CLUSTAL format seed alignment for MF_00060

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SURE_HELPY       ---------------MKKILLTNDDGYHAKGIKALEQAL--EEM-AEIYVVAPKHEKSAC
SURE_HELPJ       ---------------MKKILLTNDDGYHAKGIKALEQAL--ENM-AEIYVVAPKHEKSAC
SURE_CAMJE       ---------------MKEILITNDDGYESEGLKKLIKMLTKEFK-AKITIVAPASEKSAC
SURE_CHLMU       ----------MTKEPRFKILITNDDGIKAKGISLLVSLLRDANF-ADLYVVAPLEEQSGR
SURE_CHLTR       ----------MTETRRLRILITNDDGIKAKGISLLISLLREADF-ADLYVVAPLEEQSGR
SURE_CHLPN       ---------MVLMNKRLKIILTNDDGITAKGMSCLVSALLEANI-GDIYIAAPQAEQSGK
SURE_BRUME       ----------------MRILLTNDDGIHAEGLAVLERIARKLSD--DVWVVAPETDQSGL
SURE_RHILO       ----------------MRILLTNDDGIHAEGLASLERVARTLSD--DVWVVAPEQDQSGY
SURE_RHIME       ----------------MRILLTNDDGIHAEGLSVLERIARTISD--DVWVVAPEVDQSGL
SURE_CAUVC       ----------------MRILLTNDDGIHAPGLQALEKIARALSD--DVWICAPEYEQSGA
SURE_COXBU       --------MKKTATPKLRLLLSNDDGVYAKGLAILAKTLADLG---EVDVVAPDRNRSGA
SURE_LEGPH       ----------------MKILVSNDDGVLAPGIKILANELSTLG---EVKVVAPDRNRSGA
SURE_XYLFA       ----------------MRVLVSNDDGVDAPGIKILADALRNAGH--EVMVVAPDRDRSGA
SURE_ECOLI       ----------------MRILLSNDDGVHAPGIQTLAKALREFA---DVQVVAPDRNRSGA
SURE_SALTY       ----------------MRILLSNDDGVHAPGIQTLAKALREFA---DVQVVAPDRNRSGA
SURE_YERPE       ---------------MIRILLSNDDGISAPGIQTLASALRGFA---QVQIVAPDRNRSGA
SURE_HAEIN       ----------------MRILVSNDDGFHAEGIQVLATELRKIA---EVIIVAPDRNRSAA
SURE_PASMU       ----------------MKILLSNDDGIHAEGIQILARELRKFA---DVTLVAPDRNRSAA
SURE_VIBCH       ----------------MKILLSNDDGVYAQGIHALADALRDLA---EIVIVAPDRNRSGA
SURE_PSEAE       ----------------MRILIANDDGVTAPGIAALYDALADHA---DCVVIAPDQDKSGA
SURE_NEIMA       ----------------MNVLISNDDGYLSEGIAVLARVTAEFA---NVRVVAPERDRSGV
SURE_NEIMB       ----------------MNVLISNDDGYLSEGIAVLARVTAEFA---NVRVVAPERDRSGV
SURE_RALSO       ----------------MHILLANDDGYLAPGLAALHRALAPLG---RITVVAPEQNHSGA
SURE_RUBGI       ----------------MRILIANDDGYLAPGIAALVKACEGLG---TIDVIAPEQNASGT
SURE_AQUAE       ---------------MPTFLLVNDDGYFSPGINALREALKSLG---RVVVVAPDRNLSGV
SURE_NOSS1       ----------------MKLLISNDDGISALGIRTLANALAEAGH--DVTVVCPDRERSAT
SURE_SYNY3       ----------MTPSPVLNLLVSNDDGIFSQGVRTLANTLVAAGH--EVTVVCPDRERSAT
SURE_THEMA       ----------------MRILVTNDDGIQSKGIIVLAELLSEE-H--EVFVVAPDKERSAT
SURE_DEIRA       MTVPDPARPAASPSARPRVLVANDDGIFAPGIKALGLALSEW-A--DVVVVAPDVEQSAV
SURE_ARCFU       ----------------MKILLTNDDGLYSAGLKAAYDALSEL---GEVFVVAPAVQRSGV
SURE_METTH       ----------------MKILITNDDGVNSSGIIAARRAVEDL---GETIIVAPATQQSGI
SURE_METJA       ----------------MEILIVNDDGIYSPSLIALYNALKEKFSDANITIVAPTNQQSGI
SURE_HALSA       -----------MDADEPEILVTNDDGIDAPGIRALADGLDAVG---NVTVVAPADNQSAT
SURE1_PYRAE      ----------------MKILVTNDDGVHSPGLRLLYQFALSLG---DVDVVAPESPKSAT
SURE2_PYRAE      ----------------MKIVVTNDDGPHSPLLEPLVRGLEAVGN--EVVVVVPERPRSAA
SURE_AERPE       ---------------MLKAIVTNDDGVHSRSLRALAESLASRGW--DVVVAAPLGNWSGY
                                    :: ****  :  :                 :  *    *. 

