CLUSTAL format seed alignment for MF_00063

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CYSH_ECOL6       ---------MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLPG-----
CYSH_ECOL5       ---------MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLPG-----
CYSH_ECO57       ---------MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLPG-----
CYSH_SHIBS       ---------MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPG-----
CYSH_SHISS       ---------MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPG-----
CYSH_ECOHS       ---------MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPG-----
CYSH_ECO24       ---------MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPG-----
CYSH_SHIFL       ---------MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPG-----
CYSH_SHIF8       ---------MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPG-----
CYSH_ECOLI       ---------MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPG-----
CYSH_SHIDS       ---------MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLPG-----
CYSH_ECOUT       ---------MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLPG-----
CYSH_ECOK1       ---------MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLPG-----
CYSH_ENT38       ---------MSLLDLNALNDLPKVERILALAETNAKLEKLDAEGRVAWALENLPG-----
CYSH_KLEP7       ---------MSVLDLNALNALPKVERILALAETNAQLEKLDAEGRVAWALENLPG-----
CYSH_CITK8       ---------MSVLDLNALNELPKVERVMALAETNAQLEKQDAEGRVAWALENLPG-----
CYSH_SALCH       ---------MSQLDLNALNELPKVDRVLALAEINAQLETLSAEERVAWALENLPG-----
CYSH_SALTY       ---------MSQLDLNALNELPKVDRVMALAETNAQLEKLSAEERVAWALENLPG-----
CYSH_SALPA       ---------MSQLDLNALNELPKVDRVLALAETNAQLETLTAEERVAWALENLPG-----
CYSH_SALTI       ---------MSQLDLNALNELPKVDRVLALAETNAQLETLTAEERVAWALENLPG-----
CYSH_CROS8       ---------MSVLDLHALNALEKDARAGALADTNAQLEALSAEARVSWALENLPG-----
CYSH_PECAS       ---------MAEFNLEALNALPKDEQVAALAAVNGQLEQLSAQERVSWALENLPG-----
CYSH_BAUCH       ---------MKVLDLRELNAMDKSQQTEAMTTVNLQLENMTAEHRVSWALEHLPQ-----
CYSH_PHOLL       ---------MSQFSLSQCVSMTAEQQEQSLAEINLRLEMMDAHQRVNWALENLPG-----
CYSH_YERPS       ---------MSQFNLSELNALPKAKQAAALVLVNGQLEHLTAQERVSWALDNLPG-----
CYSH_YERP3       ---------MSQFNLSELNALPKAKQAAALVLVNGQLEHLTAQERVSWALDNLPG-----
CYSH_YERE8       ---------MSQFNLNELNALPKAEQAAALALVNGQLEHLTAQERVSWALENLPG-----
CYSH_SODGM       ---------MSDWDLGELNALEKAQQTAALAAVNQQLESQTAEQRVAWALEHLPE-----
CYSH_SERP5       ---------MAEFNLAELNALPKSGQALSLAVVNGQLETLSAEQRVEWALEHLPG-----
CYSH_ZYMMO       ---------MSAFHLETLKSLPKAEQEAALSEANRQLEEMSAEDRLKWAFDNLSG-----
CYSH_BUCAI       ---------MSKFYIENINLLNSEKKNNILSELNLLLSNYSAEERISWALSHLPH-----
CYSH_VIBCH       ----MPNRTV--PTLEELLTLNKVQQTLRLTEVNQHLESLTAQERVVWGLENLQG-----
CYSH_VIBC3       ----MPNRTV--PTLEELLTLNKVQQTLRLTEVNQHLESLTAQERVVWGLENLQG-----
CYSH_ALIF1       ----MPKL-----QLSELLSLTKVEQTLRLAEVNVELEKLTAQERVVWALENLEG-----
CYSH_VIBCB       ----MLDSVASKPELAELLTLTKTEQILRLAQINVELEQLSAQERVKWALENLEG-----
CYSH_VIBPA       ----MLDSVASKPELAELLTLTKTEQILRLAQINVELEPLSAQERVKWALENLDG-----
CYSH_VIBVU       ----MLDSVASTLQLSELLSLTKAEQSIRLAEINVELEMLSAQERVAWALQNLEG-----
CYSH_VIBVY       ----MLDSVASTLQLSELLSLTKAEQSIRLAEINVELEMLSAQERVAWALQNLEG-----
CYSH_PHOPR       ---------MPNYALADLLEKTKIEQILQLAEINAELEALSAQERVRWALANLGS-----
CYSH_SHEON       ---------MSSSELKALLTAPKSVQQAELERINRFLAGLTAQERVLWGLAYLPG-----
CYSH_THIRO       ---------MSKPDLDAFLHGDDA----ALRETNRRLESMPAEDRVRWALEHLPP-----
CYSH_XANAC       ---------MTALPAASITSSAFDD----LDALNAQLEGLRADQRVAWALQHGPQ-----
CYSH_XANC5       ---------MTALPAASITSSAFDD----LDALNAQLEGLHADQRVAWALQHGPQ-----
CYSH_XANOM       ---------MTALPAASITSSALDD----LDALNAQLEGLRADERVAWALQHGPQ-----
CYSH_XANCP       ---------MTALPATSIAAPSLDD----LDALNAHLETLRADERVAWALQHGPQ-----
CYSH_XANC8       ---------MTALPATSIAAPSLDD----LDALNAHLETLRADERVAWALQHGPQ-----
CYSH_XYLFA       ---------MTVLPAL----PPLDD----LETLNVHLETLSAENRVCWALERGPD-----
CYSH_XYLFT       ---------MTVLPAL----PPLDD----LETLNVHLETLSAENRVCWALEHGPD-----
