CLUSTAL format seed alignment for MF_00068

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURQ_SHIBS       -------------MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPD
MURQ_SHISS       -------------MQLEKMITEGSNTASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPD
MURQ_SHIFL       -------------MQLEKMITEGSNTASAEIDRVSTLEMCRIINDEDKTVPPAVDRVLPD
MURQ_ECOLI       -------------MQFEKMITEGSNTASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPD
MURQ_ECO57       -------------MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPD
MURQ_SHIDS       -------------MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPD
MURQ_ECOL6       -------------MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPD
MURQ_ECOUT       -------------MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPD
MURQ_VIBVU       -----------MKIDLSRLVTESRNPASAEIDTLSTVEMLRVINQEDQKVALAVEAVLPH
MURQ_VIBVY       -----------MKIDLSRLVTESRNPASAEIDTLSTVEMLRVINQEDQKVALAVEAVLPH
MURQ2_VIBPA      -----------MKIDLSRLVTESRNPASTEIDTLSTIEMLQVINEEDQKVALAVKAVLPQ
MURQ1_VIBCH      -----------MKIDLTRLVTESRNPASEQIDTLPTLDMLKVINQQDQLVALAVAQTLPQ
MURQ_PHOLL       -----------MKINLNNMVTESRNPASANIDTLPTLEMLKLINDEDKKVALAVEQTLPK
MURQ_PHOPR       -----------MKIDLTNLITESRNTASQHIDTLSTIDMLKVINDEDKKVALAVEKTLPE
MURQ_ALIF1       -----------MKIDLTTLVTESRNKASENIDVLSTVEMLTVINQEDQKVALAVEAILPQ
MURQ_PASMU       -----------MPNAIHALVTESRNPFSTHIDQLSTLDMLAVINQEDQKVPFAIENVLPE
MURQ_SALTY       -------------MNLGTLVSETRNPQTMDLDALPTPELVKRFNEQDTLVAEAVKATLPD
MURQ_SALPA       -------------MNLGTLVSETRNPQTMDLDALPTPELVKRFNEQDTLVAEAVKATLPD
MURQ_SALCH       -------------MNLGTLVSETRNPQTMDLDALPTPELVKRFNEQDTRVAEAVKATLPD
MURQ_SALTI       -------------MNLGTLVSETRNPQTMDLDALSTPELVKRFNEQDTLVAEAVKATLPD
MURQ_YERPE       -------------MSLGALISESRNPATMELDKLSTLAMLTCINDEDRKVPDAIRLVLPA
MURQ_YERPS       -------------MSLGALISESRNPATMELDKLSTLAMLTCINDEDRKVPDAIRLVLPA
MURQ_PECAS       --------MNGENLNLGTLVSETRNPATMTLDQLSTLEMMQVFNQEDRKVPEAIAQVLPA
MURQ_HAEIN       -------MNDIILKSLSTLITEQRNPNSVDIDRQSTLEIVRLMNEEDKLVPLAIESCLPQ
MURQ_MANSM       ------MTEQNLLSSLAHMISEQRNPNSMNLDSLSPLELVTLINNEDKQVPLAIEKVLPQ
MURQ2_VIBCH      ------MTNDALIAALSHLVSEGRNPDTMDIDLLSSQEIVERLNQQDKQVPLAVEAVLPQ
MURQ1_VIBPA      ------MTNDALIAALSHLVSEGRNPDTMDIDLLPSLDIVQRINQQDKLVPLAVEKVLPE
MURQ_RHILO       ------MTEHGLMSELDLLVSEGRNPRTMDIDLLPTIDVLRKINDEDRLVPVAVEKVLPE
MURQ_COLP3       -----MNTQAKLVNELKNITTEGQNPNTLDIDLLDSLGVLKKINTEDQKVASIVGLLLPE
MURQ_BACSU       ---------MSEPLNLHRLTTESRNSQTVEIHKANTLGILKMINNEDMKVAAAVQEVLPD
MURQ1_BACLD      ----------MENSHLGSLTTERRNERSKRIHQAETIDMLKIMNDEDKTVAEAVQEVLPD
MURQ_LACAC       -------------MEIKNLTTEQRNPASIHIDTVSTVEMVKIMNEEDQKVALAVGNQDEQ
MURQ_LACJO       -------------MNIKDLTTEQRNPKSLHIDSATPLEIVKIINQEDKKIADAVGTQDKE
MURQ1_ENTFA      ---------MCKQMNLEGLTTEARNEATKKIDQVSTLEMVTLINQEDQKVAQAIEKVLPQ
MURQ_CLOAB       -----------MNSHLEDLTTEKVNDDTVNIDVMNTEDMLKAINNEDIKVAYAVQKEIHN
MURQ_MYCMS       ----------MKSNNILDIETENINKNSLDIDKKSTSEIIKIINNEDIKVAYAIKKELNQ
MURQ_CALS4       -------------MTLEELITEGRNPNTMDIDRLSTVDMLKKINEEDKKVPLAVEKVIPS
MURQ_BACAN       --------------MLENLSTEHRNEKTMNLDEMNIKEVLQSMNEEDRTVALAVEKEIEH
MURQ_BACCZ       --------------MLENLSTEHRNEKTMNLDEMNIKEVLQSMNEEDRTVALAVEKEIEH
MURQ_BACHK       --------------MLENLSTEHRNEKTMNLDEMSIKEVLQSMNEEDRTVALAVEKEIEH
MURQ_BACCR       --------------MLENLSTEHRNEKTMNLDEMSIKEVLQSMNEEDRTVALAVEKEIEQ
MURQ_BACC1       --------------MLENLSTEHRNEKTMNLDEMSIKEILQSMNEEDRTVALAVENEIEQ
MURQ_LISMF       --------------MLENLATEERNEKTIDLDTLSPKEILAVMNEEDLTVPIAIKKVLPQ
MURQ_BACSK       --------------MIDKLKTETRNQATMALDSMPIHDILKAMNREDGKVPTAIATQLPQ
MURQ_OCEIH       --------------MLDKLPTEQRNPKTMDIDTKSIKEILEMMNREDFTVPQTVQKEISF
MURQ_FRATH       ------------MNILENINTEKRNPRSLNLDSMSIAEAVSLMIDEEYGVIEALKEQHRN
MURQ_FRATT       ------------MNILENINTEKRNPRSLNLDSMSIAEAVSLMIDEEYGVIEALKEQHRN
MURQ_BACHD       --------------MLDKLTTELRNEKTMNLDEMNTIEILTAMNEEDHRVPQQIAQALPA
MURQ_STAAC       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAAM       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAAN       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAAR       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAAS       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAAW       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAA3       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAA8       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
MURQ_STAAB       --------------MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVQKAIPQ
MURQ_STAS1       ---------------MNNSMTEARNEATMHLDEMSIIQALETMNAEDQKVPQQIHDILPK
MURQ_STAEQ       ---------------MNHLTTETRNIQTMHLDEMNLSDALKTMNQEDQLVPKAIEPVIPN
MURQ_STAES       ---------------MNHLTTETRNIQTMHLDEMNLSDALKTMNQEDQLVPKAIEPVIPN
MURQ_STAHJ       ---------------MEHLTTESRNTQTMHLDEMSILEALKTINKEDQLVAKAIEPILPQ
MURQ2_ENTFA      -------------MNLENLTTERRNENTMGLDEMSVKEALQKMNQEDQKVAMAVGQELAA
MURQ_LACLA       ------------MIDLSTLTTERRNNETFNLDQMTVAEALIKMNNEDKKVAFAVEEALPN
MURQ2_LACPL      -------------MNLEKLTTETRNQKTMALDMLSVKEMLELMNQEDQRVPVAVSKELPQ
MURQ1_LACPL      -----------MKSDINQLTTEGRNPASNDLDEMSILAIAQLMNQEDAKVSQSITPELPQ
MURQ_BACFN       ----MNSNIEKSDKPSFIKISEQP-SLYDDLEKKSVREILEDINKEDQKVAIAVQKAIPQ
MURQ_BACFR       ----MNSNIEKSDKPSFIKISEQP-SLYDDLEKKSVREILEDINKEDQKVAIAVQKAIPQ
MURQ_BACTN       --------------MEFIKITEQP-SLYDDLDKKSVKEILEDINTEDHKVADAVQKAIPQ
MURQ_PORGI       ---------------MFEKITEQP-SLYDRLEEKSTREILEDINREDRKVAEAVSRTIPM
MURQ_JANSC       --MGVAAVFTAVQSDLGALVSEASNSRSADIDLMTTAQILACMNAEDRKIADAVAAELPA
MURQ_RHOBA       -----------MLNQLNQLTTEASNPASAQIDSLSALQIVQLINQQDALVAAAVNTQAEM
MURQ_SYNJB       ------------MAWDPRSLTESPNPATAEIDRLSTWELVKRINAEDRQVPEAVAAQAEP
MURQ_STRAW       --MTSMSHHRSLQAELETLTTEAFRPELAEIDQLPTLEIARLMNGEDATVPAAVAARLPQ
MURQ_STRCO       --MTSTPHHPDLRSQLETLTTEAFRPELAEIDQLPTLDIARLMNGEDATVPAAVAERLPE
MURQ_SALRD       --MPRMPDSSSLFDELQDLATEQQNPHSTHIDTASVEEILRVINTEDHKVPIAVRRELPH
MURQ_SYMTH       -------------MELNRLVTEGRLQESLEIDQVSTLEMVRIINEQDKQVALAVEKELPH
MURQ2_BACLD      -----------------MRKTENTNDKSTALDEMNALDIVTLMNEEDHTVPRAITPCLPL
MURQ_THEFY       --------MHTAPVEIVRAPTEARNSSTKDIDLLPTADILRLINAEDATVPRAVAEVLPE
MURQ_DEIGD       ------MTTPPSSPLSDPRRTEGVHPTHTDLDRLDPLALVQVFTDDQRAAVEAVRAAVPA
MURQ_DEIRA       --------------MTDPRRTEQVHPDYADLDTLAPDALIAALADDQLGAVRAVQAAAPQ
MURQ_CUTAK       -----------MDSLTNLATTEGRNPASEELDQLPTLDVLRLMNDEDHRVPDAIASQLPA
MURQ_BURL3       -------------MHLEHLVTEQPNGQSANLDALGIPDALALMNREDAGIAARVAHALPA
MURQ_SYNE7       --------MDPSLSDRGHLLTEQANPASQALDQLSPLELVDLFNQEDQHCLAAVAQAREA
MURQ_SYNP6       --------MDPSLSDRGHLLTEQANPASQALDQLSPLELVDLFNQEDQHCLAAVAQAREA
MURQ_NOSS1       ---------MADLQERGHLLTEQVNPLSQNLDQLSSLELVELFNSEDLKTVEAVAAAKVQ
MURQ_TRIV2       ---------MANLQERGHLLTEQVNPLSQNLDQLSSLELVELFNSEDRKTIEAVAAAKVQ
MURQ_SYNY3       -------MPMEILEERGHLLTEQTNPQSQNLDQLSSLELVDLFNQQDQLTVTAIAGARED
MURQ_THEEB       ------MTNLQELPSRGHLLTEQINPASQNLDQLTPLELVDLFNQEDAHTLRAIAQAREA
MURQ_GLOVI       --------MDERLPERAHLVTEQVNPDSARLDRLDSPSLVELFCREDERVVPAVRAAAPA
MURQ_PROMA       ----MKNYNLSDNINRSNILTEESNHLSKNIDTVSTSKLVDIFVEEDKKPQQAISQAKHQ
MURQ_PROMT       ----MSDTNNHSKNIIHRILTEQINLTSNELDTKSTKEIVNIFSEADKEPQKAVERVIPE
MURQ_SYNS9       --MAGFDPTLQPSDDRGHLLTEQSNPRSRRLDQLATNDLVNLFVEEDRRPQEAVAEASEA
MURQ_SYNSC       --MAVFDPDLQPSSDRGHLLTEQSNQRSSHLDQLDTLALLELFADEDRRPQEAVAAVAPA
MURQ_SYNPX       --MTRFQSDAAVSADRGHLMTEQPNPRSTALDLLDTAELVTLFVEEDRRPQQAVADASAS
MURQ_PROMM       MTNVFADLNLHPSDNRGHLLTEKVNPKSECLDQLTTESLVTLFCEEDREPQRAVAAAIPE
                                     :*        :.          :   :      :      

MURQ_SHIBS       IAAAIDVIHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_SHISS       IAAAIDVIHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_SHIFL       IAAAIDVIHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_ECOLI       IAAAIDVIHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_ECO57       IAAAIDVIHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_SHIDS       IAAAIDVIHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_ECOL6       IAAAIDVIHTQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_ECOUT       IAAAIDVIHTQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQ
MURQ_VIBVU       IAQAVDAITHAFAHGGRLIYMGAGTSGRLGILDASECPPTYGTPAELVVGLIAGGHTAIL
MURQ_VIBVY       IAQAVDAITHAFAHGGRLIYMGAGTSGRLGILDASECPPTYGTPAELVVGLIAGGHTAIL
MURQ2_VIBPA      IAKTVNAITAAFANGGRLVYMGAGTSGRLGILDASECPPTYGTHPDMVIGLIAGGHQAIL
MURQ1_VIBCH      VAQAVEAIATAFAQGGRLIYMGAGTSGRLGILDASECPPTYGSQPEQVIGLIAGGHTAIL
MURQ_PHOLL       IAETVDKIAEAFRQGGRLIYIGAGTSGRLGILDASECPPTYGTKPEQVVGLIAGGHQAIL
MURQ_PHOPR       ISQVVDAITEAFKKGGRLIYTGAGTSGRLGILDASECPPTYGSKPEQVVGLIAGGHTAIL
MURQ_ALIF1       IADVVDAIAVAFQSGGRLIYTGAGTSGRLGILDASECPPTYGSNPDLVVGLIAGGHKAIL
MURQ_PASMU       IAQAVDAIAETFMKNGRLIYLGAGTSGRLGILDASECPPTFGTPHEQVVGLIAGGQQAIL
MURQ_SALTY       VARAVDAAAAALKSGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPGALL
MURQ_SALPA       VARAVDAAAAALKSGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPGALL
MURQ_SALCH       VARAVDAAAAALKSGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPGALL
MURQ_SALTI       VARAVDAAAAALKSGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPGALL
MURQ_YERPE       VAQAVDLAADALKQGGRLIYLGAGTSGRLGVLDASECPPTFGVPHGMVIGLIAGGPGALL
MURQ_YERPS       VAQAVDLAADALKQGGRLIYLGAGTSGRLGVLDASECPPTFGVPHGMVIGLIAGGPGALL
MURQ_PECAS       IAEAVDLATASLQAGGRLIYLGAGTSGRLGVLDASECPPTFGVPHGLVIGLIAGGPGALL
MURQ_HAEIN       ISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDASECPPTFGVSTEMVKGIIAGGECAIR
MURQ_MANSM       IAQAVEKIVRTFQQGGRLVYIGAGTSGRLGVLDASECPPTYGVKPEMVVGLIAGGERALR
MURQ2_VIBCH      IAQAVDKITAAFKQGGRLIYLGAGTSGRLGVLDASECPPTFGVSDQMVIGLIAGGKEAMF
MURQ1_VIBPA      IAQAVDKITDAFKVGGRLIYMGAGTSGRLGVLDASECPPTFGVSDKMVIGLIAGGPEAIL
MURQ_RHILO       IAAAVDRIVLAFQKGARLIYVGAGTSGRLGVLDASECPPTFGVPEDMVIGLIAGGPDALV
MURQ_COLP3       ISQGVDLIVDAFACGGRLIYIGAGTSGRLGVLDAVECPPTFSVSSEQVIGILAGGAGAMY
MURQ_BACSU       IKTAVDCAYESFQNGGRLIYTGAGTSGRLGVMDAVECPPTYSVSPDQVIGIMAGGPEAFL
MURQ1_BACLD      VKTAVDYAVGSLKKGGRIIYIGAGTSGRLGVLDAAECPPTFSISPESVIGIIAGGEKALY
MURQ_LACAC       IARAIDEAANRYKKGGRLIYLGAGTSGRLGVLDAAELVPTYGIKPERAIGLIAGGPGAMY
MURQ_LACJO       IAKAIEYASKRYREGGRLIYVGAGTSGRLGILDAVELVPTYRINPERAIGLIAGGQSAMF
MURQ1_ENTFA      IAAAIDAAAERFKKGGRLIYCGAGTSGRLGALDAIELTPTYSVSPERAFGILAGGEKAMY
MURQ_CLOAB       IVKAVDIVSEKLKNNGRLFYIGAGTSGRLGVLDASECPPTYGTNPELVQGIIAGGNEAIL
MURQ_MYCMS       ISNVIDLIFERFKKGGRLIYIGSGTSGRLGILDASEMYPTYGIDQNRIIGIIAGGNKAIK
MURQ_CALS4       IAEAIDRIVPRMKKGGRLIYVGAGTSGRIGILDASECPPTFGVDPGLVVGIIAGGDSAIR
MURQ_BACAN       IEKVVRVVIQSFEEEGRLIYIGAGTSGRLGILDAVECPPTFGTDDKMVQGFIAGGLKAFT
MURQ_BACCZ       IEKVVRVVIQSFEEEGRLIYIGAGTSGRLGILDAVECPPTFGTDDKMVQGFIAGGLKAFT
MURQ_BACHK       IEKVVRVVIQSFEEEGRLIYIGAGTSGRLGILDAVECPPTFGTDDKMVQGFIAGGLKAFT
MURQ_BACCR       IEKVVQTVIKSFEEEGRLIYIGAGTSGRLGILDAVECPPTFGTDDKMVQGFIAGGLKAFT
MURQ_BACC1       IEKVVQTVIKSFEEEGRLIYIGAGTSGRLGILDAVECPPTFGTDDKMVQGFIAGGLKAFT
MURQ_LISMF       IELIVSGVISCFQKGGRLIYLGAGTSGRLGVLDAAECVPTFGVSKEQVIGLIAGGEKAFV
MURQ_BACSK       IEKAVKLVIASFQQGGRLIYAGAGTSGRLGVLDAVECKPTFGVSPEMVRGVIAGGEQAFT
MURQ_OCEIH       IEEAVHRTIHSFKSNGRLIYIGAGTSGRLGVLDASECPPTFGVSSEMVKGLISGGLEAIT
MURQ_FRATH       ITEVILATSYSLRNGGRIIYIGAGTSGRLGILDAVECPPTFSVDYNTIVGLIAGGEKAFI
MURQ_FRATT       ITEVILATSYSLRNGGRIIYIGAGTSGRLGILDAVECPPTFSVDYNTIVGLIAGGEKAFI
MURQ_BACHD       IAPLVEETIKAMKQGGRLIYVGAGTSGRLGVLDAAECPPTFGVAPDRVIGLIAGGEKAFI
MURQ_STAAC       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAAM       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAAN       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAAR       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAAS       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAAW       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAA3       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAA8       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAAB       LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMT
MURQ_STAS1       LAEVIKVTTEQFKQGGRIIYIGAGTSGRLGVLDAAECVPTFNTSTNEVIGLIAGGQRAMT
MURQ_STAEQ       LTKVIESAIQRFNNGGRIIYIGAGTSGRLGVLDAAECVPTFNVSPNDIIGIIAGGQKAMT
MURQ_STAES       LTKVIESAIQRFNNGGRIIYIGAGTSGRLGVLDAAECVPTFNVSPNDIIGIIAGGQKAMT
MURQ_STAHJ       LNRVIEQTITRFRDGGRLIYIGAGTSGRLGVLDAAECVPTFNTHPNEVIGLIAGGQQAMT
MURQ2_ENTFA      IEPVVEAIIKSFNQGGRLIYMGAGTSGRLGVLDAAECVPTFGVEPEMVQGLIAGGQKAMT
MURQ_LACLA       IEPVISSAIEAFNKGGRLIYMGAGTSGRLGVLDAAECVPTFGVPATQVIGLIAGGDKAMT
MURQ2_LACPL      IECAVDKIVANFKAGGRLIYMGAGTSGRLGVLDAAECVPTFGTSPEMVQGLIAGGMSAMT
MURQ1_LACPL      IAAAIALIVTAFKANGRLIYMGAGTSGRLGVLDAAECVPTFGTEPEMVQGLIAGGAQAMT
MURQ_BACFN       IEKLVTQIVPRMKQGGRIFYMGAGTSGRLGVLDASEIPPTFGMPPTLIIGLIAGGDTALR
MURQ_BACFR       IEKLVTQIVPRMKQGGRIFYMGAGTSGRLGVLDASEIPPTFGMPPTLIIGLIAGGDTALR
MURQ_BACTN       IEKLVTLIIPRVKKGGRIFYMGAGTSGRLGVLDASEIPPTFGMPPTVVIGLIAGGDTALR
MURQ_PORGI       IERLVEQIIPRMEQGGRLFYMGAGTSGRLGVLDASEIPPTFGMPPTFVIGLIAGGDRALR
MURQ_JANSC       IAQTVDRIVAAIGRGGRLIYIGAGTSGRLGVLDASECPPTFSVPPGMVVGLIAGGDTALR
MURQ_RHOBA       IAEAVDVIADRFRSNGRLIYLGAGTSGRLGVLDASECPPTFRTPPEMVVGVIAGGPEALT
MURQ_SYNJB       IAQAIDAIAQRMRHGGRLIYIGAGTSGRLGVLDAAECPPTFGTSPAQVVALIAGGEKALT
MURQ_STRAW       IAAAIDAVADRMARGGRLVYAGAGTAGRLGVLDASECPPTFNTDPSEVVGLIAGGPSAMV
MURQ_STRCO       IAAAIDAVAVRMARGGRLIYAGAGTAGRLGVLDASECPPTFNTGPGQVVGLIAGGPDAMV
MURQ_SALRD       IAEAVEIVVEAFEADGRLFYVGAGTSGRLGVVDASECPPTFGTDPERVQGIIAGGREAVF
MURQ_SYMTH       IARAVDLIAERLRAGGRLFYVGAGTSGRLGILDASEIPPTYGAPPDLVQGVIAGGLEAVF
MURQ2_BACLD      IAEAAETIVSRFEQGGRVFTAGAGTSGRIAVLDAAELPPTFSIDESRWTGLIAGGYDAMW
MURQ_THEFY       LAKAVDLGVSVLRHGGRIHYFGAGTSGRLATMDAAELPPTFGIARDRVVAHHAGGPSALI
MURQ_DEIGD       LARAVEAALPRLERGGRLVYVGAGTSGRLAVLDATELTPTFSWPPERAVPLIAGGERAIR
MURQ_DEIRA       LTAALNAAVPQLERGGRLVYVGAGTSGRLGVLDATELTPTFSWPPERAVPLIAGGERAIR
MURQ_CUTAK       IAAVVEAAVKGLSAGGRLIYAGAGTSGRLGVLDAAECPPTFSTNPTMVVGLIAGGQQAMF
MURQ_BURL3       IASGVTVIADALRAGGRLIYIGAGNSGRIGYLDALECQPTFGTQPGEIIGIVAGGFAGIT
MURQ_SYNE7       IAQAIEYAAQAIARGGRLFYIGAGTSGRLGVLDAAECPPTFCSDPEQVQGILAGGSAAMF
MURQ_SYNP6       IAQAIEYAAQAIARGGRLFYIGAGTSGRLGVLDAAECPPTFCSDPEQVQGILAGGSAAMF
MURQ_NOSS1       IATAIEQTADRLRQGGRLFYVGAGTSGRLGVLDAAECPPTFCTPPELVQGIIAGGAGALV
MURQ_TRIV2       IATAIEQTADRLRQGGRLFYVGAGTSGRLGVLDAAECPPTFCTPPELVQGIIAGGAGALV
MURQ_SYNY3       LAAAIEIISDALAKGGRLFYIGAGTSGRLGVLDAVECPPTFCTPSELVQGILAGGASALL
MURQ_THEEB       LAQTISATAARLRQGGRLFYIGAGTSGRLGVLDAAECPPTFCTPPHLVQGILAGGDAALV
MURQ_GLOVI       IARAIDLTAAALRGGGRLFYVGAGTSGRLGVLDASECPPTFCTDPEQVQGIIAGGTAALT
MURQ_PROMA       ITKSIDLIYQRLIDNGRLFYIGAGTSGRIAVLDAVECPPTFCTSPELVQAVIAGGSSSLI
MURQ_PROMT       LINAIDEITSRLKSNGRLFYIGTGTSGRLGVLDASECPPTFCTNPDLVQGIIAGGISSLT
MURQ_SYNS9       IAAAVDAISKRLSSGGRLFYLGAGTSGRLGVLDAAECPPTFCSDPELVQGVLAGGTPALL
MURQ_SYNSC       LAQAVDAVANRLRAGGRLFYLGAGTSGRLGVLDAAECPPTFCSDPQQVQGVLAGGSAALL
MURQ_SYNPX       ISAAVDRIASRLKDGGRLFYLGAGTSGRLGVLDAAECPPTFCSDPEMVQGVLAGGAPALL
MURQ_PROMM       LIQAVEAITDRLRSGGRLFYLGAGTSGRLGVLDAAECPPTFCSDPDLVQGVLAGGSAALL
                 :              .*:   *:*.:**:. :** *  **:           :**  .. 

MURQ_SHIBS       HAVEGAEDSREGGVNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_SHISS       HAVEGTEDSREGGINDLKNINLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_SHIFL       HAVEGAEDSREGGVNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_ECOLI       HAVEGAEDSREGGVNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_ECO57       HAVEGAEDSREGGVNDLKNIGLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_SHIDS       HAVEGAEDSREGGINDLKNIGLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_ECOL6       HAVEGAEDSREGGVNDLKNIGLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_ECOUT       HAVEGAEDSREGGVNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYAR-QLGCRTVGISC
MURQ_VIBVU       KAVENAEDNRELAQNDLKSLNLTANDVVVGIAASGRTPYVLGGLEYAT-LIGATTVSIAC
MURQ_VIBVY       KAVENAEDNRELAQNDLKSLNLTANDVVVGIAASGRTPYVLGGLEYAT-LIGATTVSIAC
MURQ2_VIBPA      KAVENAEDDVKMGQDDLKALHLTKHDVVVGIAASGRTPYVLGGLEYAK-SIGATTASIAC
MURQ1_VIBCH      KAVENAEDNRELGQSDLKALHLSEKDVLVGIAASGRTPYVIAGMEYAR-SVGATVVSLAC
MURQ_PHOLL       HAVENAEDNQQLGANDLQALHFNSKDVLVGIAASGRTPYVLGAMTYAK-SVGATVACISC
MURQ_PHOPR       RAVENAEDNRELGEGDLKGLNFNEKDVLVGIAASGRTPYVLGAMAYAK-SVNATVACISC
MURQ_ALIF1       KAVENAEDNRELGASDLQDLGLNEKDVLVGIAASGRTPYVLGAMEYAK-SVGATVATLSC
MURQ_PASMU       KAVENAEDDRSAGEQDLRNLALNEKDVVVGIAASGRTPYVLAGIEYAN-HVGCVTVGISC
MURQ_SALTY       KAVEGAEDSQQAGEDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYAR-QSGCTTVAVSC
MURQ_SALPA       KAVEGAEDSQQAGEDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYAR-QSGCTTVAVSC
MURQ_SALCH       KAVEGAEDSQQAGEDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYAR-QSGCTTVAVSC
MURQ_SALTI       KAVEGAEDSQQAGEDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYAR-QSGCTTVAVSC
MURQ_YERPE       KAVEGAEDDIALGMRDLQDLQLTATDMVVGLAASGRTPYVIGALRYAR-ELGCPTAAISC
MURQ_YERPS       KAVEGAEDDIALGMRDLQDLQLTATDMVVGLAASGRTPYVIGALRYAR-ELGCPTAAISC
MURQ_PECAS       KAVEGAEDDPALGEADLKALSLTATDMVIGLAASGRTPYVIGALRYAR-DVGCRTAAISC
MURQ_HAEIN       HPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAK-SLGALTISIAS
MURQ_MANSM       HPIEGAEDNAEQGKADLQQINFSKKDILVGIAASGRTPYVIGALNYAK-SLGAITISIAS
MURQ2_VIBCH      TAQEGAEDNATLGAHDLQQIDFSSKDVLVGIAASGRTPYVIGALEYAN-DLGATTIALSC
MURQ1_VIBPA      KAKEGAEDSPQLGEQDLKAIDFSSNDVLVGIAASGRTPYVIGGLEYAN-TIGATTVALSC
MURQ_RHILO       RSTEGAEDDPKMGAQALQEIGLTPDDVVMGIAVSGRTPYVIGGLNYAK-QVGATTVALSC
MURQ_COLP3       KAVEGAEDNRQLAIDDLKAINLSSKDIVVGIAASGRTPYVISGMAFAR-EQGAKVIGVSC
MURQ_BACSU       QAAEGIEDSEEAGAEDLRNIQLTSNDTVIAIAASGRTPYAAGALRYAR-KVGAHTIALTC
MURQ1_BACLD      NAVEGAEDHEAFGRRDLEAVNLSNNDTVIGIAASGRTPYVLGALKYAK-KTGAKAISLTC
MURQ_LACAC       KAVEGAEDDTNLGAEDLKDLNLNSQDIVLGLAASGRTPYVIGGLEYAN-QIGAFTISIAC
MURQ_LACJO       RAVEGAEDDLQLGEKDLKDLKLNEKDIVIGLAASGRTPYVIGCLKYAN-QVKALTISIAC
MURQ1_ENTFA      QAIEGAEDSKELAIEDLTQHQLTARDVVIAIAASGRTPYAVSAIEYGK-KVGALTISVTC
MURQ_CLOAB       KAVEGAEDDEDMGRSIIKERNMTSKDVVIGITASGRTPFVIGAMKEAR-KNEIIAIGISN
MURQ_MYCMS       NPIEGAEDNEKLAIVDLNKIKLNSFDTVIGIASSGKTPYVLSALKYAN-KKDALSIGLCM
MURQ_CALS4       NAIESAEDDVEGGRQDLVNINLTERDSVIGISASGRTPYVIGALRYAK-EVGALTIGLFC
MURQ_BACAN       KAVEGAEDREELAEEDLKSIGLNEKDTVIGIAASGRTPYVIGGLKYAN-SVGASTASISC
MURQ_BACCZ       KAVEGAEDREELAEEDLKSIGLNEKDTVIGIAASGRTPYVIGGLKYAN-SVGASTASISC
MURQ_BACHK       KAVEGAEDREELAEEDLKSIGLNEKDTVIGIAASGRTPYVIGGLKYAH-SVGASTASISC
MURQ_BACCR       KAVEGAEDREELAEEDLKSIGLNEKDTVIGIAASGRTPYVIGGLKYAQ-SVGASTASISC
MURQ_BACC1       KAVEGAEDREELADEDLKSIGLNEKDTVIGIAASGRTPYVIGGLKYAN-RVGASTASISC
MURQ_LISMF       AAIEGAEDSKILGENDLKQIKLTANDFVIGIAASGRTPYVIGALDYAK-SVGAKTGAISC
MURQ_BACSK       EAVEGAEDDERAGANDCNRLNIGEKDTVIALAASGRTPYAIGVLKEAE-ARGANTVSIAC
MURQ_OCEIH       KAKEGAEDSEAMAKQDLLDIKLTEHDTVIGIAASGRTPYVKGALSYAN-EIGASTVAISN
MURQ_FRATH       QAQEGAEDAANFGKEDLQSINLTAKDIVIGIAASGRTPYVIGALEYAN-SIGATTVAISC
MURQ_FRATT       QAQEGAEDDANFGKEDLQSINLTAKDIVIGIAASGRTPYVIGALEYAN-SIGATTVAISC
MURQ_BACHD       EAKEGAEDDEGLGEADLKKIQLTVRDVVVGIAASGRTPYVIGALKYAN-QVGAVTGSLAC
MURQ_STAAC       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAAM       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAAN       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAAR       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAAS       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAAW       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAA3       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAA8       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAAB       MAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFAN-TIGATTVSISC
MURQ_STAS1       VAVEGAEDSESLAREDLKHIHLNEKDVVIGIAASGSTPYVMGGLKCAT-EIGAHTVAISC
MURQ_STAEQ       VAIEGAEDDAEQGAQDLKNIHLQSKDIVVGISASGRTPYVKGALVYAN-KMNAETVALSC
MURQ_STAES       VAIEGAEDDAEQGAQDLKNIHLQSKDIVVGISASGRTPYVKGALVYAN-KMNAETVALSC
MURQ_STAHJ       EAIEGAEDNYEMGMTDLKAIHLNEKDVVIGISASGRTPYVKGALTYAN-EISALTVALSC
MURQ2_ENTFA      VAVEGAEDSKELGRQDLVDLKLSANDIVVGIAASGRTPYVIGGLEYAT-TVGAATATVAC
MURQ_LACLA       VSVEGAEDSLELGRQDLIDLKLNENDLVLGIAASGRTPYVIGALDYAK-EIGAKTASLSC
MURQ2_LACPL      VAVEGAEDSIELGQQDLVDLHLTSHDTVVGVAASGRTPYVIGGLDYAC-EVGATTVSIAC
MURQ1_LACPL      VAVEGAEDNPNLGAQDLKDLALTANDAVVGLAASGRTPYVIGALDYAQ-KIGAATISLAC
MURQ_BACFN       NPVENAEDNTTRGWEELTEHNINDKDTVIGIAASGTTPYVIGAMHAAR-EHGILTGCITS
MURQ_BACFR       NPVENAEDNTIRGWEELTEHNINDKDTVIGIAASGTTPYVIGAMHAAR-EHGILTGCITS
MURQ_BACTN       NPVENAEDDMSRGWEELLQHHINSEDTVIGIAASGTTPYVIGAMRTAR-EHGILTGCITS
MURQ_PORGI       NPVEKAEDNTERGWEELLSHGVNSSDTVIGIAASGTTPYVIGALREAR-RHGILTGCICS
MURQ_JANSC       TSVEAAEDDEATGAEDVKAIGLTTKDVVIGIAVSGRTPFVMGAIDYAR-RIGAFTAALTC
MURQ_RHOBA       RAIEGAEDHPEFAERDLAKINLSSNDVLVGIATSGRTPYVIGGLKYAR-SIGAFTIGLSC
MURQ_SYNJB       QAVEGAEDDAEAAARALEGLHLQAQDSVVGIAASGRTPYVLGGIQAAR-SIGALTIGLAC
MURQ_STRAW       TSIEGAEDSKELAAGDLAGLGLTADDTVVGVSASGRTPYAIGAVEYAR-ARGALTVGLSC
MURQ_STRCO       TSIEGAEDSPELARADLDALALTADDTVVGVSASGRTPYAVGAVEYAR-SLGALTVGLAC
MURQ_SALRD       RSQEGAEDVPERGAQALKGQGVTENDVVCGIASSGRTPFVVGAVEHARDAIGCPTLFVTT
MURQ_SYMTH       RTREGAEDSREQGAADIAAR-VRPGDVVVGIAASGRTPYTVAALEEAR-RLGCATVAVTN
MURQ2_BACLD      MPLEENEDDREKIVADLKAQSFSKDDVLIGVTASGSTPYVLGALSYAK-QIGAASVSISC
MURQ_THEFY       HACEGIEDDFS--SGRADAATVTSADLAIGLTASGRTPYVAGALDRAR-EAGARTVLVTA
MURQ_DEIGD       QAVEGAEDDAEAGAADVRAAGTGPQDVLIALAASGTTPYVLGAVRAAR-ALGALTIGLAN
MURQ_DEIRA       QAVEGAEDDEAAGERDVQAVNIGPDDVLIAVAASGTTPYVLGAARSGR-AAGALTVGLAN
MURQ_CUTAK       QAVEGAEDDADRGAEELNVLQPGPHDVVVGLAASGRTPWVVGVVRAAK-RAGAVTASVCC
MURQ_BURL3       ESVE---DSDTLGRQDLDAAGLARGDVVVGLTASGRTPYVLGALRHAR-DTGCRTIAVAC
MURQ_SYNE7       RSSEGLEDRAEDGAVAIAEYQIGPRDFILGITAGGTTPYVHGALEAAR-SAGAKTGFLAC
MURQ_SYNP6       RSSEGLEDRAEDGAVAIAEYQIGPRDFILGITAGGTTPYVHGALEAAR-SAGAKTGFLAC
MURQ_NOSS1       RSSEDLEDRAEDGDAAIAQRHITQLDVVVGITAGGTTPFVQGAINSAR-QRGALTIFIAC
MURQ_TRIV2       RSSEDLEDRAEDGDAAIAQRHITQLDVVVGITAGGTTPFVQGAINSAR-QRGALTIFIAC
MURQ_SYNY3       RSSEGLEDIAADGAQAIADHRITQLDVVVGITAGGTTPYVHGALDAAR-ARGTKTIFIAC
MURQ_THEEB       RSSEGLEDRYEDGAAVVGDRQITAQDVVIGISAGGTTPYVHGALDAAQ-GVGALTVFMAC
MURQ_GLOVI       RSVEGAEDDPEAGAAELAGRALSAADVVVGISAGGTAPYVSGALAYAR-SLGGVTIFVAC
MURQ_PROMA       NSSEEKEDSNSLSIKDLKERNFSSKDCLIGITAGGTTPYVLSGLNYAR-NIGALNIAITS
MURQ_PROMT       TSSEHLEDVSEIAISDLKDRNFSYRDVLIGITASGRTPYVLGALNYSK-SISALTISISS
MURQ_SYNS9       RSSEGLEDLEQAGRDDLDRHGFRQGDCLVGIAAGGTTPYVRGGLSYAC-SIGALAIAMAC
MURQ_SYNSC       RSSEGLEDIEAAGRADLEERGFSTKDCLVGIAAGGTTPYVRGGLAFAK-SIGALAIALAC
MURQ_SYNPX       RSSEGLEDLEAAGREDLDQRGFNAGDCLVGIAAGGTTPYVRGGLSHAR-SIGALAIAMAC
MURQ_PROMM       KSSEGLEDIEQLGKKDLEERDFSPADCLVGIAAGGTTPYVKGGLAYAK-EINALAIAISC
                  . *   *                 *   .:: .* :*:. .    .          :  

MURQ_SHIBS       NPGSAVSTTAEFAITPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_SHISS       NPGSAVSTTAEFAITPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_SHIFL       NPGSAVSTTAEFAITPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_ECOLI       NPGSAVSTTAEFAITPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_ECO57       NPGSAVSTTAEFAITPVVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_SHIDS       NPGSAVSTTAEFAITPVVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_ECOL6       NPGSAVSSTAEFAITPVVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_ECOUT       NPGSAVSSTAEFAITPVVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVD
MURQ_VIBVU       NPVCPMADAAQIAILPVVGPEVVTGSSRMKAGTAQKLVLNMLTSGAMIRSGKVFGNLMVD
MURQ_VIBVY       NPVCPMADAAQIAILPVVGPEVVTGSSRMKAGTAQKLVLNMLTSGAMIRSGKVFGNLMVD
MURQ2_VIBPA      NPECAMAKAADIAILPIVGAEVVTGSSRMKAGTAQKLVLNMLTTGAMIRSGKVFGNLMVD
MURQ1_VIBCH      NPGCPMEAYADIVITPVVGAEVVTGSSRMKAGTAQKLVLNMLTTGAMIKSGKVFGNLMVD
MURQ_PHOLL       NPESPMTQAADIAIAPIVGPEIVTGSSRMKAGTAQKLILNMLTTGAMIRTGKVYSNLMVD
MURQ_PHOPR       NPNSPMTAAADISITPVVGAEVVTGSSRMKAGTAQKLVLNMLTTGAMIRSGKVFGNLMVD
MURQ_ALIF1       NPNSPMTELADINMTPVVGPEVVTGSSRMKAGTAQKLVLNMLTTGAMIRTGKVFGNLMVD
MURQ_PASMU       NPDSALAALANIAITPIVGPEVITGSSRMKAGTAQKLILNMLTTGAMIKTGKVFGNLMVD
MURQ_SALTY       NPDSPIAREANIAISPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQNLMVD
MURQ_SALPA       NPDSPIAREANIAISPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQNLMVD
MURQ_SALCH       NPDSPIAREANIAISPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQNLMVD
MURQ_SALTI       NPDSPIAREANIAISPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQNLMVD
MURQ_YERPE       NPDSPIAQEAQVAISPVVGPEALTGSTRMKSGTAQKLVLNMLSTGAMVKLGKVYQNLMVD
MURQ_YERPS       NPDSPIAQEAQVAISPVVGPEALTGSTRMKSGTAQKLVLNMLSTGAMVKLGKVYQNLMVD
MURQ_PECAS       NPHSPIAQEAQVAISPVVGPEALTGSTRLKSGTAQKLVLNMISTGVMVKLGKVYQNLMVD
MURQ_HAEIN       NPKSEMAEIADIAIETIVGPEILTGSSRLKSGTAQKMVLNMLTTASMILLGKCYENLMVD
MURQ_MANSM       NPDSAMASIADIAIDTLVGAEVLTGSSRMKSGTAQKLVLNMLTTASMVLMGKCYQNLMVD
MURQ2_VIBCH      NPDSPIAEIAQIAISPVVGPEALTGSTRLKSGTAQKLVLNMLTTASMIRLGKSYQNLMVD
MURQ1_VIBPA      NPDSPIADIADIAISPVVGPEALTGSTRLKSGTAQKLVLNMLTTASMIRLGKSYQNLMVD
MURQ_RHILO       NPASTIAGIADIAISPVVGPEVLTGSTRLKSGTAQKLVLNMLTTASMIRIGKSFQNLMVD
MURQ_COLP3       SANSSYAQNCDINICAVVGAEVLTGSTRMKSGTAQKLILNMLSTASMIRSGKSYQNLMID
MURQ_BACSU       NENSAISKDADHSIEVVVGPEAITGSTRMKAATAHKMILNMISTAVMVKIGKVYENLMVD
MURQ1_BACLD      NENSAISQAADHSIEVVVGPEVIAGSTRMKAATAHKMILNMISTAAMIKMGKVYENLMVD
MURQ_LACAC       VKDSEIGKHAEVAIEAVVGPEIVTGSTRMKSGTAQKMILNMISTGVMIRQGKVFENVMID
MURQ_LACJO       VKKSEIGKYADIAIEAVVGPEVITGSTRMKAGTAQKMILNMISTGVMIKQGKVYENVMVD
MURQ1_ENTFA      NNQSPMNQLAEIGIAPIVGPEVITGSTRMKAGSAQKMVLNMFSTGIMVKVGNIYQNLMVN
MURQ_CLOAB       NKNSLINKNVDIKITPIVGPEVIMGSTRMKAGTAQKLVLNMITTAVMIKLGKVYGNLMID
MURQ_MYCMS       VKNSEMTKIANQVISIKTGAEIITGSTRMKAGTATKLVCNMITTTLMIKLGKVYKNLMID
MURQ_CALS4       NENKNVENIVDVMITPIVGPEVIMGSTRMKAGTAQKLVLNMISTGVMIKLGKVYSNLMVD
MURQ_BACAN       NKNAEISKYAKLNVEVETGAEILTGSTRLKAGTAQKLVLNMISTASMIGVGKVYKNLMVD
MURQ_BACCZ       NKNAEISKYAKLNVEVETGAEILTGSTRLKAGTAQKLVLNMISTASMIGVGKVYKNLMVD
MURQ_BACHK       NKNAEISKYAKLNVEVETGAEILTGSTRLKAGTAQKLVLNMISTASMIGVGKVYKNLMVD
MURQ_BACCR       NKNAEISKYANLNVEVETGAEILTGSTRLKAGTAQKLVLNMISTASMIGVGKVYKNLMVD
MURQ_BACC1       NKNAEISKYAKINVEVGTGAEILTGSTRLKAGTAQKLVLNMISTASMIGVGKVYKNLMVD
MURQ_LISMF       NANAKISAHADIAVEVVTGAEILTGSTRLKAGTAQKLVLNMISTASMVGIGKVYKNLMVD
MURQ_BACSK       NKEAKMSQYASVAIEVETGPEVLTGSTRLKAGTAQKLILNMISTTAMVGIGKVYQNLMVD
MURQ_OCEIH       NKNSEIGKIAEIAIEAETGPEVITGSTRLKAGTAQKLILNMISTASMIGVGKVYENLMVD
MURQ_FRATH       TKQAKISKYAKYSIEAVPGPEVLTGSTRLKAGTTQKLILNMISTLSMVSVGKVYQNLMVD
MURQ_FRATT       TKQAKISKYAKYSIEAVPGPEVLTGSTRLKAGTTQKLILNMISTLSMVSVGKVYQNLMVD
MURQ_BACHD       NRGAAISRIATYPIEVETGSEVLTGSTRLKAGTAQKLVLNMISTTVMIGLGKAYKNLMVD
MURQ_STAAC       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAAM       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAAN       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAAR       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAAS       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAAW       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAA3       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAA8       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAAB       NEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMID
MURQ_STAS1       NTNTKISDLAQYPIEVNVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMVD
MURQ_STAEQ       NVHSDISKNSNHVLEINVGPEVLTGSTRLKSGTAQKLVLNMISTMTMIGVGKVYDNLMVD
MURQ_STAES       NVHSDISKNSNHVLEINVGPEVLTGSTRLKSGTAQKLVLNMISTMTMIGVGKVYDNLMVD
MURQ_STAHJ       NTNSDISTVASHALEVNVGPEVLAGSTRLKSGTAQKLVLNMISTMTMIGVGKVYDNLMVD
MURQ2_ENTFA      NKNAEISKYAQMPIEVDAGPEFLTGSTRLKSGTAQKLILNMLSTISMIGIGKVYNNLMVD
MURQ_LACLA       NLNAEISKHAEFPIEVDCGPEFLTGSTRLKSGTAQKLILNMISTISMIGIGKVYNNLMVD
MURQ2_LACPL      NADASISQHAQIPIEVEVGPEILTGSTRLKSGTAQKLVLNMLSTASMVGIGKVYKNLMVD
MURQ1_LACPL      NNQALISQHARVAIEVTPGPEVLAGSTRLKAGTAEKMVLNMLSTISMVKIGKVYHNLMVD
MURQ_BACFN       NPNSPMAAEADIPIEMIVGPEYVTGSSRMKSGTGQKMILNMITTSVMIQLGRVKGNKMVN
MURQ_BACFR       NPNSPMAAEADIPIEMIVGPEYVTGSSRMKSGTGQKMILNMITTSVMIQLGRVKGNKMVN
MURQ_BACTN       NPNSPMATEADVPIEVIVGPEYVTGSSRMKSGTAQKMILNMISTTIMIELGRVQGNKMVN
MURQ_PORGI       NIESPLAAEADCPIEVIVGPEYVTGSSRMKSGTAQKMILNMISTSIMIRLGRVKGNRMVN
MURQ_JANSC       NPGSPMADLADIAISPVVGPEVVTGSTRLKSGTAQKMILNMLSTASMIRLGKTWGNRMVD
MURQ_RHOBA       NPNCQLRPLSQIMIAPIVGPEIVSGSTRMKAGTATKMVLNMLTTGAMIRIGKTYGNRMVD
MURQ_SYNJB       NHPSPLTEQVDIAIAPLVGPEVILGSTRMKAGTAQKLVLNTISTGVMIRLGKTYGNLMVD
MURQ_STRAW       NADSALAAAADHGIEIVAGPELLTGSTRLKAGTAQKLVLNMLSTITMIRLGKTYGNLMVD
MURQ_STRCO       NRDSALAAAAEHGIEVVTGPELLTGSTRLKAGTAQKLVLNMLSTITMIRLGKTYGNLMVD
MURQ_SALRD       IPREELDVDPDVAICPVVGPEVIMGSTRMKSGTAQKLVLNMITTAAMVRLGKVYENMMVD
MURQ_SYMTH       NPDSALAAAADVAIAPVVGPEVIMGSTRMKAGTAQKMVLNMLSTGAMIRLGKVYSNLMVD
MURQ2_BACLD      NADTEAGKLSDIAIEVQTGPEIIRGSTRLKAGTAQKMILNMLSTAAMVRLGRVYQNEMVN
MURQ_THEFY       DPHSALAADVDVHIGVATGAEVIAGSTRMKAGTAQKLILNAFSTAVMVRLGYTYSNLMVG
MURQ_DEIGD       NPGTPLLAAAECPILLDTGPEVISGSTRLKAGTAQKIALNTLSSALMVRLGKVYGNLMVD
MURQ_DEIRA       NPGAPLLAAVDCPVLLDTGPEIISGSTRLKAGTAQKIALNTLSSALMVRLGKLYGNLMVD
MURQ_CUTAK       NHRAVISSEVDLPVEIDAGPEVLTGSTRLKAGTVQKLVLNMISTATMVGLGKTYGNLMVD
MURQ_BURL3       NVGSEAAALADVAIEVDCGPEVLTGSTRLKAGTAQKMICNMLSTISMVALGKTYGNLMVD
MURQ_SYNE7       VPADQVAIAVDVDIRVPVGPEILAGSTRLKAGTVTKMVLNQISTGAMVRIGKVYGNRMVD
MURQ_SYNP6       VPADQVAIAVDVDIRVPVGPEILAGSTRLKAGTVTKMVLNQISTGAMVRIGKVYGNRMVD
MURQ_NOSS1       VPAEQVSFTADIDIRLLTGPEILAGSTRLKAGTVTKLTLNILSTGVMVKLGKVYGNRMVD
MURQ_TRIV2       VPAEQVSFTADIDIRLLTGPEILAGSTRLKAGTVTKLTLNILSTGVMVKLGKVYGNRMVD
MURQ_SYNY3       VPESQAPCQADVNIRLLTGPEILAGSTRLKAGTVTKMALNILSTGAMVKLGKVYGNRMVD
MURQ_THEEB       VPVEQVQRSADIDIRLLVGPELLAGSTRLKAGTATKMALNIISTGVMVQLGKVYGNRMVD
MURQ_GLOVI       VPTNQIPERWDIEIRVPVGPEVLAGSTRLKAGTATKLVLNILSTGAMVRLGKTYGNLMVD
MURQ_PROMA       VPEQQASFGSNITIRLITGPEIIAGSTRLKAGTATKMALNIISSGVMIKLGKVFDNKMID
MURQ_PROMT       VPERDSTLDNDIDIRLITGPEILAGSTRLKAGTATKMALNIISTSVMIKLGKVYGNRMID
MURQ_SYNS9       VPKDQAPLPCDIDIRLLTGPELLTGSTRLKAGTATKMALNILSTTVMVRLGKVYGNRMVD
MURQ_SYNSC       VPTEQAPLPCDIDIRLLTGPELLTGSTRMKAGTATKLALNTLSTAVMVKLGKVYGNRMVD
MURQ_SYNPX       VPSDQAPLPCDIDIRLLTGPELLTGSTRLKAGTATKMALNIISTAVMVRLGKVFGNRMVD
MURQ_PROMM       VPIEQAELPCSIDIRLLTGPELLTGSTRLKAGTATKMALNILSTCAMVRLGKVFGNRMVD
                              :    *.* : **:*:*:.:  *:  * :::  *:  *    * *:.

MURQ_SHIBS       VVATNEKLHVRQVNIVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQ
MURQ_SHISS       VVATNEKLHVRQVNIVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQ
MURQ_SHIFL       VVATNEKLHVRQVNIVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQ
MURQ_ECOLI       VVATNEKLHVRQVNIVKNATGCSAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQ
MURQ_ECO57       VVATNEKLHVRQVNIVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQ
MURQ_SHIDS       VVATNEKLHVRQVNIVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQ
MURQ_ECOL6       VVATNEKLHVRQVNIVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDADEAKKCLDQ
MURQ_ECOUT       VVATNEKLHVRQVNIVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDADEAKKCLDQ
MURQ_VIBVU       VEATNAKLIQRQTNIVVEATGVCAEEAEEALKACDRHCKTAILMILSGLDAEQAKTKLQQ
MURQ_VIBVY       VEATNAKLIQRQTNIVVEATGVCAEEAEEALKACDRHCKTAILMILSGLDAEQAKTKLQQ
MURQ2_VIBPA      VEATNAKLIQRQTNIVVEATGASKEEAERALNACDRHCKTAILMILADLDAEQAKSRLAA
MURQ1_VIBCH      VEATNAKLIQRQTNIVVEATGVSAEQAEAALAACGRHCKTAILMILGGFSAEQAAQKLTQ
MURQ_PHOLL       VEATNAKLVERQKNIVIAATECNREQAEQALAECDGHCKTAIVMILAGINAQQAKTLLKK
MURQ_PHOPR       VEATNAKLVERQKKIVIEATDCSREEAESALAACNGHCKTAIVMVLAQLSAEEAKQLLDN
MURQ_ALIF1       VEATNAKLVQRQKNIVIEATGCSEVEASEALSQCDNHCKTAILMVLSGLDAQSAKAKLAQ
MURQ_PASMU       VVATNEKLVERQKNIVMEVTQCDRQQAEQALLQSNGQCKVAIVMLLLNMSAEEAKNCLAQ
MURQ_SALTY       MKATNVKLVDRACRMVVEATGIGREEAEALLKQTDFEVKPAILMALTGLDAAAAREKLAA
MURQ_SALPA       MKATNVKLVDRACRMVVEATGIGREEAEALLKQTDFEVKPAILMALTGLDAAAAREKLAA
MURQ_SALCH       MKATNVKLVDRACRMVVEATGIGREEAEALLKQTDFEVKPAILMALTGLDAAAAREKLAA
MURQ_SALTI       MKATNVKLVDRACRMVVEATGIGREEAETLLKQTDFEVKPAILMALTGLDAAAAREKLAA
MURQ_YERPE       VKATNVKLVDRACRIVVEATGVSRAEAEHALRQTDFEVKPAILMLLKGVSAEQARQDLRQ
MURQ_YERPS       VKATNVKLVDRACRIVVEATGVSRAEAEHALRQTDFEVKPAILMLLKGVSAEQARQDLRQ
MURQ_PECAS       VKATNVKLLDRACRIVVEATGADLDSARQALEQSDNDVKPAILMLLANIGVEAARERLKQ
MURQ_HAEIN       VQASNEKLKARAVRIVMQATDCNKTLAEQTLLEADQNAKLAIMMILSTLSKSEAKVLLER
MURQ_MANSM       VQASNEKLRARAIRIVMQATDCEKEVAERFLKAADNNAKLAIMMVLTNLDKQQASVLLQR
MURQ2_VIBCH      VRATNRKLIARAVRIVMQATDCQREEAEALLKESHNNAKLAILMHLTGMNYEQATAKLSQ
MURQ1_VIBPA      VKATNNKLVARAARIVMQATECTKEEATEVLKQTNYEVKLAILMILTDLDIESARQHLHH
MURQ_RHILO       LNPSNKKLVARATRMVMQTTGCTAQQAKQALHQTSNDVKLAILVTITGLDVEAARAALGK
MURQ_COLP3       VNASNKKLYARAVRIVMQATECDFDTAEMALAQANNQTKLASLMVLTGLDSTQAKAALAS
MURQ_BACSU       VNVSNKKLKERAISIIQSLTNASYDTARYTLEQADHHVKTAIVMLKTSTDQKQAQTLLDE
MURQ1_BACLD      VKVSNDKLKERAIRIIQTVTGMPNETAAQALEMSNNQVKTAIIMLKTNEDAAAAEKLLEK
MURQ_LACAC       VMPTNSKLVDRASRIISAVTDATQEEALQTLKKAENNVPLAITMIKTESNKDEAQKLLEQ
MURQ_LACJO       VMPTNSKLVDRACRIIEVATGVSESVASDTLEKADMNVAVAITMLKTGVDKEKAMDILKE
MURQ1_ENTFA      VQPTNEKLIQRATNIIKEAAEIEESQAKEYLEAAQLEVAPAIVMAKAHVDFQKAKQLLAE
MURQ_CLOAB       LSLSNKKLIDRAVRIIEHATKVEKEKAMEYLKRANLKPKVAIVMIKTNTKSYEAERLLNM
MURQ_MYCMS       LVATNDKLKNRAFKIVKQLTSAKDQIIYKALAESNFSCKHAIVMILRKISYNESVLLLEN
MURQ_CALS4       LQASNEKLRERARRMVKLATGAKEDLIERVLNETNYNVKLAILMIVGDMEKEKAQKLLEM
MURQ_BACAN       VQSTNEKLVERSKRIIVEATGVSYEVAAEHYEKAERNVKAAIVMVLLQCEYGEALEKLKQ
MURQ_BACCZ       VQSTNEKLVERSKRIIVEATGVSYEVAAEHYEKAERNVKAAIVMVLLQCEYGEALEKLKV
MURQ_BACHK       VQSTNEKLVERSKRIIVEATGVSYEVAAEHYEKAERNVKAAIVMVLLQCEYGEALEKLKV
MURQ_BACCR       VQSTNEKLVERSKRIIVEATGASYEVAAEYYEKAERNVKAAIVMVLLQCEYGEALEKLKY
MURQ_BACC1       VQSTNEKLVERSKRIIVEATGVSYEVAAEYYEKAERNVKAAIVMVLLQCEYGEALQKLKE
MURQ_LISMF       VLPTNKKLEERSKRIIMEATEADYETANKFYEAAEKHVKVAIVMILTNSTKEIALEKLSE
MURQ_BACSK       VQPTNQKLVERAKRIIMEATDSTYETAADYYQKANGHVKAAIVMILLDCSYDEALTKLQN
MURQ_OCEIH       LKPTNKKLVDRSKRIIMEATQVDYTTAENYLQKANNSVKTAIVMILLNCNVDEAIQHLDR
MURQ_FRATH       VKPTNQKLIERSKNIICEVTGVDYTTAEKFYLKANKSVKVAIVMILNNCDYEKALAILKN
MURQ_FRATT       VKPTNQKLIERSKNIVCEATGVDYTTAEKFYLKANKSVKVAIVMILNNCDYEKALAILKN
MURQ_BACHD       LKPTNEKLRERSKRIIMEATDVEAAVAEKHLREAGGVVKVAIITILTGCSVDQAQMTLDR
MURQ_STAAC       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAAM       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAAN       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAAR       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAAS       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAAW       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAA3       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAA8       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAAB       VKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLN
MURQ_STAS1       VKATNQKLIDRSIRIIQDICDISYNQAQSLYESADQNLKVAVVMHLCDINKSEAVTRLND
MURQ_STAEQ       LRPTNQKLIHRSIRIIQDVCDLNHQEAIELYEKSDHNIKIAIVMHLCSTTQQDARLRLKQ
MURQ_STAES       LRPTNQKLIHRSIRIIQDVCDLNHQEAIELYEKSDHNIKIAIVMHLCSTTQQDARLRLKQ
MURQ_STAHJ       LKATNHKLEQRSIHIIEEICGLTFEEAQELYIKADNDIKIAIVMNLCNTTKSDAQSRLIN
MURQ2_ENTFA      VKPTNEKLVERSKRIIMEATGCSYEVAELKFVEAEENVKLAIVMILTDSTKEEATQKLID
MURQ_LACLA       VKPTNEKLVERSKRIIMQATDCTYEEAEEKFIEADQDVKLAIVMLLTDCAAEEGKTKLVR
MURQ2_LACPL      VKPTNEKLVERAKRIIVQATDCSDETAVKVFMTADQNVKLAIVMVLTNMSKAEASVRLDH
MURQ1_LACPL      VKPTNEKLVIRAKHMIELATGVSADEASELFAAAHQNVKTAIVMDLAGVSVSDAEQRLQR
MURQ_BACFN       MQLSNRKLVDRGTRMIIEELGLEYDKAKALL-LMHGSVKKAI---------DAYKAG---
MURQ_BACFR       MQLSNRKLVDRGTRMIIEELGLEYDKAKALL-LMHGSVKKAI---------DAYKAG---
MURQ_BACTN       MQLSNQKLIDRGTRMIIEELHLDYEKAEALL-LLHGSVKSAI---------EAYRRHNST
MURQ_PORGI       MQLSNNKLIDRGTRMLMSEFDLSYEDARTLL-LRYGSVRIAS---------ESMKQKPPK
MURQ_JANSC       VTISNRKLADRATAMLRDATGCSADDARTLLDQSNGSVKLAILMQITGCDADAARANLEA
MURQ_RHOBA       VRATNEKLVARSRQMLSEIVGISGDQAEQLLQQCDGEVKTAIVVHIKEVSPQTARQMLVD
MURQ_SYNJB       LQASNAKLKQRAERMVALACDLDPAAAAQLLQACDGEVKTAILVALMGCSAQEARQHLQQ
MURQ_STRAW       VRASNEKLRARSRRIVALATGAADEEVERALAATDGEVKNAILTILGGVDGPTAARLLEE
MURQ_STRCO       VRASNEKLRARSRRIVALATGAADDDIERALTATDGEVKDAILVLLADVDGPTAARLLAE
MURQ_SALRD       LRRTSEKLVERGIRTVMMVTGVDYDAADAVLTRCDGHVKTALVMILADVEVDEARRRLDA
MURQ_SYMTH       MQASNEKLRHRAVRMVVQATGRDEDAAARALEEAGGSVKQAIVALLAGVDARTAREALDR
MURQ2_BACLD      MRLLNQKLAGRAVTILMNTTGLSEDEALQALKESGNDIKAAIFMTLTNGTLEVARRCLSH
MURQ_THEFY       VVATNAKLRGRMVTILTEATGLSEEDCAEALHRADGDTRIALVCLLTGVDVPTAAHALHA
MURQ_DEIGD       VKVSNAKLETRALRLTCHATGASEAEARAALAQAGGRVKTALVMLRLGLSAPEAEVRLQA
MURQ_DEIRA       VRATNAKLEDRARRLVQHATGADADAAQAALSECGGSVKTALVMLKLGLGAQEAAQRLEG
MURQ_CUTAK       VSPSNEKLRQRAMSIVMAATGCSCDDAITALHEAGGHAKTAIVMVLLGMTATQARARLAE
MURQ_BURL3       VQVHNHKLRRRAIGIVSQAAGVPTDVAERALEQAGDRPRIAILMLCAGVDRAGAERLADA
MURQ_SYNE7       VAVTNRKLEDRALRILSDLLSIDRQQAAALLGANERSVKQALLQHWTGLEPAEAAALLTE
MURQ_SYNP6       VAVTNRKLEDRALRILSDLLSIDRQQAAALLGANERSVKQALLQHWTGLEPAEAAALLTE
MURQ_NOSS1       VAVTNQKLRDRALRILQDLTGLSREAAGFLLERSSKWVKLALVMHWTGLDKDAGDRLLSA
MURQ_TRIV2       VAVTNQKLRDRALRILEDLTGLSREAAGFLLERSGKWVKLALVMHWTGLDKDAGDRLLSA
MURQ_SYNY3       VAVTNRKLEDRAIRILRDLTDLNREEAAELLVASGQRVKLALLMHWSGLSAESAQAQLDR
MURQ_THEEB       VAVSNRKLLDRALRILTDVTGMDRAAAAALLERSGYQVKRALLMHWTGLDAPAAQALLDQ
MURQ_GLOVI       VAVSNQKLRDRAVRILTTLTELERTAALALLEASGLRVKVALLMHWSNQDPASCATALEA
MURQ_PROMA       VSISNKKLFDRALRITSSLLNIEMKEAQLLLDQAKGSIKVACIIKSSGMDQKSAFALLER
MURQ_PROMT       LSVSNDKLLDRAIGILFDIGSVDKVTAVQLLKKTNGSVKLSLLIALSGMDVIDAKQLLND
MURQ_SYNS9       VAASNSKLVDRSLRILRDLIGVEREEGLALLALSDGSVKLALLMKAANLSKDQARSVLER
MURQ_SYNSC       VAASNSKLVDRSLRILRDLAGVERERGLTLLEEAGGSVKLALLMAAAGLSVDQAKAHLQQ
MURQ_SYNPX       VSASNSKLVDRCLRILRDLGGIERDDGLVLLDQAGGSVKLALLMASSGLASSEAMELLQT
MURQ_PROMM       VAATNIKLMDRALRILHDLADVDRVRGTELLQASDGSVKVALLMHTCGLDAETAQKLLIE
                 :   . **  *                             :                   

MURQ_SHIBS       HGGFIRQVLDKE--------
MURQ_SHISS       HGGFIRQVLDKE--------
MURQ_SHIFL       HGGFIRQVLDKE--------
MURQ_ECOLI       HGGFIRQVLDKE--------
MURQ_ECO57       HGGFIRQVLDKE--------
MURQ_SHIDS       HGGFIRQVLDKE--------
MURQ_ECOL6       HGGFIRKALEKE--------
MURQ_ECOUT       HGGFIRKALEKE--------
MURQ_VIBVU       HNGFIRAALNDK--------
MURQ_VIBVY       HNGFIRAALNDK--------
MURQ2_VIBPA      HNGFIRAALNNN--------
MURQ1_VIBCH      HQGFIRAALNQE--------
MURQ_PHOLL       HHGFIRPTISAVR-------
MURQ_PHOPR       NKGFIRAAIAAGK-------
MURQ_ALIF1       HNGFIRNALSDQ--------
MURQ_PASMU       ANGFIHQALTLVK-------
MURQ_SALTY       HQGFLRAALEH---------
MURQ_SALPA       HQGFLRAALEH---------
MURQ_SALCH       HQGFLRAALEH---------
MURQ_SALTI       HQGFLRAALEH---------
MURQ_YERPE       HHGYLRAAL-----------
MURQ_YERPS       HHGYLRAAL-----------
MURQ_PECAS       HNGYLREALLGG--------
MURQ_HAEIN       HQGKLRNALSK---------
MURQ_MANSM       HQGKLSRALSQ---------
MURQ2_VIBCH      SDGFLRRAMEEHEE------
MURQ1_VIBPA      QDGFLRKAVESHKSN-----
MURQ_RHILO       AGGFLRKAISDPTA------
MURQ_COLP3       NKGFLRKAVEQQGC------
MURQ_BACSU       ANGFIDKAIEHYHP------
MURQ1_BACLD      SEGDIEKALSIYEKS-----
MURQ_LACAC       YNGNVSEVIKNN--------
MURQ_LACJO       CNGNISSVVNNY--------
MURQ1_ENTFA      HDGRISEVLA----------
MURQ_CLOAB       ADGFVTKAIKLGSK------
MURQ_MYCMS       CDNSLTKLLEEKV-------
MURQ_CALS4       ADGYIAEAIKLKDLVLQGEE
MURQ_BACAN       AKGFVKKAL-----------
MURQ_BACCZ       AKGFVKKAL-----------
MURQ_BACHK       AKGFVKKAL-----------
MURQ_BACCR       AKGFVKKAL-----------
MURQ_BACC1       AKGFVKKAL-----------
MURQ_LISMF       AKGFVRNTIQK---------
MURQ_BACSK       AKGFIRKTVDK---------
MURQ_OCEIH       AEGFIRKTK-----------
MURQ_FRATH       NNNFIKS-------------
MURQ_FRATT       NNNFIKS-------------
MURQ_BACHD       NGGFIRKAVHELN-------
MURQ_STAAC       NGDIVKRAIRDRQP------
MURQ_STAAM       NGDIVKRAIRDRQP------
MURQ_STAAN       NGDIVKRAIRDRQP------
MURQ_STAAR       NGDIVKRAIRDRQP------
MURQ_STAAS       NGDIVKRAIRDRQP------
MURQ_STAAW       NGDIVKRAIRDRQP------
MURQ_STAA3       NGDIVKRAIRDRQP------
MURQ_STAA8       NGDIVKRAIRDRQP------
MURQ_STAAB       NGDIVKRAIRDRQP------
MURQ_STAS1       NNHIIKKAIQN---------
MURQ_STAEQ       NNGVIKQAINT---------
MURQ_STAES       NNGVIKQAINT---------
MURQ_STAHJ       NNDIVKKAIQS---------
MURQ2_ENTFA      GNQFIKNTLN----------
MURQ_LACLA       ANGFVKNTLN----------
MURQ2_LACPL      ANGFVRQAVN----------
MURQ1_LACPL      AHGVVRDALALQ--------
MURQ_BACFN       --------------------
MURQ_BACFR       --------------------
MURQ_BACTN       QQE-----------------
MURQ_PORGI       K-------------------
MURQ_JANSC       ENGFLRKAIERAEKTPPQS-
MURQ_RHOBA       VDGHLSRLLATPSE------
MURQ_SYNJB       AQGNIRQVLDSVLAQRR---
MURQ_STRAW       SDGHLRAALAAAPR------
MURQ_STRCO       SGGHLRAAMAAALG------
MURQ_SALRD       TDGFVRPAIEGDE-------
MURQ_SYMTH       AGGYVREAIRLAQGK-----
MURQ2_BACLD      ENGHLKKAIQYHRKGF----
MURQ_THEFY       AHGSVRAALRELART-----
MURQ_DEIGD       AGGHARVALGEG--------
MURQ_DEIRA       AGGHARQVLGEGEALGTSAS
MURQ_CUTAK       VGGVVRVAVDENHLRL----
MURQ_BURL3       AGGSIRKALATLAPSTRA--
MURQ_SYNE7       HQGHLRAAVTAFSSLR----
MURQ_SYNP6       HQGHLRAAVTAFSSLR----
MURQ_NOSS1       HQGNLREAVASYKNQND---
MURQ_TRIV2       HQGNLREAVASYKNQGN---
MURQ_SYNY3       HGGNLRQAMDAAP-------
MURQ_THEEB       QNGQLHAARSAALDP-----
MURQ_GLOVI       AGGLLPVALEKLSGR-----
MURQ_PROMA       NNHNLRKALKDINIEF----
MURQ_PROMT       SKGNLRTALIRVKGN-----
MURQ_SYNS9       HDQQLRPSLETCGATLAQL-
MURQ_SYNSC       YDQQLRPALAAYGAQLAEA-
MURQ_SYNPX       HDGQLRQAFASRGLKLAQS-
MURQ_PROMM       HNNQLRTALARCKNCIA---