SURE_HELPY       SQCITITAPLRAEKIK--GKEGRHYRIDDGTPSDCVYLAINELFKHVCFDLVISGINLGS
SURE_HELPJ       SQCITITAPLRAEKIK--GKEGRHYRIDDGTPSDCVYLAINELFKHVCFDLVISGINLGS
SURE_CAMJE       SHSITLTKPLRFVKV---GK--RFYKLDDGTPADCVYLALHALYKKRLPDLVISGINKGA
SURE_CHLMU       SMAFSLIGPTAVEPFDY-PQKVQEAWAVVGTPVDCVKLAIGELFKDNPPDLVLSGINNGK
SURE_CHLTR       SMAFSLVEPTALEPFDY-PQRVQEAWAVTGTPVDCVKLAIGELFKENALDLILSGINNGK
SURE_CHLPN       SMAISLNQVVCASPYAY-PQPVKEAWAVGGSPTDCVRLGLRTLFESVSPDLVISGINCGN
SURE_BRUME       AHSLTLSEPLRLRQID-----ARHFALR-GTPTDCVIMGVRHVLPG-APDLVLSGVNSGA
SURE_RHILO       AHSLSISEPLRLRKIG-----EKHFAVR-GTPTDCVIMGVKKILPG-APDVILSGINSGA
SURE_RHIME       AHSLTLSEPLRLRPVS-----ERRFALR-GTPTDCVIMAVKKILDR-KPDLVLSGVNVGA
SURE_CAUVC       SRALTLADPIRVRKLD-----SRRFAVE-GTPTDCVMMAVQHLIEGGRPDLVLSGVNRGQ
SURE_COXBU       SNSLTLNAPLHIKNLE-----NGMISVE-GTPTDCVHLAITGVLP-EMPDMVVAGINAGP
SURE_LEGPH       SNSLTLTQPLRVKQLD-----NGYYSVD-GTPTDCVHLALTGFL--EPTDIVVSGINEGA
SURE_XYLFA       SNSLTLDTPIRAKQID-----MHTYSVA-GTPTDCVHLALTGLLN-YDPDIVVSGINNTG
SURE_ECOLI       SNSLTLESSLRTFTFE-----NGDIAVQMGTPTDCVYLGVNALMR-PRPDIVVSGINAGP
SURE_SALTY       SNSLTLESSLRTFTFD-----NGDIAVQMGTPTDCVYLGVNALMR-PRPDIVVSGINAGP
SURE_YERPE       SNALTLDSALRITTLS-----NGDIAVQQGTPTDCVYLGVNALMR-PRPDIVVSGINAGP
SURE_HAEIN       SSSLTLVEPLRPRHLD-----NGDYCVN-GTPADCVHLALNGFLS-GQVDLVVSGINAGC
SURE_PASMU       SSSLTLVEPLRPLRLP-----NGDYCLN-GTPADCVYLALNGFLS-GQVDLVVSGINAGV
SURE_VIBCH       SNSLTLEHPLRVSQIA-----ENTYSVQ-GTPTDCVHFALNELMKDALPDLVLSGINHGA
SURE_PSEAE       SSSLTLDRPLHPQRLD-----NGFISLN-GTPTDCVHLGLNGLLE-ELPDMVVSGINLGA
SURE_NEIMA       SNSLTLERPLQLKQA-----QNGFYYVN-GTPTDCIHIGQSVFSD-FQADFVFSGINRGA
SURE_NEIMB       SNSLTLERPLQLKQA-----QNGFYYVN-GTPTDCIHIGQSVFSD-FQADFVFSGINRGA
SURE_RALSO       SNSLTLQRPLSVFQAT-EGAQKGFRFVN-GTPTDCVHIALTGMIE-ERPDLVVSGINQGQ
SURE_RUBGI       SNALTLNRPLSVFEAR-GEPVQGFRVVN-GTPSDSVHVALTGLLP-HKPDLVLSGINQGA
SURE_AQUAE       GHSLTFTEPLKMRKID-----TDFYTVIDGTPADCVHLGYRVILEEKKPDLVLSGINEGP
SURE_NOSS1       GHGLTLHQPIRAEIVESIFHPAIKAWACDGTPSDCVKLALWALLE-SPPDLVLSGINQGA
SURE_SYNY3       GHGLTLHRPIRAGIVEDVFDPRIKAWSCSGTPADCVKFALHAVMP-RYPDFVLSGVNHGA