CYSH_SYNP6       --------------------MPALLP--SLTEINAQLADQAATQIIQWAATEFGS-----
CYSH_SYNE7       --------------------MPALLP--SLTEINAQLADQAATQIIQWAATEFGS-----
CYSH_SYNY3       --------------------MSHTLTKLDLPTLQTELENATAQQIITWAAQTFGP-----
CYSH_AGRFC       -----------MEIPDVTMTINSTNASADTASLDATLAGLDLAGRLSFVAGLGGR-----
CYSH_RHIME       ------MTTQSLKAEAVALEADVMALDAEAKALNDKLESLDLAGRLALIAGLEGR-----
CYSH_NEIMA       -----------MKIFKPALWKIPPIENGSETALAEKTETLKQ--RLHRIAGSHRD-----
CYSH_NEIMB       ---------METTLFKPALWQIPHIGSGGETALAEKTETLKQ--RLHRIVGSHRD-----
CYSH_PSEAE       MLPFATIPATERNSAAQHQDPSPMSQPFDLPALASSLADKSPQDILKAAFEHFGD-----
CYSH_PSEAB       MPPFATIPATERNSAAQHQDPSPMSQPFDLPALASSLADKSPQDILKAAFEHFGD-----
CYSH_BACVZ       -----------------MLTYDTWE-EPA-ITFPEDDSYKGALSVLKWAYGHYGD-----
CYSH1_BACSU      -----------------MLTYDNWE-EPT-ITFPEDDPYKGALSVLKWAYGHYGD-----
CYSH_BACP2       -----------------MLTYENWQ-EPS-ITFQEDDLYKGALSVLKWAYGHYGD-----
CYSH_GEOKA       -----------------MLTYDQWE-KAEKPSFPSDNETKGALDVLAWAYREYGD-----
CYSH_GEOTN       -----------------MLTYDRWE-TVEKPSFPSDNETKGALDVLAWAYREYGD-----
CYSH_STAES       -------------MSIERITYDNFQNDPFINELDINDETKGAYEILKWAYQTYEN-----
CYSH_STAEQ       -------------MSIERITYDNFQNDPFINELDINDETKGAYEILKWAYQTYEN-----
CYSH_STAHJ       -------------MSVPTITYENFEGDPFIDSISTDDATKGAYEILEWAYRTYGD-----
CYSH_STAS1       -------------MSETKITYDDFNPHAF-ETLDITDETKGAREVIRWAYDVYGD-----
CYSH_OCEIH       -------------MGGYSVTYSNFVKDPYKDWFP-DDETNGASKILQWAYEVYGT-----
CYSH_BACC1       -----------------MLTYETWEENDV--SFSEEDETKGALSVLSWAYKEYKS-----
CYSH_BACAH       -----------------MLTYETWEENDV--SFSEEDETKGALSVLSWAYKEYKS-----
CYSH_BACCZ       -----------------MLTYETWEENNV--SFSEEDETKGALSVLSWAYKEYEG-----
CYSH_BACHK       -----------------MLTYETWEENDI--SFSEEDETKGALSVLSWAYKEYEN-----
CYSH_BACAN       -----------------MLTYETWEEN----------ETKGALSVLSWAYKEYKS-----
CYSH_BACCR       -----------------MLTYETWEENVV--SFSEEDETKGALSVLNWAYKEYKD-----
CYSH_BACHD       --------------MDQSIQVNI-----NEVNQALERK--DSLDVIKWAYKTYGD-----
CYSH2_BACSU      --------------MNETITYDTWN---DMLSKQITDQLIDELDVLKWAYRTYGE-----
CYSH_MYCBO       -------------MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAG
CYSH_MYCBP       -------------MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAG
CYSH_MYCTU       -------------MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAG
CYSH_MYCTA       -------------MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAG
CYSH_DEIRA       ----------MMTAEVRTPEQGGGPLTTEPRAPRSAPGHADASAPAFGPETDPRDIIR--
CYSH_RHILO       -----------MLAKPRPLDHIGDADDGVAAKAAGLDALYGHLKPLEIIERSARELF---
                                                                             

CYSH_ECOL6       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ECOL5       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ECO57       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_SHIBS       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_SHISS       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ECOHS       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ECO24       ----------EYVLSSSFGIQAAVSLHLVNQIHPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_SHIFL       ----------EYVLSSSFGIQAAVSLHLVNQIHPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_SHIF8       ----------EYVLSSSFGIQAAVSLHLVNQIHPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ECOLI       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_SHIDS       ----------EYVLSSSFGIQAAVSLHLVNQICPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ECOUT       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ECOK1       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK
CYSH_ENT38       ----------EYALSSSFGIQAAVSLHLVNTIRPDIPVILTDTGYLFPETYQFIDELADK
CYSH_KLEP7       ----------NYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDK
CYSH_CITK8       ----------EYVLSSSFGIQAAVSLHLVNQVRPDIPVILTDTGYLFPETYQFIDELTEK
CYSH_SALCH       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDK
CYSH_SALTY       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDK
CYSH_SALPA       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPEAYQFIDELTDK
CYSH_SALTI       ----------EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDK
CYSH_CROS8       ----------EFVLSSSFGIQAAVCLHLVTQQRPDIPVILTDTGYLFPETYRFIDELTEK
CYSH_PECAS       ----------DFVLSSSFGIQAAISLHLVTQQRPDIPVILTDTGYLFPETYQFIDALTEQ
CYSH_BAUCH       ----------PAVLSSSFGIQAAVSLHLVTSQQPNIPVILTDTGYLFPETYQFIDQLTEQ
CYSH_PHOLL       ----------EFVLSSSFGIQAAVCLHLVTQEYPDIPVILTDTGYLFPETYQFIDKLTTQ
CYSH_YERPS       ----------EFVLSSSFGIQAAVCLHLVTRQRPDIPVILTDTGYLFPETYRFIDDLTEK
CYSH_YERP3       ----------EFVLSSSFGIQAAVCLHLVTRQRPDIPVILTDTGYLFPETYRFIDDLTEK
CYSH_YERE8       ----------EFVLSSSFGIQAAVCLHLVTRQQPDIPVILTDTGYLFPETYQFIDSLTEK
CYSH_SODGM       ----------QAVLSSSFGIQAAVSLRLVTRQRPDIPVILTDTGYLFPETYRFIDELTET
CYSH_SERP5       ----------EFVLSSSFGIQAAVCLHLVTRIKPDIPVILTDTGYLFPETYQFIDQLADK
CYSH_ZYMMO       ----------QFVLSSSFGIQAAVMLHLVTRKKADIPVILTDTGYLFPETYRFIDALTEK
CYSH_BUCAI       ----------TQIMSSSFGIQSTVLLHLIIKKKPDIPVILIDTGYLFPETYNFIDFLTNK
CYSH_VIBCH       ----------NHALSSSFGIQAAVMLHLLTSVKSDIPVVLTDTGYLFPETYQFIDELTER
CYSH_VIBC3       ----------NHALSSSFGIQAAVMLHLLTSVKSDIPVVLTDTGYLFPETYQFIDELTER
CYSH_ALIF1       ----------NPALSSSFGIQAAVMLQLVTEVKSDTPIILTDTGYLFPETYQFIDQLTDR
CYSH_VIBCB       ----------EFAVSSSFGIQAAVMLHLVTQQKPDIPIILTDTGYLFAETYQFIDQLKAQ
CYSH_VIBPA       ----------EFAVSSSFGIQAAVMLHLVTQEKPDIPIILTDTGYLFAETYRFIDELTEK
CYSH_VIBVU       ----------AHAVSSSFGIQAAVMLHLVSKQQADIPVILTDTGYLFPETYQFIDELTKS
CYSH_VIBVY       ----------AHAVSSSFGIQAAVMLHLLSKQQADIPVILTDTGYLFPETYQFIDELTKS
CYSH_PHOPR       ----------EFALASSFGIQSAVMLHLVTNESPKVPVILTDTGYLFPETYQFIDQLTLR
CYSH_SHEON       ----------NHALSSSFGIQAAVMLHMVSQVQSDIPVILTDTGYLFPETYQFIDQLTER
CYSH_THIRO       ----------QHVLSSSFGTQSAVMLHLVSRQMPEIPVILVDTGYLFPETYRLVDALTDR
CYSH_XANAC       ----------NAALSSSFGAQSAVTLHLLSQQRPDIPVILIDTGYLFPETYRFADALTER
CYSH_XANC5       ----------NAALSSSFGAQSAVTLHLLSQQRPDIPVILIDTGYLFPETYRFADALTER
CYSH_XANOM       ----------DAALSSSFGAQSAVTLHLLSQQRPDIPVILIDTGYLFPETYRFADALTER
CYSH_XANCP       ----------QAALSSSFGAQSAVTLHLLTQQRPDIPVILIDTGYLFPETYRFADALTER
CYSH_XANC8       ----------QAALSSSFGAQSAVTLHLLTQQRPDIPVILIDTGYLFPETYRFADALTER
CYSH_XYLFA       ----------HPALSSSFGAQSAVMLHLLTRFAPDIPVILVDTGYLFPETYRFADTLTER
CYSH_XYLFT       ----------HPALSSSFGAQSAVMLHLLTRFAPDITVILVDTGYLFPETYRFADTLTER
CYSH_SYNP6       ----------GLVLSTSFGIQSAVMLHLATQVQPDIPVIWIDTGYLPTETYRFAAELTER
CYSH_SYNE7       ----------GLVLSTSFGIQSAVMLHLATQVQPDIPVIWIDTGYLPTETYRFAAELTER
CYSH_SYNY3       ----------GLVMSTSFGIQAAVMLHLVTSIVPNIPVIWIDTGYLPLETYQFADQLTGR
CYSH_AGRFC       -----------AVFTTSLGIEDQVITAAIGTHRLPIDVVTLETGRLFKETVDLIDETEER
CYSH_RHIME       -----------AVFTTSLGIEDQVITAAIGSNRLDIEVATLKTGRLFNETVALIDQTEET
CYSH_NEIMA       -----------ARFASSLAAEDMVITDLIAGENLNIGIFTLDTGLLHAETLNLLDRIERV
CYSH_NEIMB       -----------ARFASSLAAEDMVITDLIAGENLNIGIFTLDTGLLHTETLNLLDRLGRA
CYSH_PSEAE       -----------ELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREH
CYSH_PSEAB       -----------ELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREH
CYSH_BACVZ       ----------QLVYACSFGIEGIVLIDLISKVKKDAEIVFLDTGLHFKETYETIEKVKER
CYSH1_BACSU      ----------QLVYACSFGIEGIVLIDLIYKVKKDAEIVFLDTGLHFKETYETIERVKER
CYSH_BACP2       ----------QLVYACSFGIEGIVLIDLIAKVKKDARIVFLDTGLHFKETYDTIDAVKER
CYSH_GEOKA       ----------EIVYACSFGIEGIVLIDLISQVKPDAEIVFLDTGLHFPETYDTIAKVKEK
CYSH_GEOTN       ----------EIVYACSFGIEGIVLIDLISQVKPDAEIVFLDTGLHFQETYDTIAKVKET
CYSH_STAES       ----------DIVYSCSFGAESMVLIDLISQIKPDAQIVFLDTDLHFQETYDLIDRVKDK
CYSH_STAEQ       ----------DIVYSCSFGAESMVLIDLISQIKPDAQIVFLDTDLHFQETYDLIDRVKDK
CYSH_STAHJ       ----------SIVYSCSFGAESMVLIDLIYQIKPDAQIVFLDTDLHFQETYDLIDRVKEH
CYSH_STAS1       ----------SIIYSCSFGAEGMILIDLISSVKKDAEIVFLDTNLHFQETYDLIDRVKAR
CYSH_OCEIH       ----------DIVYACSFGAEGMVLIDLISKTQKNADIVFLDTDLHFQETYDLIEDIKVK
CYSH_BACC1       ----------EIVYACSFGVEGMVLLHLINQVNPSAKVVFLDTNVHFQETYELIQKVRER
