLLNKSQEDLMKMEYFRIEDVKQILDSLEIEKA-FHNPFTEE-----
RPOA_OENEH       SLKG--SKIHTLSDLLNKSQEDLMKMKHFRIEDVKQILDILEIEKA-FHNRFNEENVENA
RPOA_CITSI       CLKK--SNIHTLFDLLNTRQEDLMKIEHFRIEDVKQIMSILEKK----------------
RPOA_GOSBA       CLKK--SNIHTLLDLLNNSREDLMKMEHFRIEDVKQILGILEKK----------------
RPOA_POPTR       CLKR--SNIHTLWDLLKNSQEDLMKIEHFRIEDVKHIFGILKIEKH-FTINLPKNKF---
RPOA_CUCSA       CLKR--CNIHTLFDLLNNSPDELMKIKHFRIEDVKHILDILEMEKN-FA-----------
RPOA_MORIN       CLKR--SNINTFLELLNNSQEELMKIQDFRIEDVKHILDVLEI-----------------
RPOA_JASNU       CLKG--SNLYTLLDLLNKSQEDLMKMEHLRLEDVNHILVILARKHFAIYLPNKKFEIDFE
RPOA_PHAVU       CLKR--SNIHTLLELLSNSQEDLLKFEHFHVEDGKSILDILKIQKYFA------------
RPOA_LOTJA       CLKK--SNIHTLLELLTKSKEDLMKIEHFRVEDVKHILDILEIEKHFP------------
RPOA_PIPCE       CLKK--SNIHTLLDLLNNSQEDLLKIEHFCMEDVKRILDILQKHFGFDLPKNGK------
RPOA_AMBTC       CLKR--SNIHTLLDLLSKSQEDLRKIQHFRVEDVKRVLDILKKRFAMNLFT---------
RPOA_NYMAL       CLKR--SNIHTLLDLLSKSQEDLMRIEHFRVEDVKQIFDILQKGFTIDLLKNSNQFESR-
RPOA_ORYSJ       CLKR--ANIHTLLDLLSKTEEDLMRIDSFRMQDGKQIWDTLEKHLPMDLPKNKF------
RPOA_PHAAO       CLKR--SNIHTLLDLLSHSQEDLMKMEYFRTEDVKQILSTVQKHFAINLLNKKL------
RPOA_PINTH       SLRR--ANIHTLLDLLNYSREDLMRIEHFGKESVEQVLEVLQKLFAIDPPRN--------
RPOA_PSINU       CLKK--MQVHTVSDLLKYTQYDLKKVKNFGNKSVEQVVEALQERFAIQLPKDQFNIS---
RPOA_ANGEV       CLKK--VDVHTISDLLKYSQDDLRKIKNFGKKSVDQVLEALQERFAINLPRNKFSID---
RPOA_MARPO       CLKK--VNVHTIADLLHYSEDDLIKIKNFGKKSVEQVLEALKKRFSIQLPKNKNYL----
RPOA_ANTAG       GLKK--VDVHTISDLLNYSQEDLMKIKNFGKKSIQQVVEALQKHFAIHLPKNKFSIND--
RPOA_HUPLU       FLKK--INVHTISDLLDYSQDDLMKMKNFGKKSVEQILEALQKRFGMRLQ----------
RPOA_ADICA       CLKR--AEIYTIADLLNYSREDLSKLKNFGRKSVDQVSEALWDRFAKELPDKKIVLNRRK
RPOA_CHAGL       SLKK--NNINTISDLLKYSYEDLLKIKNFGKKSADQVIEQLKKRFKIQL-----------
RPOA_CHAVU       CLKN--EKISTLFDLLNYSQEDLLKIKNFGKRSFEQVVNALEKHFDMKLSKDSSKKFYEQ
RPOA_STAPU       CLKK--ANINTIADLLNYTQEDLLKIKNFGRKSVEQVSLVLRKRFNMELLPTK-------
RPOA_ZYGCR       CLKK--VGIYTIRQLLSYTQQDLFQIKNLGKKSVEQIVIAIRKSYGHILG----------