SURE_THEMA       GHSITIHVPLWMKKV--FISERVVAYSTTGTPADCVKLAYNVVMD-KRVDLIVSGVNRGP
SURE_DEIRA       GHGITIRRPLRFKHTAAAGFGDIPAYRVDGTPADCVVLGVHLLG---RPDLVVSGINIGP
SURE_ARCFU       GRSLSIMEPIRVSEVKV---NGMRVFAVDGTPTDSVIIGMYEVIG-EIPDLAVSGINLGE
SURE_METTH       GHALTLFEPVRVSEVTLR--DGSGAYAVSGTHTDAVIIGIFELMD-EKPDLVISGINMGE
SURE_METJA       GRAISLFEPLRMTKVKLA--KDIVGYAVSGTPTDCVILGIYQILK-KVPDLVISGINIGE
SURE_HALSA       GRAMSQEVAVHDHDLG---------YAVEGTPADCVVAGLEALGP--YPDLVVSGVNEGG
SURE1_PYRAE      GLGITLHKPLRMYEVDL---CGFRAIATSGTPSDTVYLATFGLGR--KYDIVLSGINLGD
SURE2_PYRAE      GLARTYHKPLRVRRLG-------GYYVVNGFPADAVFLALKLIAP--DAELVISGVNVGE
SURE_AERPE       SKSIGRFRGNRVYRFE-----SRGVRFFTGDMPPAALVGTAIDIAGFEPDIVVSGINYGP
                 .                            *        .          :. .:*:*   

SURE_HELPY       NMGE-DTIYSGTVAGAIEGTIQGVPSIAISQILS----NKNKNTPLSFDLAQKIIQDLVQ
SURE_HELPJ       NMGE-DTIYSGTVAGAIEGTIQGVPSIAISQILS----NKNKNTPLSFDLAQKIIQDLVQ
SURE_CAMJE       NVGE-DITYSGTCAGAMEAVLQGIPAIALSQFYK----KSEK--ELDYKNALQITKKIIQ
SURE_CHLMU       NSGR-NLYYSATVGAIREANLHGIPAIALSQCEN----------ISFFQEAQMSSLIRAL
SURE_CHLTR       NSGR-CLYYSATVGAIREANLHGIPAIALSQSEN----------IAFFQKAHMASLIRSL
SURE_CHLPN       NICK-NAWYSGTIGAAKQALVDGIPSMALSQDNH----------ISFFQQDKAPEILKAL
SURE_BRUME       NMAD-DVTYSGTVAGAMEGTLLGVRAIALSQEYE----YAGDR-RIVPWETAEAHAPELI
SURE_RHILO       NIAD-DVTYSGTVAGAMEGALLGIRSIALSQGYS----YVGED-RIVPYETTEALAPALL
SURE_RHIME       NLAD-DVTYSGTVAGAIEGTLQGIRSIALSQAYQ----HA-VG-RDVPWDVAETHAPALI
SURE_CAUVC       NIAE-DVTLSGTVAGAIEGMAMGIPSIALSQSMN----YFHDE-IVAHWETAEAFAPGII
SURE_COXBU       NLGD-DVWYSGTVAAAMEGRFLGLPALAVSLG---------GE-LFRYYETAAKVVYQLI
SURE_LEGPH       NLGD-DVLYSGTVAAAMEGRYLGLPAIAISMV---------GD-NIQHYETAAIIAKQLV
SURE_XYLFA       NLGD-DVIYSGTVSAAMEGRFLGLPAVAVSLVTL----YREGQ-QAPQYETAAHAAINIV
SURE_ECOLI       NLGD-DVIYSGTVAAAMEGRHLGFPALAVSLD---------GH---KHYDTAAAVTCSIL
SURE_SALTY       NLGD-DVIYSGTVAAAMEGRHLGFPALAVSLN---------GY---QHYDTAAAVTCALL
SURE_YERPE       NLGD-DVIYSGTVAAAMEGRHLGYPALAVSLN---------GH---QHYDTAAAVTCRLL
SURE_HAEIN       NMGD-DTIYSGTLAAALEGRHLGLPAIAVSLD---------GR---QHYETAARVVCDLI
SURE_PASMU       NLGD-DVIYSGTVAAALEGRYLGLPAIAVSLD---------GR---QHYESAARVVCELI
SURE_VIBCH       NLGD-DVLYSGTVAAAMEGHFLGVQSIAFSLA---------GT---THFASAAHFVRQLV
SURE_PSEAE       NLGD-DVLYSGTVAAAIEGRFLKGPAFAFSLV---------SR-LTDNLPTAMHFARLLV
SURE_NEIMA       NMGD-DTLYSGTVAAATEAYLMGMPAVAFSLN---------DA-SGRYWATAEQALWTLL
SURE_NEIMB       NMGD-DTLYSGTVAAATEAYLMGIPAVAFSLN---------DA-SGRYWATAEQALWTLL
SURE_RALSO       NMGE-DVLYSGTVAAAIEGYLFGVPSIAFSQV---------DK-GWTHLDAAERIAREVV
SURE_RUBGI       NMGD-DTLYSGTVAAAMEGYLFGVPAIAFSQA---------EK-GWTHLDAAAATARAIV
SURE_AQUAE       NLGE-DITYSGTVSGAMEGRILGIPSIAFSAF---------GR-ENIMFEEIAKVCVDIV
SURE_NOSS1       NLGT-EILYSGTVSAAMEGMIEGIPSIAFSLTSH----ISR------NFQPAAKFATILV
SURE_SYNY3       NLGT-DVLYSGTVSAAMEGLIEGIPSIALSLVSF----TAT------DFQPAADFANCFV
SURE_THEMA       NMGM-DILHSGTVSGAMEGAMMNIPSIAISSANY----ESP------DFEGAARFLIDFL
SURE_DEIRA       NLGE-DLTHSGTVAAAIEGLTLGLPSIAFSQFAN----EAGEY----DFGPSAAYASRLA
SURE_ARCFU       NLSTEAATTSGTVGAALEAATHGSKTIAISLQMP--DVSKFELTSKADFSFASKVLRGIA
SURE_METTH       NLGKSELTTSGTIGAAMEAAVHGVPSLAVSLQVRRGDIKFHDGHVDVDFSLAAELTGRVA
SURE_METJA       NLGT-EIMTSGTLGAAFEAAHHGAKSIASSLQITSDHLKFKELDIPINFEIPAKITAKIA
SURE_HALSA       NLGMYVLGRSGTVSAAVEAAFFGVPAIAVSMYMR--EEQFGEPTAVADYEHAVDATTHLA
SURE1_PYRAE      NTSLQVILSSGTLGAAFQAALLGIPALAYSAYLENWNELLNNK---EAVEIMGAVVSSTA
SURE2_PYRAE      NIGIEATYGSGTVGAALQAGVLGVPSIAASMEVG------------GDVDFMIKVVEGAV
SURE_AERPE       NLGIYDFFSSGTIGGALEAALRGFKSVSISSACR-----EEE----TDCLPEALSISLAV
                 *        *.* ..  :.      :.: *                              

SURE_HELPY       NIFTKGYPLKGRKLLNVNVPNCSL-QEYQGERITPKG-YRLYKKEVHKRT-DPKNESYFW
SURE_HELPJ       NVFTKGYPLKGRKLLNVNVPNCSL-QEYKGERITPKG-YRLYKKEVHKRT-DPKNESYFW
SURE_CAMJE       NIFDKGFPLEKKEFLNINFPAKS---KIKGIKICKAG-KRVYNFEAHSNV-NPRGVEYYW
SURE_CHLMU       CEFTVSHKHANPLGFNVTFPASSDNSPWKGIRFTLSG-DEFLFGIPRLIR-TEGNRRYYT
SURE_CHLTR       CEFTVAYKHTDPLGLNVNFPASTDDSPWKGIRFTLSG-NEFLFGIPRLVR-TEGNRRYYT
SURE_CHLPN       VIYLLSQPFPCLTGLNINFPTSPGGSSWEGMRLVPPG-DEFFYEEPQYLG-SVNKNQYYV
SURE_BRUME       GRLMEA-GWPEGVLLNLNFPNCAP-EEVKGVRVTAQG-KLSHDARLDERR-DGRGFPYFW
SURE_RHILO       KKLVAT-PLPDGVLLNVNFPNCLP-EEVVGTVVTMQG-KLVHSLWVDERR-DGRGLPYYW
SURE_RHIME       RTLMGV-DLPDGTLINLNFPNCAV-DAVAGVEVTSQG-KLEFGLSIDERT-DGRGFPYFW
SURE_CAUVC       QRLLEV-GWPADVVMNVNFPALPP-ESVKAVEVTRQGFRDGHMRHMDKRT-DLRGRDYYW
SURE_COXBU       QRIEKD-PLPPSTILNINVPDLPY-EELKGFEVTRLGTRHRAEPTIRQI--DPRGHPIYW
SURE_LEGPH       IKLSAN-KLPSQTILNVNVPDLPL-NQIRGLQVTRLGTRHSAEPIIKEY--DPRGRPIYW
SURE_XYLFA       AQLKTD-PLPADTILNVNVPDVTW-QQMRGFKVTRLGNRHRSAPCLTQT--DPRGHTIYW
SURE_ECOLI       RALCKE-PLRTGRILNINVPDLPL-DQIKGIRVTRCGTRHPADQVIPQQ--DPRGNTLYW
SURE_SALTY       RGLSRE-PLRTGRILNVNVPDLPL-AQVKGIRVTRCGSRHPADKVIPQE--DPRGNTLYW
SURE_YERPE       RALQRK-PLRTGKILNINVPDLPL-AEIKGIRVTRCGSRHPAEQVFCQQ--DPRGQDLYW
SURE_HAEIN       PKLQHQ-LLNPREIININVPDLPF-EELKGYKVCRLGYRSSSVEVIKQR--DPRDETIYW
SURE_PASMU       PRLHGQ-ILQRREILNINVPDIPY-EEIKGVKVCHLGYRAAAAEVVKQQ--DPRGEAIYW
SURE_VIBCH       EQHLAN-PIPTNRLLNVNIPDRPL-ELIQGIEVTRLGARHHAESMIKQK--DPRGHDIYW
SURE_PSEAE       SAHERL-AVPPRTVLNVNIPNLPL-DRVRGIQLTRLGHRARAAAPVKVV--NPRGKEGYW
SURE_NEIMA       AHFFKN-PPQSPILWNINIPAVAP-EDVRGIKIARLGRRHHGQNVIPAR--NPRGEQIYW
SURE_NEIMB       AHFFKN-PPQSPILWNINIPAVAP-EDVRGIKIARLGRRHHGQNVIPAR--NPRGEQIYW
SURE_RALSO       ERYLSD-PPAGPVLLNVNIPNLPY-AEVAGWRATRLGKRHQSQPVIRQE--NPRGEPIYW
SURE_RUBGI       EQVLAGGPPTGPWLLNVNIPNRAD-AASLPRLVTRLGRRHASEPVIRQT--NPRGEPIYW
SURE_AQUAE       KKVLNE-GIPEDTYLNVNIPNLRY-EEIKGIKVTRQGKRAYKERVFKYI--DPYGKPFYW
SURE_NOSS1       EQLAAK-PIPDLMLLNVNIPPVEW-EEIAGVKLTRQGVRRYVDVFDKRT--DPRGKTYYW
SURE_SYNY3       QHLWRS-PLTEPTLFSINIPAVPA-EQIAGVRLTRQGLQRYSETFEERY--DPRGKRYYW
SURE_THEMA       KEFDFS-LLDPFTMLNINVPA----GEIKGWRFTRQSRRRWNDYFEERV--SPFGEKYYW
SURE_DEIRA       REVCCR-GLPPRVLLNVNFPRVS---P-RGVRVTEVGLHRWEDSVVTRQ--DPEGRDYHW
SURE_ARCFU       EIVLYKGLPEGVDLLNVNVPAKP----NGKIAVTRLARRMYRVSVEKRL--DPRGREYYW
SURE_METTH       SRILRRGLPEGVDFLNLNVPSHPA---SDEIRITRLGDRMYNVHIKKRL--DPRGRPYYW
SURE_METJA       EKYLDYDMP--CDVLNINIPENAT--LETPIEITRLARKMYTTHVEERI--DPRGRSYYW
SURE_HALSA       HDAVTDGIFDTADYLNVNAPHPDA--DATGEMVVTRPSHAYDMTAAQTGD-TVTLYDRLW
SURE1_PYRAE      SYVLKNGMPQGVDVISVNFPRRLG--RGVRAKLVKAAKLRYAQQVVERV--DPRGVRYYW
SURE2_PYRAE      ASARAG--LDGVLAVSINIPSVWK----GGVYCVRKLARAVYRERLYEGV-DPRGEKYYW
SURE_AERPE       VETSVETLSSSAGLMVVNIPRSP-----RGFKVTRPCRRVPRFSGEIGEEGSLLVEKFDH
                                 :. *                                        

SURE_HELPY       LGLHPLEWQKRENEDRL-----SDFDAIASNHASI-TPLN-----LDLTSYDDLKSLESW
SURE_HELPJ       LGLHPLKWQKRENEDRL-----SDFDAIASNHASI-TPLN-----LDLTSYDDLKSLESW
SURE_CAMJE       LAAANLDFEDEKN---------SDIALLKKGYATI-TPIM-----LDLTAYERMKKVKKW
SURE_CHLMU       LYDMQDKVSEDLS---------DEYLALANNYITA-VPLISKNTPLATLSEEELAFLKES
SURE_CHLTR       LYDMRDKVSEEFS---------EEYLALANNYISA-APLVSKNTPRATLSEEELAFLKDS
SURE_CHLPN       GKISGVRIGEHPS---------EELACMLENHISV-SPIFSQNSPIGLMTLEEFQKTQEN
SURE_BRUME       LHFGRGKAPVADD---------SDIAAIRSGCISV-TPLH-----LDLTAHKVRAEL--G
SURE_RHILO       LRFGREPVEGKQG---------TDLHALRNRLVSV-TPLQ-----LDLTAHEIRDQL--S
SURE_RHIME       LRFGERAGDFRSG---------TDIRALRDNRISV-TPLK-----LDMTDHAAQERI--A
SURE_CAUVC       MGFTAKASQPAEG---------TDLRAVYEGRISV-TPLH-----IDLTHNETVHTL--K
SURE_COXBU       VGAAGPEQDSGPG---------TDFFAMNHHCVSI-TPLR-----VDLTHYEAFDQL--A
SURE_LEGPH       VGPPGIEADAGAG---------TDFFAIKTGHVSI-TPLH-----LDMTHYKLFDHL--S
SURE_XYLFA       IGPAGPEQDAGPG---------TDFDAVRNTYISI-TPIH-----VDLTRYQALENV--T
SURE_ECOLI       IGPPGGKCDAGPG---------TDFAAVDEGYVSI-TPLH-----VDLTAHSAQDVV--S
SURE_SALTY       IGPPGDKYDAGPD---------TDFAAVDEGYVSV-TPLH-----VDLTAHSAHDVV--S
SURE_YERPE       IGPPGEKYDAGPD---------TDFAAVEQGYVSI-TPLQ-----VDLTAYMAQEVV--E
SURE_HAEIN       IGPSALPEDESEG---------TDFYAVKNGYVSI-TPIQ-----ADLTAYHSLLSL--Q
SURE_PASMU       VGPAGLAENEQEG---------TDFHAVKNGYVAI-TPIQ-----ADMTAYHSLQSL--Q
SURE_VIBCH       LGPPGKEQDAGPG---------TDFHAIERGWVSL-TPLQ-----VDLTAHESLRSM--D
SURE_PSEAE       IAAAGDAEDGGPG---------TDFHAVMQGYVSI-TPLQ-----LDRTFHEAFGGL--D
SURE_NEIMA       IGPVGEVSDREEG---------TDFGECEAGFITV-TPLQ-----IDLTAYRDMAET--A
SURE_NEIMB       IGPVGEVSDREEG---------TDFGECGAGFITV-TPLQ-----IDLTAYPDMAET--A
SURE_RALSO       VGAAGDAKDASEG---------TDFHAVAHGFVSL-TPLQ-----LDLTDTAQLRS---V
SURE_RUBGI       IGPAGDARDAGEG---------TDFHAVAHGAVSI-TPLQ-----VDLTDHAMRGAW--A
SURE_AQUAE       IAAEEFGWHAEEG---------TDYWAVLNGYVSV-TPLH-----LDLTNYKVMKSI--K
SURE_NOSS1       LTGEVLEEVEPPEGLNLPQNVPIDVHVVRNNYISI-TPLQ-----YNLTYATGIDKL--S
SURE_SYNY3       LAGERVKEIPQPDYLRLNRRIPTDVQASQDNFITI-TPLQ-----YNLTDINGVNIIEKT
SURE_THEMA       MMGEVIEDDDRDD---------VDYKAVREGYVSI-TPIH-----PFLTNEQCLKKL--R
SURE_DEIRA       VAGVSTAHDGHDE--------QTDYGAVQAGFISV-SPVR-----LDLTARDLIGEL--T
SURE_ARCFU       IYGEETED-AEEG---------TDIHALRQGYVSI-TPLK-----IDLTASVEFDIVEGW
SURE_METTH       IDGDP------AG---------TDFRVQMSTHLRLKTPPP-----SPPYHSTAQQALTQW
SURE_METJA       IDGYPIFE-EEED---------TDVYVLRKKRHISITPLT-----LDTTIKNLDEFKEKY
SURE_HALSA       EAMAAGDIHDPDG---------TDRRAVLDGHVSV-SPLT------APHSTEHHDALDGI
SURE1_PYRAE      LYGRDLAPEPETD----------VYVVLKEGGIAI-TPLTLNLNAVDAHREVDMDSLNRM
SURE2_PYRAE      RWGPRRSEFEPDT---------DAYYFYYMRGVTVLGLSE-----SGVASVENFGRKLGQ
SURE_AERPE       SRLFSSEHDSCDGRLFSMGYIPVSLYKIDNGWIHPLDPSR------DGYLKAVEDILNYK
                                                                             

SURE_HELPY       HEGMLK------------
SURE_HELPJ       HEGMLK------------
SURE_CAMJE       LKANDE------------
SURE_CHLMU       FEQSVQWDSSLNFEEDLA
SURE_CHLTR       FEQSVLWKASLNLEEDLA
SURE_CHLPN       FNASLL---SSELTTKIF
SURE_BRUME       AALGVEA-----------
SURE_RHILO       KALA--------------
SURE_RHIME       QALREGSVA---------
SURE_CAUVC       GVLGGAPPRKVGA-----
SURE_COXBU       SWVKRLEM----------
SURE_LEGPH       NLLNEICIEN--------
SURE_XYLFA       RWTDRLTAHMDWPT----
SURE_ECOLI       DWLNSVGVGTQW------
SURE_SALTY       DWLDSVGVGTQW------
SURE_YERPE       SWLANTEVDGEW------
SURE_HAEIN       NWLDQEFTK---------
SURE_PASMU       DWLESE------------
SURE_VIBCH       HWLKEKVNG---------
SURE_PSEAE       EWLGGLT-----------
SURE_NEIMA       VFWHTD------------
SURE_NEIMB       AFWHAD------------
SURE_RALSO       RRWQTP------------
SURE_RUBGI       SRLGVPLA----------
SURE_AQUAE       YLEDSP------------
SURE_NOSS1       DWDFPLS-----------
SURE_SYNY3       NWLDHLNFD---------
SURE_THEMA       EVYD--------------
SURE_DEIRA       QALPPL------------
SURE_ARCFU       FDGLEWEV----------
SURE_METTH       RAGLIRARN---------
SURE_METJA       GKILCEM-----------
SURE_HALSA       ATEF--------------
SURE1_PYRAE      VEYINASL----------
SURE2_PYRAE      LIGAVKVDC---------
SURE_AERPE       IFPSAGKQF---------