CYSH_BACAH       ----------EIVYACSFGVEGMVLLHLINQVNPSAKVVFLDTNVHFQETYELIQKVRER
CYSH_BACCZ       ----------EIVYACSFGVEGMVLLHLINQVNPSAKVVFLDTNVHFQETYELIQKVRER
CYSH_BACHK       ----------EIVYACSFGVEGMVLLHLINQVNPSAKVVFLDTNVHFQETYELIQKVRER
CYSH_BACAN       ----------EIVYACSFGVEGMVLLDLINQVNPSAKVVFLDTNVHFQETYELIQKVRER
CYSH_BACCR       ----------EVVYACSFGVEGMVLLHIINQVNPSAKVVFLDTNVHFQETYELIRKVRER
CYSH_BACHD       ----------KLVYACSMGAEGMVLIDLISKVRPDAPVIFLDTDFHFSETYELIERVKER
CYSH2_BACSU      ----------KIVYACSFGAEGMVLLDLISKINKNAHIIFLDTGLHFQETYELIETVKER
CYSH_MYCBO       GGVSGHRGWTTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESV
CYSH_MYCBP       GGVSGHRGWTTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESV
CYSH_MYCTU       GGVSGHRGWTTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESV
CYSH_MYCTA       GGVSGHRGWTTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESV
CYSH_DEIRA       ---WALAAHPDLLMPSAFNLNGVVLLDLAAQAGYRGEVVFVDTGYHFPETLATRDRLESR
CYSH_RHILO       --------HDEIAAVSSFGADSAVLLHMIAEIDRTLPVIFLDTGKHFEETLGYRDALVAD
                                        :             :   .*.    *:          

CYSH_ECOL6       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_ECOL5       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_ECO57       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_SHIBS       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_SHISS       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_ECOHS       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_ECO24       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_SHIFL       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_SHIF8       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_ECOLI       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_SHIDS       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_ECOUT       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNVQTWF
CYSH_ECOK1       LKLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNVQTWF
CYSH_ENT38       LKLNLKVYRAEQ--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALEELNVKTWF
CYSH_KLEP7       LKLNLKVYRAAE--SAAWQEARYGKLWEQ-GVEGIEKYNEINKVEPMNRALKELNAQTWF
CYSH_CITK8       LNLNLKVYRATE--SAAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_SALCH       LKLNLKVYRAGE--SPAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELKAQTWF
CYSH_SALTY       LKLNLKVYRAGE--SPAWQEARYGKLWEQ-GVEGIEKYNEINKVEPMNRALKELKAQTWF
CYSH_SALPA       LKLNLKVYRAGE--SPAWQEARYGKLWEQ-GVEGIEKYNEINKVEPMNRALKELNAQTWF
CYSH_SALTI       LKLNLKVYRAGE--SPAWQEARYGKLWEQ-GVEGIEKYNEINKVEPMNRALKELNAQTWF
CYSH_CROS8       LNLNLKIYRAEQ--SPAWQEARYGKLWEQ-GVEGIEKYNDINKVEPMNRALKELNAQTWF
CYSH_PECAS       LKLNLHVYRAAE--SPAWQESRYGKLWDQ-GVEGIERYNLLNKVEPMNRALSELNAGTWF
CYSH_BAUCH       LKLNLKVFRAYI--SPAWQEARYGKLWEQ-GIKGIQLYNKINKVEPMNRALIQLGSLTWF
CYSH_PHOLL       LKLNLQVFSAEH--SPAWQEARYGKLWEQ-GVEGIERYNQINKVEPMNRALKNLRAQSWF
CYSH_YERPS       LQLNLQVFRAAH--SPAWQEARYGKLWEQ-GVEGIERYNTLNKVEPMNRALEALGAQTWF
CYSH_YERP3       LQLNLQVFRAAH--SPAWQEARYGKLWEQ-GVEGIERYNTLNKVEPMNRALEALGAQTWF
CYSH_YERE8       LQLNLQVFRAQQ--SPAWQEARYGKLWEQ-GVEGIERYNDLNKVEPMNRALETLGAQTWF
CYSH_SODGM       LGLNLQIFRATT--SPAWQEARYGKLWEQ-GVEGIERYNQLNKVEPMNRALATLGAGTWF
CYSH_SERP5       LKLNLQVFRAEQ--SPAWQEARYGKLWEQ-GVEGIEKYNQINKVEPMNRALETLGGQTWF
CYSH_ZYMMO       LDLNLQVFRAAL--SPAWQEARYGKLWEQ-GVEGIERYNDINKVEPMNRALKTLEAGTWF
CYSH_BUCAI       FHLNLKVFRSTI--SSAWQEARYGKLWEK-GIEGIDFYNNINKVQPMNFALNELSVQTWF
CYSH_VIBCH       LNLNLKVYSAPV--SAAWQEARYGKLWEQ-GVEGIERYNQINKVEPMRRALDELNIGTWF
CYSH_VIBC3       LNLNLKVYSAPV--SAAWQEARYGKLWEQ-GVEGIERYNQINKVEPMRRALDELNIGTWF
CYSH_ALIF1       LNLNLHVFTADE--SPNWQEARYGKLWEQ-GVEGIEKYNKLNKVQPMRRALDQLEIGVWF
CYSH_VIBCB       LNLNLKVYRAKE--SANWQEARYGKLWEQ-GIEGIEKYNKINKVEPMRRALREQNVGTWF
CYSH_VIBPA       LNLNLKVYRAEQ--SAQWQEARYGKLWEQ-GVEGIEKYNKINKVEPMRRALKELNVGTWF
CYSH_VIBVU       LNLNLKVYRANE--SANWQEARYGKLWEQ-GIEGIEKYNKLNKVEPMRRALNELNVKTWF
CYSH_VIBVY       LNLNLKVYRANE--SANWQEARYGKLWEQ-GIEGIEKYNKLNKVEPMRRALNELNVKTWF