RPOA_MESVI       CLKR--AQIHTISDLLAYSQEDLLEIKNFGRRSAEEVIEALEKKLNIYLPKEKY------
RPOA_CHLAT       CLKR--AQIHTVSDLLSYSQEDLLEIKNFGRRSAEEVIEGLQKRLGIHLPKEKFTKD---
RPOA_PYRYE       CLKR--AQIHSIADLLDYSQEELLEIKNFGQKSAEEVIYALQKKLGISLPKEKSD-----
RPOA_GRATL       CLKR--AQINSISDLLDYSQDELLEIKNFGQKSAEEVIEALQNKLGIRLPKEKNIQNT--
RPOA_GUITH       CLKRGCAHIHSVADLLDYSQEDLIEIKNFGQKSAEEVIDALQKRLGINLPKEKTTKIYNK
RPOA_CYAPA       CLKR--AQIHSIGDLLNVSQEELLEIRNFGQKSAKEVIDALQKRLGISLPKRKTNKKEN-
RPOA_CYACA       CLKR--VQVDSIGDLLEYSIGDLLEIKNFGQKSVEEVSKALYKKFGVKLKH---------
RPOA_CYAM1       CLKR--AQIHSVADLMQYTQEELLALKNFGQKSVEEVNKALEQKLHCQLKKYVD------
RPOA_TRICV       CLKR--AQINTIGDLLKYSPEKLQELKNFGRKSADEVFTTLKNKLGIVLSN---------
RPOA_THAPS       CLKR--AQINTIGDLLDYSPEKLLELKNFGRKSADEVFATLKNKLGIVLK----------
RPOA_PHATC       CLKK--AQINTVGDLLQYSPEKLQELKNFGRKSADEVFSTLKNKLGIILK----------
RPOA_TRIV2       CLKR--AQVNSVADLLDYTQEDLLEIKNFGQKSAEEVVEALQRRLGITLPQERSSKHS--
RPOA_TRIEI       CLKR--AQINSVADLLDYSQEDLLEIKNFGQKSAEEVIEALQKRLGITLPQEKVAKAT--
RPOA_SYNY3       CLKR--AQINSVADLLEYSQEDLLEIKNFGLKSAEEVIEALQKRLGITLPHEKAKA----
RPOA_SYNE7       CLKR--AQVNSVADLLSYTYEDLLEIKNFGQKSAEEVVEALE-RIGIKLQESKVS-----
RPOA_SYNJA       CLKR--AQINTVADLLVYTEEDLLEIKNFGQKSAEEVVQALKNRLGLTLPRERSKT----
RPOA_GLOVI       CLKR--AQINTVADLLEYTEEDLLEIKNFGQKSAEEVIEALQDKMGLSLPKDKPARS---
RPOA_THEEB       CLKR--AQVNTVADLLEYSQEELLEIKNFGQKSAEEVIEALQKHLGITLPPQKAARN---
RPOA_SYNS3       CLKR--AQVNSVSDLMGFSYEDLLEIKNFGSKSADEVIEALE-RIGISIPQSRTSV----
RPOA_SYNPX       CLKR--AQVNSVSDLMGFSYEDLLEIKNFGSKSADEVIEALE-RIGISIPQSRTSA----
RPOA_PROMA       CLKR--AQVNSVSDLMGFSYEDLLEIKNFGSKSADEVIEALE-RIGISIPQSRTSA----
RPOA_PROM5       CLKR--AQVNSVSDLMGFSYEDLLEIKNFGSKSADEVIEALE-RIGISIPQSRTSV----
RPOA_PROM1       CLKR--AQVNSVSDLMGFSYEDLLEIKNFGSKSADEVIEALE-RIGISIPQSRTSA----
RPOA_EMIHU       CLKR--AQIHTLGELLKYSKENLLEFKNFGQKSANEVCENLHERFNLTLN----------
                  *            :       .             :   .                   

RPOA_BUCAI       -WPPSSILDE-----------------------------------------
RPOA_BUCAP       -WPPSSILEE-----------------------------------------
RPOA_ECOLI       -WPPASIADE-----------------------------------------
RPOA_BAUCH       -WPPLGFIDK-----------------------------------------
RPOA_WIGBR       -WPPVSILKND----------------------------------------
RPOA_BUCBP       -WPPDNILDN-----------------------------------------
RPOA_BLOFL       -WPPKHLSEQ-----------------------------------------
RPOA_BLOPB       -WPPTNILDN-----------------------------------------
RPOA_BUCCC       -WPPKSLLED-----------------------------------------
RPOA_COLP3       -WPPESIVDND----------------------------------------
RPOA_PSEA6       -WPPESIAEKD----------------------------------------
RPOA_SHEAM       -WPPASLADDL----------------------------------------
RPOA_AERS4       -WPPASIADE-----------------------------------------
RPOA_PSEHT       -WPPASLAE------------------------------------------
RPOA_IDILO       -WPPASLIDND----------------------------------------
RPOA1_PSYIN      -WPPASLIED-----------------------------------------
RPOA2_PSYIN      -WPPASLSED-----------------------------------------
RPOA_ACIBT       -WPPASLRMDDRFAYRSR---------------------------------
RPOA_PSYCK       -WPPADLRVDDRFSYRSR---------------------------------
RPOA_HAHCH       -WPPASIRGDDRVLGG-----------------------------------
RPOA_MARHV       -WPPASLRGDDRVLGG-----------------------------------
RPOA_PSEE4       -WPPASLKKDDKATA------------------------------------
RPOA_SACD2       -WPPASLKNND----------------------------------------
RPOA_CHRSD       -WPPASLK-DDKASA------------------------------------
RPOA_ALCBS       -WPPVSLRDDDRLNAKLR---------------------------------
RPOA_NITOC       -WPPAGLREEETKVTA-----------------------------------
RPOA_XANOM       -WPPAGVAQHGMLG-------------------------------------
RPOA_XYLFT       -WPPPGVSQYGMLG-------------------------------------
RPOA_ALKEH       -WPPAGLGE-DRVVG------------------------------------
RPOA_HALHL       -WPPPSLGDRARIAG------------------------------------
RPOA_AZOSB       -WPPAGLEKLG----------------------------------------
RPOA_NITMU       -WPPSNLDKGKKDTSHAAP--------------------------------
RPOA_DECAR       -WPPAGLEKA-----------------------------------------
RPOA_POLNA       -WPPAGLDKR-----------------------------------------
RPOA_RHOFT       -WPPAALEKR-----------------------------------------
RPOA_METPP       -WPPQGLDKR-----------------------------------------
RPOA_RALSO       -WPPAGLEK------------------------------------------
RPOA_BORA1       -WPPLGLERP-----------------------------------------
RPOA_NEIG1       -WPPVGLEKP-----------------------------------------
RPOA_CHRVO       -WPPAGLEKP-----------------------------------------
RPOA_THIDA       -WPPAGLERP-----------------------------------------
RPOA_METFK       -WPPAGLEKV-----------------------------------------
RPOA_NITEC       -WPPANLENYVKEPGHASS--------------------------------
RPOA_METCA       -WPPEGLKKLNQ---------------------------------------
RPOA_LEGPA       -WPPASLGE------------------------------------------
RPOA_COXBU       -WPPADLTDQ-----------------------------------------
RPOA_HYDCU       -WPPSSLVSKESA--------------------------------------
RPOA_DICNV       -WPQN----------------------------------------------
RPOA_VESOH       -WPPVDLMSE-----------------------------------------
RPOA2_FRAT1      -WPQDL---------------------------------------------
RPOA1_FRATN      -FRELVEGK------------------------------------------
RPOA_NEOSM       -HG------------------------------------------------
RPOA_KORVE       -HGNAVAPPPGSQPAPSYGGYPGSYGTGGTFGGGGNYGGGGGFGGDNNPGF
RPOA_SOLUE       -HGRLVAPPP-------------------SAGGGPDFGPED--DGQDQIGE
RPOA_LEPBL       ---------------------------------------------------
RPOA_ANADE       -WPPKAAPQGAPKV-------------------------------------
RPOA_MYXXD       -WPPKQAPAPAQPKA------------------------------------
RPOA_GEOMG       -FPDPEVMRRIRGERKDEE--------------------------------
RPOA_GEOSL       -FPDPEVMRRLRGERKDEE--------------------------------
RPOA_PELPD       -FPEPDMLRRLRGEQNEEE--------------------------------
RPOA_PELCD       -FPDPEYLKMIQ-EGKEDL--------------------------------
RPOA_SYNFM       -FPSRDDIENRRKEQE-----------------------------------
RPOA_BDEBA       -WPPAGWDPSQPPQKRETQQ-------------------------------
RPOA_SYNAS       -TPWNKDVREEMGEIQEEG--------------------------------
RPOA_DESPS       -WNAPSDAETEE---------------------------------------
RPOA_DESVV       -FEKKYQEWK-RKQQHEA---------------------------------
RPOA_DESAG       -FEKKYQEWLKRKQQNEA---------------------------------
RPOA_LAWIP       -FEKKYQEWK-RKQHHEA---------------------------------
RPOA_RHILO       -WPPENIEDLAKRYEDQY---------------------------------
RPOA_BRUME       -WPPENIEDLAKRYEDQY---------------------------------
RPOA_BARQU       -WPPENIDDLAKRYEDQY---------------------------------
RPOA_BARBK       -WPPENIDDLAKHYEDQY---------------------------------
RPOA_NITWN       -WPPENIDELAKRFEDHY---------------------------------
RPOA_CAUVC       -WPPENIEDLAKKFEDQI---------------------------------
RPOA_MARMM       -WPPENIEDLAKRFEDHV---------------------------------
RPOA_MAGSA       -WPPENIEELAKKLEEPY---------------------------------
RPOA_RHORT       -WPPENIEDLAKKLEEPY---------------------------------
RPOA_GRABC       -WPPENIEDLAKRLEEPF---------------------------------
RPOA_ROSDO       -WPPDNIEDLAKKFEDSF---------------------------------
RPOA_JANSC       -WPPDNIEELAKKYEDNF---------------------------------
RPOA_PARDP       -WPPENIEDLAKRFDDQF---------------------------------
RPOA_HYPNA       -WPPEDIEGLAKKYDDHI---------------------------------
RPOA_NOVAD       -WPPENIEEMAKKLEQELLG-------------------------------
RPOA_SPHAL       -WPPENIEEMAKKLEQELLG-------------------------------
RPOA_ERYLH       -WPPENIEEMAKKLEQELLG-------------------------------
RPOA_ZYMMO       -WPPENIEEMAKKLEQEY---------------------------------
RPOA_PELUB       -WPPENIAEMSKKLEEQI---------------------------------
RPOA_MAGMM       -WPPENIDDLSKQFEEENF--------------------------------
RPOA_RICTY       -WPPENIQELSKRYEDSYN--------------------------------
RPOA_RICBR       -WPPENIHELSKRYEDSYN--------------------------------
RPOA_ANAMM       -WPPESIENLSKQYSED----------------------------------
RPOA_ANAPZ       -WPPESIENLSKQYSED----------------------------------
RPOA_EHRRW       -WPPESIESLSKQYSEE----------------------------------
RPOA_WOLPM       -WPPKDIDELAKQHTDED---------------------------------
RPOA_WOLTR       -WPPKDIDELARQHTDED---------------------------------
RPOA_RHOBA       -QPLF----------------------------------------------
RPOA_TREDE       -HLKNTIKVSRQKEETDEA--------------------------------
RPOA_TREPA       -HVGVVSRLMRQKEEIDEA--------------------------------
RPOA_BORBP       -ALFVLSKNVKISE-------------------------------------
RPOA_BACTN       -YKLDKE--------------------------------------------
RPOA_PORGI       -YKLDKD--------------------------------------------
RPOA_GRAFK       -YKLDKD--------------------------------------------
RPOA_CYTH3       -YKLDED--------------------------------------------
RPOA_PELLD       -YQMKG---------------------------------------------
RPOA_CHLPD       -YQMK----------------------------------------------
RPOA_CHLTE       -YQLKG---------------------------------------------
RPOA_CHLCH       -YQMK----------------------------------------------
RPOA_SALRD       -YLEEKKAS------------------------------------------
RPOA_CAMJE       -DNKEILKNKIAELKAQNEG-------------------------------
RPOA_CAMFF       -DSKEALRKKISELKS-----------------------------------
RPOA_HELHP       -DILPLLNRKLAKLKSN----------------------------------
RPOA_WOLSU       -EVSSALQKRLNKLK------------------------------------
RPOA_HELAH       -EQRESLKKRLEKLEDKGGND------------------------------
RPOA_SULDN       -DVVSALKKKIEAL-------------------------------------
RPOA_CHLMU       DNVKEKMKWYAEKIRSSKNTKG-----------------------------
RPOA_CHLFF       DNVKEKMKWYAEKIRS-KNVKG-----------------------------
RPOA_CHLPN       DNVKEKMKWYAEKIRA-KNIKG-----------------------------
RPOA_PARUW       DNVKDKIKQYREEKKKKKELVKHEDAK------------------------
RPOA_AQUAE       ---------------------------------------------------
RPOA_THEMA       ---------------------------------------------------
RPOA_COREF       LEGY-----------------------DAETGGYIDVEPEDAE--------
RPOA_CORDI       LDGY-----------------------DAATGDYIDTDPEETE--------
RPOA_CORJK       IEGY-----------------------DAETGEFIDTEGEDIAE-------
RPOA_BIFAA       FDAN-----------------------NLEGGTFFSPEDE-----------
RPOA_FRAAA       AV----------DTYGTDSYNPAFSDPSDDGAEFVETEQY-----------
RPOA2_STRAW      A---------------------ALGADDDADAGFLETEHY-----------
RPOA_THEFY       A---------------------AGSYGSDHDQSYVETEQY-----------
RPOA_ACIC1       VV----------YS--------ASRSDYDEDQRYIETEQL-----------
RPOA_ARTS2       R---------------------AAAIEEDD-AAFSDDEL------------
RPOA_NOCSJ       A---------------------LAAYGDDDDDAFVEDEQY-----------
RPOA_MYCLE       VA------GYDVTTGTWSTDGA---YDS---QDYAETEQL-----------
RPOA_MYCS2       VA------GYDAATGTWTSDAG---YDLDDNQDYAETEQL-----------
RPOA_RHOJR       VA------GYDAATGTWSDTDAGSFGDAEGTEDYAETEQL-----------
RPOA_SACEN       AAAEYPSEGWASETETVGGLGRVEDNGYDDGQDYAETEQL-----------
RPOA_CUTAK       AA---------------------EAYDEANDDDYAETEQY-----------
RPOA_LEIXX       FY---------------------SGYDEDESTTI-----------------
RPOA_TROWT       FD-----------------------------PNYGS---------------
RPOA_RUBXD       ---------------------------------------------------
RPOA_GEOTN       ---------------------------------------------------
RPOA_BACHD       ---------------------------------------------------
RPOA_OCEIH       ---------------------------------------------------
RPOA_LISW6       ---------------------------------------------------
RPOA_STAS1       ---------------------------------------------------
RPOA_LACPL       ---------------------------------------------------
RPOA_LACBA       ---------------------------------------------------
RPOA_LACS1       ---------------------------------------------------
RPOA_LACP3       ---------------------------------------------------
RPOA_PEDPA       ---------------------------------------------------
RPOA_ENTFA       ---------------------------------------------------
RPOA_CLONN       ---------------------------------------------------
RPOA_CLOAB       ---------------------------------------------------
RPOA_CLOTE       ---------------------------------------------------
RPOA_CLOPS       ---------------------------------------------------
RPOA_CLOD6       ---------------------------------------------------
RPOA_CARHZ       ---------------------------------------------------
RPOA_MOOTA       ---------------------------------------------------
RPOA_DESHY       ---------------------------------------------------
RPOA_HUNT2       ---------------------------------------------------
RPOA_SYMTH       ---------------------------------------------------
RPOA_CALS4       ---------------------------------------------------
RPOA_SYNWW       ---------------------------------------------------
RPOA_LACGA       ---------------------------------------------------
RPOA_LACAC       ---------------------------------------------------
RPOA_LACDB       ---------------------------------------------------
RPOA_STRSV       ---------------------------------------------------
RPOA_STRS2       ---------------------------------------------------
RPOA_LACLS       ---------------------------------------------------
RPOA_LEUMM       ---------------------------------------------------
RPOA_OENOB       ---------------------------------------------------
RPOA_DEIGD       ---------------------------------------------------
RPOA_DEIRA       ---------------------------------------------------
RPOA_THET8       ---------------------------------------------------
RPOA_FUSNN       ---------------------------------------------------
RPOA_MYCMS       ---------------------------------------------------
RPOA_MESFL       ---------------------------------------------------
RPOA_MYCGE       ---------------------------------------------------
RPOA_MYCPN       ---------------------------------------------------
RPOA_MYCGA       ---------------------------------------------------
RPOA_MYCPE       ---------------------------------------------------
RPOA_UREPA       ---------------------------------------------------
RPOA_MYCMO       ---------------------------------------------------
RPOA_MYCPU       ---------------------------------------------------
RPOA_MYCH7       ---------------------------------------------------
RPOA_MYCS5       ---------------------------------------------------
RPOA_AYWBP       VEEDKDKH-------------------------------------------
RPOA_DEHMC       NNKKKNKGIDED---------------------------------------
RPOA_OSTTA       ---------------------------------------------------
RPOA_SINAL       ---------------------------------------------------
RPOA_AETGR       ---------------------------------------------------
RPOA_LIRTU       ---------------------------------------------------
RPOA_DRIGR       ---------------------------------------------------
RPOA_ACOCL       ---------------------------------------------------
RPOA_VITVI       ---------------------------------------------------
RPOA_PLAOC       ---------------------------------------------------
RPOA_NANDO       ---------------------------------------------------
RPOA_RANMC       SE-------------------------------------------------
RPOA_NICTO       ---------------------------------------------------
RPOA_PANGI       LAQSIYSESG-----------------------------------------
RPOA_COFAR       ---------------------------------------------------
RPOA_LACSA       ---------------------------------------------------
RPOA_SPIOL       ---------------------------------------------------
RPOA_EUCGG       ---------------------------------------------------
RPOA_OENEH       FISSFFLNKTKGQKKDEMGFESLE---------------------------
RPOA_CITSI       ---------------------------------------------------
RPOA_GOSBA       ---------------------------------------------------
RPOA_POPTR       ---------------------------------------------------
RPOA_CUCSA       ---------------------------------------------------
RPOA_MORIN       ---------------------------------------------------
RPOA_JASNU       IYCYSIFFH------------------------------------------
RPOA_PHAVU       ---------------------------------------------------
RPOA_LOTJA       ---------------------------------------------------
RPOA_PIPCE       ---------------------------------------------------
RPOA_AMBTC       ---------------------------------------------------
RPOA_NYMAL       ---------------------------------------------------
RPOA_ORYSJ       ---------------------------------------------------
RPOA_PHAAO       ---------------------------------------------------
RPOA_PINTH       ---------------------------------------------------
RPOA_PSINU       ---------------------------------------------------
RPOA_ANGEV       ---------------------------------------------------
RPOA_MARPO       ---------------------------------------------------
RPOA_ANTAG       ---------------------------------------------------
RPOA_HUPLU       ---------------------------------------------------
RPOA_ADICA       ---------------------------------------------------
RPOA_CHAGL       ---------------------------------------------------
RPOA_CHAVU       LKNLELINNKDIS--------------------------------------
RPOA_STAPU       ---------------------------------------------------
RPOA_ZYGCR       ---------------------------------------------------
RPOA_MESVI       ---------------------------------------------------
RPOA_CHLAT       ---------------------------------------------------
RPOA_PYRYE       ---------------------------------------------------
RPOA_GRATL       ---------------------------------------------------
RPOA_GUITH       ---------------------------------------------------
RPOA_CYAPA       ---------------------------------------------------
RPOA_CYACA       ---------------------------------------------------
RPOA_CYAM1       ---------------------------------------------------
RPOA_TRICV       ---------------------------------------------------
RPOA_THAPS       ---------------------------------------------------
RPOA_PHATC       ---------------------------------------------------
RPOA_TRIV2       ---------------------------------------------------
RPOA_TRIEI       ---------------------------------------------------
RPOA_SYNY3       ---------------------------------------------------
RPOA_SYNE7       ---------------------------------------------------
RPOA_SYNJA       ---------------------------------------------------
RPOA_GLOVI       ---------------------------------------------------
RPOA_THEEB       ---------------------------------------------------
RPOA_SYNS3       ---------------------------------------------------
RPOA_SYNPX       ---------------------------------------------------
RPOA_PROMA       ---------------------------------------------------
RPOA_PROM5       ---------------------------------------------------
RPOA_PROM1       ---------------------------------------------------
RPOA_EMIHU       ---------------------------------------------------