CYSH_PHOPR       LSLNLYVYRAEI--SSAWQEARHGKLWEQ-GVDGIKQYNRLNKVEPMRRALDELNVSAWF
CYSH_SHEON       LSLNLKVYQAPI--TSAWQEARFGQLWEQ-GVEGLERYNRLNKVEPMQRALAELEVGTWF
CYSH_THIRO       FGLNLKVYRPAL--SPAWQEAGLGRLWEQ-GADGIERYNRLNKIDPMERALRDLDAGTWF
CYSH_XANAC       LKLNLKVYRPLV--SRAWMEARHGRLWEQ-GMVGIDQYNNLRKVEPMRRALNELDVGTWF
CYSH_XANC5       LKLNLKVYRPLV--SRAWMEARHGRLWEQ-GMVGIDQYNNLRKVEPMRRALDELEVGTWF
CYSH_XANOM       LKLNLKVYRPLV--SRAWMEARHGRLWEQ-GMVGIDQYNNLRKVEPMRRALDELNVGTWF
CYSH_XANCP       LSLNLQVYRPLV--SRAWMEARHGRLWEQ-GMVGIDQYNNLRKVEPMRRALDELNVGTWF
CYSH_XANC8       LSLNLQVYRPLV--SRAWMEARHGRLWEQ-GMVGIDQYNNLRKVEPMRRALDELNVGTWF
CYSH_XYLFA       LKLNLKVYQPLR--SGAWTEARHGRLWEQ-GIDGINQYNTLHKVEPMRRALEELQVGTWF
CYSH_XYLFT       LKLNLKVYQPLR--SGAWTEARHGRLWEQ-GIDGINQYNTLHKVEPMRRALEELQVGTWF
CYSH_SYNP6       LKLNLKVYQSEI--SPARMEALYGRLWESESVEDFNRYDQMRKVEPMNRALQELGATAWL
CYSH_SYNE7       LKLNLKVYQSEI--SPARMEALYGRLWESESVEDFNRYDQMRKVEPMNRALQELGATAWL
CYSH_SYNY3       LQLNLKVYQSPL--SPARMEALYGKLWQQKDVESLNRYDQIRKVEPMQRALKELEAIAWL
CYSH_AGRFC       F-GIEIRRFRPEQDDIDAYAAKYGLNGFYESVEARHACCHVRKLIPLGKALEGA--AFWI
CYSH_RHIME       Y-DILIKRYYPEKADIDAYVAQYGMNGFYESVEARHACCGVRKLKPLARALDGA--SYWI
CYSH_NEIMA       YPHMQIKRFQPIREDALHYVESKGRFAFYDSVEARRECCRIRKTEPLDRAIAGA--DAWL
CYSH_NEIMB       YPHLRIKRFRPVREDADRYVESKGRFAFYDSVEARRECCRIRKTEPLNRAIAGA--DAWL
CYSH_PSEAE       Y-GIAIDVLSPDPRLLEPLVKEKGLFSFYR--DGHGECCGIRKIEPLKRKLAGV--RAWA
CYSH_PSEAB       Y-GIAIDVLSPDPRLLEPLVKEKGLFSFYR--DGHGECCGIRKIEPLKRKLAGV--RAWA
CYSH_BACVZ       YPGLNIILKKPS----LTLEEQAEAHGDKLWEREPNQCCYIRKILPLREALAGH--PAWL
CYSH1_BACSU      YPGLNIILKKPD----LTLEEQAEEHGDKLWEREPNQCCYLRKVVPLREALSGH--PAWL
CYSH_BACP2       YPGLDIVLKTPE----LTVEEQNDQHGDQLWKTDPQSCCHMRKVIPLQEALSGY--PAWL
CYSH_GEOKA       YPSLRIVMKQPR----LTLEEQKAQFGDELWKRDPNKCCELRKVIPLREVLTGV--TAWI
CYSH_GEOTN       YPSLRIIMKQPH----LTLEEQAAQFGDELWKRDPNKCCELRKVIPLREVLTGV--TAWI
CYSH_STAES       YPQLRIKMKKPE----LTLEEQGEKYNPALWKNDPNQCCYIRKIKPLEDVLSGA--VAWI
CYSH_STAEQ       YPQLRIKMKKPE----LTLEEQGEKYNPALWKNDPNQCCYIRKIKPLEDVLSGA--VAWI
CYSH_STAHJ       FPKLRIEMKKPD----LTLEEQADKYNPALWKNNPNQCCYIRKIKPLEEVLGGA--VAWV
CYSH_STAS1       YPELNIKLKQPS----LTLEEQADQVAPALWKQDPNQCCYIRKIKPLEEVLSGA--TAWV
CYSH_OCEIH       YPTLNIHIKKPD----LTLEEQAAEHGSALWKRQPDQCCYIRKIKPLEDALSGA--PAWI
CYSH_BACC1       FPSLNIIEKQPE----LTLDEQANLHGDKLWESNPNLCCKIRKILPLEESLANE--KAWI
CYSH_BACAH       FPSLNIIEKQPK----LTLDEQDKLHGDKLWESNPNLCCKIRKILPLEESLANE--KAWI
CYSH_BACCZ       FPSLNIIEKQPK----LTLDEQAKLHGNKLWESNPNLCCKIRKILPLEESLANE--KAWI
CYSH_BACHK       FPSLNIIEKQPK----LTLDEQAKLHGNKLWESNPNLCCKIRKILPLEESLANE--KAWI
CYSH_BACAN       FPSLNIIEKQPK----LTLDEQDKLHGDKLWESNPNLCCKIRKILPLEESLANE--KAWI
CYSH_BACCR       FPSLNIIEKQPE----LTLDEQAKLHGEKLWESNPNLCCKIRKILPLEKSLVVE--KAWI
CYSH_BACHD       YPKLQLKLVKPE----LTPEEQAETYGDRLWERQPDLCCKLRKLVPLEKELAQY--DAWM
CYSH2_BACSU      YPGFAIQMLEPE----LSLTEQGTKYGGELWKHNPNLCCQLRKIEPLKKHLSGM--TAWI
CYSH_MYCBO       Y-DVRVLNVTPE----HTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGY--SAWV
CYSH_MYCBP       Y-DVRVLNVTPE----HTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGY--SAWV
CYSH_MYCTU       Y-DVRVLNVTPE----HTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGY--SAWV
CYSH_MYCTA       Y-DVRVLNVTPE----HTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGY--SAWV
CYSH_DEIRA       YPELTFVTLNAG------ASPDDGQTPPDLYASDPDACCAARKVDPLQRYLKEQGPSALL
CYSH_RHILO       FGLTNIQVIKPEE-----AALARIDPTGNLHQSNTDACCDVRKVEPLARGVAPF--RAWF
                                                          .*  *:   :         

CYSH_ECOL6       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ECOL5       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ECO57       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKNGLKYHPLW
CYSH_SHIBS       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_SHISS       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ECOHS       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ECO24       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_SHIFL       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_SHIF8       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ECOLI       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_SHIDS       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ECOUT       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ECOK1       AGLRREQS-GSRANLPVLAIQ-------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLW
CYSH_ENT38       AGLRREQS-GSRASLPVLGIQ-------RGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_KLEP7       AGLRREQS-GSRATLPVLAVQ-------RGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_CITK8       AGLRREQS-GSRAHLPVLAIQ-------RGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_SALCH       AGLRREQS-GSRAHLPVLATQ-------RGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_SALTY       AGLRREQS-GSRAHLPVLAIQ-------RGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_SALPA       AGLRREQS-GSRAHLPVLAIQ-------RGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_SALTI       AGLRREQS-GSRAHLPVLAIQ-------RGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_CROS8       AGLRRDQS-GSRANLPVLGVQ-------RGVFKILPIIDWDNRTVYQYLQKHGLKYHPLW
CYSH_PECAS       AGLRREQS-GSRGELPVLAIQ-------RGVFKFLPIIDWDNRTVYQYLKENGLSYHPLW
CYSH_BAUCH       AGLRRTQS-SSRSKLPVLAVQ-------QCLFKLLPIIDWDNRQVHSYLKKHGLNYHPLW
CYSH_PHOLL       AGLRRQQS-ESRSKLPVLAVQ-------RGVFKILPIIDWDNRRVHQYLTKHGLEYHPLW
CYSH_YERPS       AGLRREQS-GGRSQLPVLALQ-------RGIFKLLPIIDWDNRQVYQYLTQHGLSYHPLW
CYSH_YERP3       AGLRREQS-GGRSQLPVLALQ-------RGIFKLLPIIDWDNRQVYQYLTQHGLSYHPLW
CYSH_YERE8       AGLRREQS-GSRAKLPVLAIA-------RGVFKLLPIIDWDNRQVYQYLTQHGLSYHPLW
CYSH_SODGM       AGLRREQS-GSRAHLPVLAIQ-------RGVFKLLPIIDWDNRQVYQYLTRHGLSYHPLW
CYSH_SERP5       AGLRREQS-GSRAHLPVLAVQ-------RGVFKILPIIDWDNRKIYQYLTEHGLSYHPLW
CYSH_ZYMMO       AGLRRDQS-KSRSHLPILAIQ-------RGVFKFLPIIDWDNRKIHYYLKEHDLPYHPLW
CYSH_BUCAI       AGLRHDQS-KSRNLLPYLSIK-------KGIFKILPILDWSKDKIKDYLKENNLDTHPLY
CYSH_VIBCH       SGLRREQS-QSRASLPILSVQ-------NGVFKFLPVIDWTNKEVHYYLKDNDLPYHPLW
CYSH_VIBC3       SGLRREQS-QSRASLPILSVQ-------NGVFKFLPVIDWTNKEVHYYLKDNDLPYHPLW
CYSH_ALIF1       SGLRREQS-GSRANLPILSIQ-------NGVFKFLPVLDWTNKEVHYFLKEYDLPYHPLW
CYSH_VIBCB       SGLRREQS-QSRAGLPILSIQ-------NGVFKFLPVIDWTNKDVHYYLEEHGLSYHPLW
CYSH_VIBPA       SGLRREQS-KSRAGLPILSIQ-------NGVFKFLPVIDWTNKDVHYYLEQHGLTYHPLW
CYSH_VIBVU       SGLRREQS-QSRAGLPILSIQ-------NGVFKFLPVVDWSNKDVHYYLKEHGLSYHPLW
CYSH_VIBVY       SGLRREQS-QSRAGLPILSIQ-------NGVFKFLPVVDWSNKDVHYYLKEHGLSYHPLW
CYSH_PHOPR       SGLRREQS-SSRASLPVLAIQ-------NGVFKFLPLIDWTDNDIEQYLNQYDLPYHPLR
CYSH_SHEON       AGLRRSQS-STREELPILAIH-------GSRFKLLPIIEWSNKDVHLYLTQFDLPYHPLW
CYSH_THIRO       AGLRRQQA-NSRAELPVLRRQ-------DGRIKFHPIIDWHRPRRARYLRRHDLPDHPLR
CYSH_XANAC       TGLRRSQS-GGRAQTPIMQKR-------GERYKISPIADWTDRDVWQYLQAHDLPYHPLW
CYSH_XANC5       TGLRRSQS-GGRAQTPIVQKR-------GERYKISPIADWTDRDVWQYLQAHDLPYHPLW
CYSH_XANOM       TGLRRSQS-GGRAQTPIVQKR-------GERYKISPIADWTDRDVWQYLQAHELPYHPLW
CYSH_XANCP       TGLRRSQS-GGRAQTPIVQKR-------GDRYKISPIADWTDRDVWQYLQAHALPYHPLW
CYSH_XANC8       TGLRRSQS-GGRAQTPIVQKR-------GDRYKISPIADWTDRDVWQYLQAHALPYHPLW
CYSH_XYLFA       TGLRRGQS-STRTQTSIVQQR-------DERYKISPIADWTDRDIWEYMKHHDLPYHPLW
CYSH_XYLFT       TGLRRGQS-STRTQTSIVQRR-------DERYKISPIADWTDRDIWEYMKHHDLPYHPLW
CYSH_SYNP6       SGVRRQQT-AHRQSMEIVELK-------RDRYAIRPILGWHSRDVYQYLTAHDLPYHPLF
CYSH_SYNE7       SGVRRQQT-AHRQSMEIVELK-------RDRYAIRPILGWHSRDVYQYLTAHDLPYHPLF
CYSH_SYNY3       TGLRRDQT-RHRQNLKPVDLQ-------GNQYKVLPILDWNSKMVYEYLTAHDLPYHPFF
CYSH_AGRFC       TGLRRGQS-GNRAATPFAEFD-----AERNLIKINALADWDIEQIRAYVAEENIPVNPLH
CYSH_RHIME       TGLRRGQS-GNRATTPFAEAD-----VERGLIKINPLADWGIETIQAHVAAEGIPVNPLH
CYSH_NEIMA       TGQRREQS-ATRTELPFAEYD-----AGRGIDKYNPIFDWSEHDVWAYILANNVPYNDLY
CYSH_NEIMB       TGQRREQS-ATRTELPFAEYD-----AGRGIGKYNPIFDWSEHDVWAYILANNVPYNDLY
CYSH_PSEAE       TGQRRDQSPGTRSQVAVLEIDGAFSTPEKPLYKFNPLSSMTSEEVWGYIRMLELPYNSLH
CYSH_PSEAB       TGQRRDQSPGTRSQVAVLEIDGAFSTPEKPLYKFNPLSSMTSEEVWGYIRMLELPYNSLH
CYSH_BACVZ       SGLRRDQG-PSRANTNFLNKD-----DKFQSIKVCPLIHWTWKDIWRYTSKHELDYNILH
CYSH1_BACSU      SGLRRDQG-PSRANTNFLNKD-----EKFKSVKVCPLIHWTWKDIWRYTSRNELDYNPLH
CYSH_BACP2       SGLRREQS-PKRAGTNFLNKD-----EKFKSVKVCPLIHWTWKDIWRYASREELTYNPLH
CYSH_GEOKA       SGLRREQS-PTRRHVEYINKD-----DKFRSIKVCPLIHWTWKDVWNYVYKRHLPYNVLH
CYSH_GEOTN       SGLRREQS-PTRRHVEYVNKD-----DKFRSIKVCPLIHWTWKDVWNYVYKHSLPYNVLH
CYSH_STAES       SGLRRAQS-PTRAHTNFINKD-----ERFKSIKVCPLIYWTEEEVWSYIRDKDLPYNELH
CYSH_STAEQ       SGLRRAQS-PTRAHTNFINKD-----ERFKSIKVCPLIYWTEEEVWSYIRDKDLPYNELH
CYSH_STAHJ       SGLRRDQS-PTRANTNFINKD-----ERFKSVKVCPLIYWTEDEVWDYIKKHDLPYNALH
CYSH_STAS1       SGLRREQS-PSRQATNFINKD-----ERFKSVKVCPLIHWTWDDVWDYIKAHDLHYNELH
CYSH_OCEIH       SGLRREQS-VSRSKTDFINKD-----ERFKSIKVCPLIHWTWDDVWEYIKDNNLPYNELH
CYSH_BACC1       SGLRREQS-ETRKHTKFINQD-----HRFRSIKVCPLIHWTWKEVWRYVYKHSLPYNPLH
CYSH_BACAH       SGLRREQS-ETRKHTKFINQD-----HRFQSIKVCPLIHWTWKEVWRYVYKHSLPYNPLH
CYSH_BACCZ       SGLRREQS-ETRKHTKFINQD-----HRFQSIKVCPLIHWTWKEVWRYVYKHSLPYNPLH
CYSH_BACHK       SGLRREQS-ETRKHTKFINQD-----HRFQSIKVCPLIHWTWKEVWRYVYKHSLPYNPLH
CYSH_BACAN       SGLRREQS-ETRKHTKFINQD-----HRFQSIKVCPLIHWTWKEVWRYVYKHSLPYNSLH
CYSH_BACCR       SGLRREQS-ETRKHTKFINQD-----HRFQSIKVCPLIHWTWKEVWRYVYKHSLPYNPLH
CYSH_BACHD       SGLRRDQS-PTRTNTQFVNED-----RRFGSTKICPLIHWTSEEIWMYIELHQLPYNDLH
CYSH2_BACSU      SGLRRDQS-PTRKHIQYVNLD-----QKFELIKICPLIHWTWDDVWTYIRLHNLPYNKLH
CYSH_MYCBO       TGLRRVDA-PTRANAPLVSFD-----ETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLV
CYSH_MYCBP       TGLRRVDA-PTRANAPLVSFD-----ETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLV
CYSH_MYCTU       TGLRRVDA-PTRANAPLVSFD-----ETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLV
CYSH_MYCTA       TGLRRVDA-PTRANAPLVSFD-----ETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLV
CYSH_DEIRA       NARSRDQA-STRADIPFVEEG-------GARRRVNPLAHWTREQLEAYAAEHDLPVNPLY
CYSH_RHILO       TGRKRFQA-STRAALPVFEAV-------GARIRINPLAHWTTSDQADYMRAHALRENPLV
                  .  : :    *                       .:          .     :  : : 

CYSH_ECOL6       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_ECOL5       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_ECO57       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_SHIBS       DEGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_SHISS       DEGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_ECOHS       DEGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_ECO24       DEGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_SHIFL       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_SHIF8       DDGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_ECOLI       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_SHIDS       DEGYLSVGDTHTTRKWEPSMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_ECOUT       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_ECOK1       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_ENT38       DQGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_KLEP7       DQGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_CITK8       DQGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_SALCH       DQGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_SALTY       DQGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_SALPA       DQGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_SALTI       AQGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_CROS8       DEGYLSVGDTHTTRKWEPGMAEE-ETRFFGL---KRECGLHEG--------------
CYSH_PECAS       DQGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_BAUCH       EQGYLSVGDTHTTCKWTPGMNEE-DTRFFGL---KRECGIHEEK-------------
CYSH_PHOLL       EQGYLSVGDIHTTQKWEPGMSEE-QTRFFGL---KRECGLHEN--------------
CYSH_YERPS       EQGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_YERP3       EQGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_YERE8       EQGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHES--------------
CYSH_SODGM       EQGYLSVGDTHTTRKCEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_SERP5       EQGYLSVGDTHTTQKWEPGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_ZYMMO       DEGYLSVGDTHTTRKWEEGMSEE-ETRFFGL---KRECGLHEG--------------
CYSH_BUCAI       NNGYSSVGDTHTTKKHMPGMLEE-ETRFFGL---KRECGLHEN--------------
CYSH_VIBCH       EQGYLSVGDTHTTQKWQPGMNEE-QTRFFGL---KRECGLHEDH-NDTHQ-------
CYSH_VIBC3       EQGYLSVGDTHTTQKWQPGMNEE-QTRFFGL---KRECGLHEDH-NDTHQ-------
CYSH_ALIF1       DQGYLSVGDTHTTQKWEPGMSEE-ETRFFGL---KRECGLHEDD-GELDGSGI----
CYSH_VIBCB       EQGYLSVGDTHTSRKWEPGMSEE-ETRFFGL---KRECGLHEDDGSEQDGSGI----
CYSH_VIBPA       EEGYLSVGDTHTTRKWEPGMSEE-ETRFFGL---KRECGLHEDDGNEQDGSGI----
CYSH_VIBVU       EQGYLSVGDTHTTQKWEPGMSEE-ETRFFGL---KRECGLHEED-NEQDGSGI----
CYSH_VIBVY       EQGYLSVGDTHTTQKWEPGMSEE-ETRFFGL---KRECGLHEED-NEQDGSGI----
CYSH_PHOPR       DEGYLSMGDTHTTKKWEPGMTEE-ETRFFGL---KRECGLHEEDAESDGSGI-----
CYSH_SHEON       EQGYVSVGDTHSSKPLELGMTEE-ETRFNGL---KRECGLHYEI-------------
CYSH_THIRO       DQGYVSIGDVHTTVPLLPGMLEE-ETRFFGI---KRECGLHR---------------
CYSH_XANAC       EQGYVSIGDFHTTRRWEPGMREE-DTRFYGL---KRECGIHEDI-------------
CYSH_XANC5       EQGYVSIGDFHTTRRWEPGMREE-DTRFFGL---KRECGIHEDI-------------
CYSH_XANOM       EQGYVSIGDFHTTRRWEPGMREE-DTRFFGL---KRECGIHEDI-------------
CYSH_XANCP       EQGYVSIGDFHTTRRWEPGMREE-DTRFFGL---KRECGIHEDI-------------
CYSH_XANC8       EQGYVSIGDFHTTRRWEPGMREE-DTRFFGL---KRECGIHEDI-------------
CYSH_XYLFA       EQGYVSIGDIHTTRPLEPGMREE-DTRFFGF---KRECGIHENI-------------
CYSH_XYLFT       EQGYVSIGDIHTTRPLEPDMREE-DTRFFGF---KRECGIHENI-------------
CYSH_SYNP6       DQGYVTVGDWHSSRPLQADDSDERSTRFRGL---KQECGLHL---------------
CYSH_SYNE7       DQGYVTVGDWHSSRPLQADDSDERSTRFRGL---KQECGLHL---------------
CYSH_SYNY3       DQGYVSVGDWHSSRPLMAHDEDERDTRFHGL---KQECGLHLPLSPEAGQSLDSSAL
CYSH_AGRFC       QRGYPSIGCEPCTRAIKPGEPER-AGRWWWENDEKRECGLHVAGAEQTPPVSAIPQR
CYSH_RHIME       SRGYPSIGCEPCTRAIKPGEPER-AGRWWWENDEKRECGLHVPEAASSIIPNASNAA
CYSH_NEIMA       RQGFPSIGCDPCTRPVKAGEDIR-AGRWWWEDKNSKECGLHK---------------
CYSH_NEIMB       RQGFPSIGCDPCTRPVKAGEDIR-AGRWWWEGRNSKECGLHK---------------
CYSH_PSEAE       ERGYISIGCEPCTRPVLPNQHER-EGRWWWEEATHKECGLHAGNLISKA--------
CYSH_PSEAB       ERGYISIGCEPCTRPVLPNQHER-EGRWWWEEATHKECGLHAGNLISKA--------
CYSH_BACVZ       DQGYPSIGCEPCTSPAFTAEDLR-SGRWNGM--AKTECGLHE---------------
CYSH1_BACSU      DQGYPSIGCAPCTSPAFTAEDLR-SGRWNGM--AKTECGLHE---------------
CYSH_BACP2       DQGYPSIGCAPCTQPAFTAQDLR-SGRWSGT--AKTECGLHE---------------
CYSH_GEOKA       DRGYPSIGCAPCTAPATDPNDLR-SGRWAGQ--GKTECGLHLA--------------
CYSH_GEOTN       DRGYPSIGCAPCTAPALDPNDLR-SGRWAGQ--GKTECGLHLT--------------
CYSH_STAES       DQNYPSIGCIPCTSPVFDSNDSR-AGRWSNS--SKTECGLHVADKP-----------
CYSH_STAEQ       DQNYPSIGCIPCTSPVFDSNDSR-AGRWSNS--SKTECGLHVTDKP-----------
CYSH_STAHJ       DQHYPSIGCIPCTAPVFDSEDSR-AGRWSNF--DKTECGLHVADKP-----------
CYSH_STAS1       DFNFPSIGCIPCTEAVSGNGDSR-AGRWTNS--TKTECGLHTTNKP-----------
CYSH_OCEIH       DNGYPSIGCIPCTSQVSDSSDSR-AGRWAGT--QKTECGLHTSD-------------
CYSH_BACC1       DIGYPSIGCEKCTLPVGEGGDSR-DGRWAGK--VKTECGLHYQ--------------
CYSH_BACAH       DVGYPSIGCEKCTLPVGEGGDSR-DGRWAGK--VKTECGLHYQ--------------
CYSH_BACCZ       DIGYPSIGCEKCTLPVGEGGDSR-DGRWAGK--VKTECGLHYQ--------------
CYSH_BACHK       DIGYPSIGCEKCTLPVGEGGDSR-DGRWAGK--VKTECGLHYQ--------------
CYSH_BACAN       DIGYPSIGCEKCTLPVGEGGDSR-DGRWAGK--VKTECGLHYQ--------------
CYSH_BACCR       DVGYPSIGCEKCTLPVGDGGDSR-DGRWAGK--VKTECGLHYQ--------------
CYSH_BACHD       DKQYPSIGCEYCTRPVKEGEDER-AGRWSNT--SKTECGLHQ---------------
CYSH2_BACSU      DQHYPSIGCEMCTLPSPDPNDER-AGRWAGR--EKTECGLHQE--------------
CYSH_MYCBO       REGYPSIGCAPCTAKPAEGADPR-SGRWQGL--AKTECGLHAS--------------
CYSH_MYCBP       REGYPSIGCAPCTAKPAEGADPR-SGRWQGL--AKTECGLHAS--------------
CYSH_MYCTU       REGYPSIGCAPCTAKPAEGADPR-SGRWQGL--AKTECGLHAS--------------
CYSH_MYCTA       REGYPSIGCAPCTAKPAEGADPR-SGRWQGL--AKTECGLHAS--------------
CYSH_DEIRA       FDGFLSIGCWPCTRAVKPGEDAR-AGRWAGK--GKTECGLWQGENKL----------
CYSH_RHILO       AYGYLSIGCFPCTQPVQPGEDAR-SGRWAGH--AKTECGIHLSGLEVSLTDASL---
                    : ::*    :         .   *:        ***: