CLUSTAL format seed alignment for MF_00071

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LEPA1_LACPL      -------------------------------------------------------MDKAT
LEPA_LACJO       -------------------------------------------------------MDIKK
LEPA_OCEIH       ------------------------------------------------------------
LEPA_STAES       -------------------------------------------------------MDKQE
LEPA_STRP3       -------------------------------------------------------MNSQD
LEPA_ONYPE       -------------------------------------------------------MNIEQ
LEPA_MYCGA       -------------------------------------------------------MD---
LEPA_MYCPN       -------------------------------------------------------ME---
LEPA_MYCPE       -------------------------------------------------------MD---
LEPA_UREPA       -------------------------------------------------------MD---
LEPA_MYCPU       -------------------------------------------------------MN---
LEPA_FUSNN       -------------------------------------------------------MEAIM
LEPA_CLOTE       -----------------------------------------------------------M
LEPA_CALS4       ------------------------------------------------------------
LEPA_SYNPX       -----------------------------------------------------------M
LEPA_SYNY3       -----------------------------------------------------------M
LEPA_GLOVI       -----------------------------------------------------------M
LEPA_DEIRA       ------------------------------------------------------MTAGPT
LEPA_BUCAP       ------------------------------------------------------------
LEPA_BUCBP       ------------------------------------------------------------
LEPA_BLOFL       ------------------------------------------------------------
LEPA_WIGBR       ------------------------------------------------------------
LEPA_ECOLI       ------------------------------------------------------------
LEPA_PSESM       ------------------------------------------------------------
LEPA_COXBU       -----------------------------------------------------------M
LEPA_XYLFT       -----------------------------------------------------------M
LEPA_NITEU       ------------------------------------------------------------
LEPA_RALSO       ------------------------------------------------------------
LEPA_RICPR       ------------------------------------------------------------
LEPA_RHOPA       -----------------------------------------------------------M
LEPA_BDEBA       ------------------------------------------------------------
LEPA_GEOSL       ------------------------------------------------------------
LEPA_HELPJ       --------------------------------------------------------MKEK
LEPA_WOLSU       ------------------------------------------------------------
LEPA_STRCO       ------------------------MPAIP-------------------------SHVPEP
LEPA_MYCPA       -----------MRLPAGRHIRSIDAPIVPQSGRADTLDTLANRRLAGPDQEIPISSFADK
LEPA_BIFLO       ----------------------------------------------------MVVQHNQP
LEPA_TROWT       ----------------------------------------------------------MT
LEPA1_RHOBA      --------------------------------------------------------MASK
LEPA_CHLTE       ---------------------------------------------------------MPP
LEPA_PORGI       ------------------------------------------------------------
LEPA_TREPA       ----------------------------------------------------------MR
LEPA_TREDE       ------------------------------------------------------------
LEPA_BORBU       --------------------------------------------------------MVQG
LEPA2_RHOBA      ------------------------------------------------------------
LEPA_CHLTR       -----------------------------------------------------------M
LEPA_LEPIN       ------------------------------------------------------------
LEPA_THEMA       ---------------------------------------------MVKFKREVNFSGGDR
LEPA_AQUAE       ------------------------------------------------------------
GUF1_YEAST       ----------------------MLKFRIRPVRHIRCYKRHAYFLRYNHTTTPAQKLQAQI
GUF1_HUMAN       MWTLVGRGWGCARALAPRATGAALLVAPGPRSAPTLGAAPESWATDRLYSSAEFKEKLDM
                                                                             

LEPA1_LACPL      MQDRQQHIRNFSIVAHIDHGKSTLADRILELTDTIS-KREMQ--DQVLDSMDLERERGIT
LEPA_LACJO       LQDYQKHIRNFSIVAHIDHGKSTIADRILELTDTVS-ERQMK--NQLLDDMPLERQRGIT
LEPA_OCEIH       MANKKRNVRNFSIIAHIDHGKSTLADRILENTKTVT-KREMK--DQLLDGMDLERERGIT
LEPA_STAES       RYNRRENIRNFSIIAHIDHGKSTLADRILENTKSVE-TREMQ--DQLLDSMDLERERGIT
LEPA_STRP3       LKKRQEKIRNFSIIAHIDHGKSTLADRILEKTETVS-SREMQ--AQLLDSMDLERERGIT
LEPA_ONYPE       LKERQKRIRNFSIIAHIDHGKSTLADRILEFTGTID-KRIMK--EQILDSMDLERERGIT
LEPA_MYCGA       ----KKNIRNFSIIAHIDHGKSTLSDRLIEITETVS-KREMK--NQLLDSMELERERGIT
LEPA_MYCPN       ----QQKIRNFSIIAHIDHGKSTLSDRLIERSIGFE-KRLLQ--AQMLDTMAIERERGIT
LEPA_MYCPE       ----KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLT-TREMK--NQILDSMDIERERGIT
LEPA_UREPA       ----KKFIRNFSIIAHIDHGKSTLSDRIIEFTNTLS-KREMT--NQILDSMDIERERGIT
LEPA_MYCPU       ----KSKIRNFSIIAHIDHGKSTLADRILEITQTVS-TRELK--AQHLDSMDLEQERGIT
LEPA_FUSNN       L---QKNKRNFSIIAHIDHGKSTIADRLLEYTGTVS-ERDMK--EQILDSMDLEREKGIT
LEPA_CLOTE       TSERQKRVRNFSIIAHIDHGKSTLADRLLEETGTLT-QREMD--EQTLDTMDLEKERGIT
LEPA_CALS4       MSERMKYIRNFCIIAHIDHGKSTLADRLIEKTGFLS-EREMD--KQILDNLELERERGIT
LEPA_SYNPX       TDAPVSRIRNFCIIAHIDHGKSTLADRLLQDTGTVA-NRDMQ--EQFLDNMDLERERGIT
LEPA_SYNY3       TDVPVSRIRNFSIIAHIDHGKSTLADRLLQVTDTVQ-QREMK--EQFLDNMDLERERGIT
LEPA_GLOVI       TAVPVSQIRNFSIIAHIDHGKSTLADRLLQVTGTVS-DRNMT--AQYLDNMDLERERGIT
LEPA_DEIRA       DPTPTSQIRNFSIIAHVDHGKSTLADRILEQLGAMG-ERDKR--DQTLDTLELERERGIT
LEPA_BUCAP       MVKKMKNIRNFSIIAHIDHGKSTLSDRLIQKCGGLS-EREMS--DQVLDSMDLEKERGIT
LEPA_BUCBP       ----METIRNFSIIAHVDHGKSTISDRLIQICGGLS-KREMH--SQVLDSMDLEKERGIT
LEPA_BLOFL       ----MKYIRNFSIIAHVNHGKSTLSDRFIQICGGLC-DREMM--SQVLDSMELERERGIT
LEPA_WIGBR       ----MENIRNFSIIAHINHGKSTLSDRLIQICGNIS-NREMS--NQILDTMDLERERGIT
LEPA_ECOLI       ----MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLS-DREME--AQVLDSMDLERERGIT
LEPA_PSESM       ----MSHIRNFSIIAHIDHGKSTLADRFIQMCGGLS-EREME--AQVLDSMDLERERGIT
LEPA_COXBU       TTISQKFIRNFSIIAHIDHGKSTLADRFIQLCGGLS-EREMK--AQVLDSMDIERERGIT
LEPA_XYLFT       SSDPMRNIRNFSIIAHVDHGKSTLADRIIQLCGGLE-AREME--AQVLDSNPIERERGIT
LEPA_NITEU       ---MIQHIRNFSIIAHIDHGKSTLADRIIQFCGGLS-DREME--DQVLDSMDLERERGIT
LEPA_RALSO       ----MDNIRNFSIIAHIDHGKSTLADRIIQLCGGLS-DREME--AQVLDSMDIEKERGIT
LEPA_RICPR       -MNNQKYIRNFSIIAHIDHGKSTLADRLIEYCGGLN-AREMS--QQVLDSMDIERERGIT
LEPA_RHOPA       TTAPIDNIRNFSIVAHIDHGKSTLADRLIQITGGMS-DREMAGKEQVLDSMDIERERGIT
LEPA_BDEBA       --MDPKYIRNFSIIAHIDHGKSTLADGLLSATGSLS-DREKK--DQFLDNMELERERGIT
LEPA_GEOSL       --MKIDTIRNFSIIAHIDHGKSTLADRLLEYTGALT-EREMQ--DQFLDKMDLERERGIT
LEPA_HELPJ       TPTPMKNIRNFSIIAHIDHGKSTLADCLIAECNAIS-NREMK--SQVMDTMDIEKERGIT
LEPA_WOLSU       ----MKNIRNFSIIAHIDHGKSTLADRLIQECGAVE-ARDMK--AQLMDTMDIEKERGIT
LEPA_STRCO       SRTDPALIRNFCIIAHIDHGKSTLADRMLQLTGVVE-QRQMR--AQYLDRMDIERERGIT
LEPA_MYCPA       TFTAPAQIRNFCIIAHIDHGKSTLADRMLQLTGVVD-ERSMR--AQYLDRMDIERERGIT
LEPA_BIFLO       GSTDQSVIRNFCIIAHIDHGKSTVADRILQLSGIVP-EREMR--DRFLDRMDIEQERGIT
LEPA_TROWT       DRVLPEQIRNFGIIAHVDHGKSTLADRILQLTGAVS-DRDMR--EQYLDRLYIERERGIT
LEPA1_RHOBA      SSRSQEHIRNFCIIAHIDHGKSTLADRLLESTGTVD-NRGKK--TQMLDDLALEQQRGIT
LEPA_CHLTE       TGTEVGMIRNFCIIAHIDHGKSTLADRLLEVTHTLERNQMST--AQVLDDMDLERERGIT
LEPA_PORGI       ----MKNIRNFCIIAHIDHGKSTLADRLLEYTNTVS-GKDLQ--DQVLDNMDLERERGIT
LEPA_TREPA       AMACVRRVRNFCIVAHIDHGKSTLADRLIERTRAVE-ERLQH--AQMTDNMELERERGIT
LEPA_TREDE       -MLNPENIRNFCIVAHIDHGKSTLSDRLIEKTKIID-ERYHR--NQMTDDMDIERERGIT
LEPA_BORBU       GSSISIRKKNFCIIAHIDHGKSTLADRFIQKAKIIS-DRDFK--SQMLDSMDIERERGIT
LEPA2_RHOBA      ----MKHIRNFCIIAHIDHGKSTLADRLIQSCGGVT-QREFH--DQMLDSMDIERERGIT
LEPA_CHLTR       KPYKIENIRNFSIIAHIDHGKSTIADRLLESTSTIE-QREMR--EQLLDSMDLERERGIT
LEPA_LEPIN       MSDKQQFIRNFSIIAHIDHGKSTLADRLLEIGQVTN-DRTKK--DQILDSMDIERERGIT
LEPA_THEMA       GVYRPDLIRNICIIAHIDHGKTTLVDRILEITNTVD-RRKMR--EQYLDMMDIERERGIT
LEPA_AQUAE       --MEQKNVRNFCIIAHVDHGKSTLADRLLEYTGAIS-EREKR--EQLLDTLDVERERGIT
GUF1_YEAST       EQIPLENYRNFSIVAHVDHGKSTLSDRLLEITHVIDPNARNK---QVLDKLEVERERGIT
GUF1_HUMAN       SRFPVENIRNFSIVAHVDHGKSTLADRLLELTGTIDKTKNNK---QVLDKLQVERERGIT
                         :*: *:**::***:*: * ::                :  *   :*:::***

LEPA1_LACPL      IKLNAVELHYQ-AK---DGETYIFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGVE
LEPA_LACJO       IKLNSVEVKYH-AK---DGETYIFHLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVQ
LEPA_OCEIH       IKLNAVQLAYT-SN---KGEDFIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIE
LEPA_STAES       IKLNAVRLKYE-AK---DGETYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIE
LEPA_STRP3       IKLNAIELNYT-AR---DGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIE
LEPA_ONYPE       IKLNAVEINYK-SK---DGKNYIMHLIDTPGHVDFSYEVSRSLAACEGAILIIDAAQGIQ
LEPA_MYCGA       IKLNAVQLKFK--R---NNQDYTFHLIDTPGHVDFTYEVSRSLAACEAALLVVDATQGVQ
LEPA_MYCPN       IKLNAVQLKMA--Q---GNQQYLFHLVDTPGHVDFTYEVSRSLAACEGVLLLVDATQGIQ
LEPA_MYCPE       IKLNAVQLIYHNPK---DNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVE
LEPA_UREPA       IKLNAVQIKYH-AK---DKHEYLIHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIE
LEPA_MYCPU       IKLNAVQIKYK---------DYIFHLIDTPGHVDFTYEVSRSLAASEGALLLVDATQGIE
LEPA_FUSNN       IKAQAVTLFYK-AK---NGEEYELNLIDTPGHVDFIYEVSRSLAACEGALLVVDAAQGVE
LEPA_CLOTE       IKSQAARLIYK-RD---DEKEYILNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQ
LEPA_CALS4       IKLKPVRMIYK-AK---DGNEYELNLIDTPGHVDFTYEVSRSIAACEGALLVVDASQGIE
LEPA_SYNPX       IKLQAARMNYT-AT---DGQQYVLNLIDTPGHVDFSYEVSRSLQACEGALLVVDASQGVE
LEPA_SYNY3       IKLQAARMNYK-AK---DGQDYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVE
LEPA_GLOVI       IKLQAARMEYV-AD---DGEKYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVE
LEPA_DEIRA       IKSTPIRLEYT-RE---NGEGYVFNLIDTPGHVDFNYEVSRSLAACEGVLLLVDASQGVE
LEPA_BUCAP       IKAQSVMIDYKDK----NGNVFHLNFIDTPGHVNFSYEVSRSLAACEGALLVVDSSQGVE
LEPA_BUCBP       IKSQSVTIEYKSK----CNKIIQMNFIDTPGHVDFSYEVSRSLSACEGALLIIDATQGVE
LEPA_BLOFL       IKSQSVTLNYRSRS---NEQFYQLNLIDTPGHVDFSYEVSRALAACEGAVLVVDAAQGIE
LEPA_WIGBR       IKAQSVRLNYKAK----NKKNYQLNLIDTPGHADFSYEVSRSLSACEGALLIIDSSQGIE
LEPA_ECOLI       IKAQSVTLDYKAS----DGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVE
LEPA_PSESM       IKAHSVTLYYKAK----DGITYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQGVE
LEPA_COXBU       IKAQSVTLNFKSQ----DGHFYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVE
LEPA_XYLFT       IKAQSVSLLYKAQ----DGQNYHLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVE
LEPA_NITEU       IKAQTAALHYQAK----DGKNYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVE
LEPA_RALSO       IKAQTAALSYKAR----DGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVE
LEPA_RICPR       IKAQTVRLVYKAK----NGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVE
LEPA_RHOPA       IKAQTVRLKYRAH----DGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVE
LEPA_BDEBA       IKAQTVCLDFKSK----DGNMYQINLIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVE
LEPA_GEOSL       IKAQTVRLTYRAD----DGNDYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVE
LEPA_HELPJ       IKAQSVRLNYTFK-----GEDYVLNLIDTPGHVDFSYEVSRSLCSCEGALLVVDATQGVE
LEPA_WOLSU       IKAQSVRLSYRYE-----GEDYILNLIDTPGHVDFSYEVSRSLASCEGALLVVDASQGVE
LEPA_STRCO       IKSQAVRLPWAPS--HDKGATHILNMIDTPGHVDFTYEVSRSLAACEGTILLVDAAQGIE
LEPA_MYCPA       IKAQNVRLPWQVSGGEDAGKEFVLHLIDTPGHVDFTYEVSRALEACEGAVLLVDAAQGIE
LEPA_BIFLO       IKSQAVRVPWTFD-----GTEYTLGMIDTPGHVDFTYEVSRALAACEGAVLLVDATQGIE
LEPA_TROWT       IKSQAVTLQWDCD-----ATQYVLNMVDTPGHVDFTYEVSRSLAACEAAVILVDATQGVE
LEPA1_RHOBA      IKARAVAMRYKRD-----GIEYELNLIDTPGHVDFQYEVSRSLACCEGALLLVDAFQGVE
LEPA_CHLTE       IKSHAVQMRYTAK----DGQDYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVE
LEPA_PORGI       IKSHAIQMDYEM-----DGEKYVLNLIDTPGHVDFSYEVSRSIAACEGALLIVDAAQGIQ
LEPA_TREPA       IKSHAVCIPYTDAH----GTEYVLNFVDTPGHADFAYEVSRAIAACEGALLVVDATQGVE
LEPA_TREDE       IKSHAVRIPYTAKD----GKNYVLNFVDTPGHVDFSYEVSRAIASCEGAILIVDATQGVE
LEPA_BORBU       IKSQAVTITYKSND----GDFYELNFVDTPGHVDFSYEVSRAISSCEGALLLIDASQGIQ
LEPA2_RHOBA      IKSNTVTLNYTAKD----GEAYQLNLIDTPGHVDFSHEVRRSLMACEGALMVVDASQGVE
LEPA_CHLTR       IKAHPVTMTYEYE-----GETYELNLIDTPGHVDFSYEVSRSLAACEGALLIVDAAQGVQ
LEPA_LEPIN       IKANNATFDYLAED----GNTYIMNLLDTPGHVDFTYEVSRSLKACEGVLLIVDASQGVE
LEPA_THEMA       IKAQPVKVMYTAED----GNTYEINIIDTPGHVDFSYEVGRSMAACEGAILLVDATQGVE
LEPA_AQUAE       VKMQAVRMFYKAKD----GNTYKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIE
GUF1_YEAST       IKAQTCSMFYKDKR---TGKNYLLHLIDTPGHVDFRGEVSRSYASCGGAILLVDASQGIQ
GUF1_HUMAN       VKAQTASLFYNCE-----GKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEGIQ
                 :*     .               : ::*****.:*  ** *:  .. . ::::*: :*::

LEPA1_LACPL      AQTLANVYLAIDDDLEIVPVINKIDLPSAEPEKVRKEIEDDIGIDAEDAVLASAKAGIGI
LEPA_LACJO       AQTLANTYLAIDDDLEILPVINKIDLPSADPEMCKNEIEEMIGLDASDAVEVSGKTGQGI
LEPA_OCEIH       AQTLANVYLAMENDLEIIPVINKIDLPSADTEKVKKELEDVLGIDGDDVILASAKANIGI
LEPA_STAES       AQTLANVYLALDNDLELLPVVNKIDLPAAEPDRVKQELEDVIGIDQEDVVLASAKSNIGI
LEPA_STRP3       AQTLANVYLALDNDLEILPVINKIDLPAADPERVCHEVEDVIGLDASEAVLASAKAGIGI
LEPA_ONYPE       AQTLANVYLAVDNNLTLIPVLNKVDLPSADVPKVKEEIKETLGLDPEQALIASGKTGLGV
LEPA_MYCGA       AQTLSNVYLALENNLEIIPVINKVDLPSADVERVKREIETKIGIDCSDVPLISAKTGLNI
LEPA_MYCPN       AQTISNTYLALENNLEIIPVINKVDMESADVEKTKQAFHQLLGVDPNTIPLVSAKTGLGI
LEPA_MYCPE       AQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNI
LEPA_UREPA       AQTLSNVYLALENNLEIVPTINKIDLPSADPNRVKKEIEDVIGLDTADVPLISAKTGLNI
LEPA_MYCPU       AQTLANAYLALENNLKIIPIINKIDLPSADPERIKGEIEEVIGISAKDTILISAKSGLNV
LEPA_FUSNN       AQTLANVYLAIENNLEILPIINKIDLPAAEPEKVKREIEDIIGLPADDAVLASAKNGIGI
LEPA_CLOTE       AQTLANCYLALEHNLEIVPVINKIDLPSARPEEVKREIEDIIGIDASDAPLISAKTGLNI
LEPA_CALS4       AQTLANVYLALEHDLEIIPVINKIDLPSADPERVKREIEDIIGIDASEALLTSAKEGIGI
LEPA_SYNPX       AQTLANVYLALDNDLEIIPVLNKIDLPGADPDRIKEEVEAIIGLDCDNAIPCSAKTGLGV
LEPA_SYNY3       AQTLANVYLALDNNLEIIPVLNKIDLPSAEPDRVAAEIEEVVGLDCSDIIQASAKAGIGV
LEPA_GLOVI       AQTLANVYLAIENNLEIIPVLNKIDLPGAEPERVLDEIEEIIGLERTGAIRASAKEGIGI
LEPA_DEIRA       AQTIVNAYLAIDNNLEIVPVINKIDLPAADPEGAARELEEVIGIPAEDAVRASGKTGIGI
LEPA_BUCAP       AQTLANCATALEMKLSIVPVLNKIDLPNSNPEKVAREIKEIIGISALDAIRCSAKTGQGI
LEPA_BUCBP       AQTIANCHTALDMNLKVIPILNKIDLPTADPQRVKKEIEDIIGLSTNNIILCSAKTGTGI
LEPA_BLOFL       AQTVANYRIAMERDLKVIIALNKIDLLTADINRVSKEIEEIIGINSNDIILCSAKTGLGV
LEPA_WIGBR       AQTIANFYCAIEMKIKIIPVLNKIDLPNSDPDKISKEIESMMGIKSKEIIKCSAKTGYGV
LEPA_ECOLI       AQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVRCSAKTGVGV
LEPA_PSESM       AQSVANCYTAIEQGLEVMPVLNKMDLPQADPDRVKEEIEKIIGIDATDAVACSAKSGMGV
LEPA_COXBU       AQTVATCYTAIEQGLVVLPVLNKIDLPQADPERAIQEIEDVIGIEAHDAIRVSAKEGRGV
LEPA_XYLFT       AQSVANCYTAVEQGLEVVPILNKIDLPTADTERAKAEIETVIGIDASEAVAVSAKTGLYV
LEPA_NITEU       AQTVANCYTAIEQGVEVIPVLNKIDLPAADPDRVIAEVEDIIGIEAKGALRISAKTGEGV
LEPA_RALSO       AQTVANCYTAIELGVEVVPVLNKIDLPAADPDSAIQEIEDVIGIDAQDATRCSAKTGVGV
LEPA_RICPR       AQTLANVYQAIANDHLIVPVLNKIDLAASEPDYVKTQIEDIIGIDASEAVLISAKNGIGI
LEPA_RHOPA       AQTLANVYHALDAGHEIVPVLNKVDLPAAEPEKIKQQIEDVIGLDASDAVMISAKTGLGV
LEPA_BDEBA       AQTLANVYLAMENNLEIIPVLNKIDLPSADPEGVAKQIEDTVGLDCTGIIHASAKEKIGI
LEPA_GEOSL       AQTLANVYLAIDNNLEVFPVLNKIDLPAAEPERVKHEIEEIIGLDAHDAVMASAKEGIGT
LEPA_HELPJ       AQTIANTYIALDNNLEILPVINKIDLPNANVLEVKQDIEDTIGIDWFNANEVSAKAKLGI
LEPA_WOLSU       AQTIANVYIALDNELEILPVINKIDLPAADPLRVKQEIEQTIGLDCSGALHVSAKSGLGI
LEPA_STRCO       AQTLANLYLAMENDLTIIPVLNKIDLPAAQPEKFAEELANLVGCDPDDVLKVSAKTGLGV
LEPA_MYCPA       AQTLANLYLALDRDLTIIPVLNKIDLPAADPDRYAGELAHIIGCEPDDVLWVSGKTGEGV
LEPA_BIFLO       AQTLSNLYMAIDHDLAIIPVLNKIDLPSAEPDKHAEEIAGLIGCEPSDVLRVSGKTGEGV
LEPA_TROWT       AQTLANLHLAIENNLLIIPVLSKVDLPSADVEGATLELSEVLECRVEDVMHVSGKTGYGV
LEPA1_RHOBA      AQTVANAFAAMEHDLTIVPVINKIDLIHARPDEVAEEMMNSLGTDPDECKRVSAKTGEGV
LEPA_CHLTE       AQTIANLYLAIEAGLEIIPVINKIDLPSSDVEGVARQIIDLIGVNRDEILRVSAKNGIGV
LEPA_PORGI       AQTISNLYMAIENDLTIIPIVNKVDLPSAMPEEVEDQIIELLGCDRSEIIRASGKTGQGV
LEPA_TREPA       SQTISNLYLVLEHNLEIIPVINKIDLPTADVPRVLQQVEHDLGLDPASSVLISAKTGENV
LEPA_TREDE       SQTLSNMYLALEHDLEILPVINKIDLPAADIDAAKHQIDHDLGLDSDAAVAVSAKTGENI
LEPA_BORBU       AQTVSNFYMAFEHDLEIIPVINKIDLPNANVDFVKKQIKNDLGLNEEIAISISAKNGIGI
LEPA2_RHOBA      AQTVANLYLALEYDLELLPVINKIDLPAADVDRVRGEIDEDLGLDPFVAIPVSAKTGQGI
LEPA_CHLTR       AQSLANVYLALERDLEIIPVLNKIDLPAAQPEAIKKQIEEFIGLDTSNTIACSAKTGQGI
LEPA_LEPIN       AQTLANLYLAMEQDLEILPVMNKIDLPAADVEKTKIQIEESLGLDPQKAVAISAKTGLNV
LEPA_THEMA       AQTVAHTYLAIEHDLEIIPVINKIDLPNANIEETALEIKDLLGVSENEILLVSAKEGTGV
LEPA_AQUAE       AQTVANFWKAVEQDLVIIPVINKIDLPSADVDRVKKQIEEVLGLDPEEAILASAKEGIGI
GUF1_YEAST       AQTVANFYLAFSLGLKLIPVINKIDLNFTDVKQVKDQIVNNFELPEEDIIGVSAKTGLNV
GUF1_HUMAN       AQTVANFFLAFEAQLSVIPVINKIDLKNADPERVENQIEKVFDIPSDECIKISAKLGTNV
                 :*::     ..     :.  :.*:*:  :        .   .          *.*     

LEPA1_LACPL      EDLL-EQIVHKIPAPQ-GDLDAPLKALVFDSVYDDYRGVVLSVRIHEGIVRPGDRIRLMN
LEPA_LACJO       PELL-EEIVKKVPAPD-GDLNAPLKALIFDSKYDDYRGVVLSVRIEEGTVKPGDKIRIMN
LEPA_OCEIH       EEIL-ERITEVVPEPA-GDGEAPLKALIFDSLYDSYRGVIAYVCVKEGSIKVGDKIQMMA
LEPA_STAES       EEIL-EKIVDVVPAPD-GDPEAPLKALIFDSEYDPYRGVISSIRIIDGVVKAGDRIKMMA
LEPA_STRP3       EEIL-EQIVEKVPAPT-GDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKPGDKIQMMS
LEPA_ONYPE       IDIL-EQIVTRISPPQ-GDIQKPLQALIFDSYFDSYKGVVPSIRIVNGTVKKGDQIRFMA
LEPA_MYCGA       DQVL-DVIIKKVPSPKNANDNDPLKALIFDSYYDPHKGVVCFIRIFDGKLKVGDEILFMA
LEPA_MYCPN       DQLI-TTIIEKVPPPK-GDESKPLKALLFDSYYDPYKGVVCFIRIFEGSLKLNDKIRFAR
LEPA_MYCPE       NQIM-EAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMS
LEPA_UREPA       QDVL-EAIIKHVPPPLDAKDDAKLQALIFDSFYDSYKGVVCLVRVKQGTIKVGDKIRMMA
LEPA_MYCPU       EKVL-EEIVDKISYPIDADDDKPLKALVFDSYFDAYRGVILLVRIFEGKIAVNDQFKFIS
LEPA_FUSNN       EDIL-EAIVHRIPAPN-YDEDAPLKALIFDSYFDDYRGVITYVKVLDGNIKKGDKIKIWS
LEPA_CLOTE       KDVL-EAVVEKVPYPK-GEEEEPLKALIFDSYYDAYKGVVCYVRVKEGTIKPGTEIKLMA
LEPA_CALS4       EEVL-EAIVKRIPPPQ-GDEDKPLKALIFDSFYDNYKGAISFVRIVDGKVKRGMRIKMFS
LEPA_SYNPX       PEIL-QAVVDRVPPPK-DALEEPTKALIFDSYYDPYRGVIVYFRVMSGRISCKDKVLLMA
LEPA_SYNY3       DDIL-EAIVQQVPPPA-DTVDQPLRALIFDSYYDAYRGVVVYFRVMDGQVKKGDKVRLMA
LEPA_GLOVI       HDIL-EAIVHRIPPPA-DTVAEPLQALIFDSYYDAYRGVIVYFRVMSGSVKKGNKIRFMA
LEPA_DEIRA       PEIL-EAVVERIPPPA-GDPGAPLKALIFDSFFDAYQGVILFVRVLEGTMKAKDGVRLMN
LEPA_BUCAP       EELI-EQIIKKIPAPD-GDEKKPLQALIIDSWFDNYLGVVSLIRIKNGIISKKDKIKVMS
LEPA_BUCBP       TNLL-ETITHNIPYPK-GNPNDPLQALIIDSWFDCYLGVVSLVRVKNGYLTKKTKIQIMS
LEPA_BLOFL       LDIL-ERIIIDIPVPQ-GNCDAPLQALIIDSWFNNYLGVISLICVKNGILHKGDTIQSMN
LEPA_WIGBR       YEIL-ENIVCNLTPPI-GNINKPLQALIIDSWFDNYLGIIVLIRIKNGNLKNGEKIIVMS
LEPA_ECOLI       QDVL-ERLVRDIPPPE-GDPEGPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGDKVKVMS
LEPA_PSESM       DEVL-ERLVATIPPPT-GDIEAPLQALIIDSWFDNYLGVVSLVRVRHGRVKKGDKILVKS
LEPA_COXBU       KELL-EQLVVAIPPPV-GDPEAPLQALIIDSWFDSYLGVVSLVRVKAGTLRKGDKIRVMS
LEPA_XYLFT       EQVL-EAIVQRIPAPQ-PRDTEKLQALIIDSWFDNYLGVVSLVRVMQGEITPGNKLLVMS
LEPA_NITEU       DQVL-EMIVAQIPPPE-GDVDAPLKALIIDSWFDSYVGVVMLVRVVDGVLRPGNKILLMS
LEPA_RALSO       PDVL-EALIAKVPAPK-GDPDAPLQALIIDSWFDNYVGVVMLVRVVNGTLRAKDKVLLMA
LEPA_RICPR       DSVL-EAIINKLPAPK-ESSTDILKALLVDSWYDPYLGVVILVRIIDGALRKNMRVKMMR
LEPA_RHOPA       PDVL-EAIVTRLPPPK-GDRDATLKALLVDSWYDVYLGVVVLVRVVDGVLKKGQRIRMMG
LEPA_BDEBA       TDIL-EAIVEKVPPPK-ADRSLTPRALIFDSWFDAYQGVVVLVRMVDGVIKKGDKIKFMA
LEPA_GEOSL       REIL-EEIVKKIPPPE-GDPAAPLKALLFDSWYDQYQGVIILVRVIDGTVKKGDKIQLVS
LEPA_HELPJ       KDLL-EKIITTIPAPS-GDPNNPLKALIYDSWFDNYLGALALVRIMDGSINTEQEILVMG
LEPA_WOLSU       KELL-DEIIRRIPAPN-GQESASTKALIYDSWFDNYLGALALVRVVDGSIKVGQNILVMS
LEPA_STRCO       DVLL-DKVVAEVPAPV-GVKDAPARAMIFDSVYDSYRGVVTYVRVIDGQLNKRERIRMMS
LEPA_MYCPA       ARLL-DEVVRQVPPPQ-GQADAPLRAMIFDSVYDIYRGVVTYVRVVDGKITPRERIAMMS
LEPA_BIFLO       ADLL-DQIVMDVPAPH-GDPDAPARALIFDSVYDSYRGIVTYIRMEDGELHDREKVHMMG
LEPA_TROWT       KELL-DLIVRKAPPPK-GDVTSAPRALIFDSIYDSYRGVVTYVKMCDGTIRVGDKIRMMS
LEPA1_RHOBA      AALL-DAIVDSVPAPT-GDPKAVLQAMVFDSNYDDFRGAITYIRVMQGTVRKGQKIKFLR
LEPA_CHLTE       DDLM-EAIVARVPAPA-DNRQMPLRALIFDSVFDAYRGAIAYIRIVDGVLKKGDRVRFFA
LEPA_PORGI       DQIL-RAIVEQVPAPA-GDPDAPLQCLIFDSVFNPFRGIIAYFKVVNGSIRKGDHVKFIA
LEPA_TREPA       DALF-DAIITRIPPPQ-GSGTAALQALVFDCHYDQYRGVVVHIRVFEGQVTSGMVIRFMS
LEPA_TREDE       DALF-EAIITTFPPPK-GSRDNPLQALIFDCHYDPYRGVVVHVRVFEGMIKPGMTIRFMN
LEPA_BORBU       DDLL-EAICKYVPSPR-GSIKDPLRALIFDSHYDSYRGVVVHFRIFEGQIKMGDKIRLMH
LEPA2_RHOBA      EDVL-EGIVKNLPAPK-GDPKAPLKALVFDAFFDKYRGVILQCRVMEGTLKPKDEIHFMH
LEPA_CHLTR       PEIL-ESIIRLVPPPK-PPQETELKALIFDSHYDPYVGIMVYVRVISGEIKKGDRITFMA
LEPA_LEPIN       KEVL-EQITKQIPSPK-GNSNAPLKALVYDSYFDPYMGVVIKIRIFDGRIKKGDRILMMS
LEPA_THEMA       KELL-EAIVKRVPPPK-GDINGKLKALIFDAKYDNYKGVIVHVRLFDGQVKPGDKIMTFS
LEPA_AQUAE       EEIL-EAIVNRIPPPK-GDPQKPLKALIFDSYYDPYRGAVAFVRIFDGEVKPGDKIMLMS
GUF1_YEAST       EELLLPAIIDRIPPPT-GRPDKPFRALLVDSWYDAYLGAVLLVNIVDGSVRKNDKVICAQ
GUF1_HUMAN       ESVL-QAIIERIPPPK-VHRKNPLRALVFDSTFDQYRGVIANVALFDGVVSKGDKIVSAH
                   ::   :    . *         :.:: *. :: . * :    :  * :     .    

LEPA1_LACPL      S-GSEYEVTEVGVNSP-KPLARDYLMAGDVGYITASIKD--IQDTRVGDTVT-NAKNPAE
LEPA_LACJO       T-GKEFEVTEVGVSSP-HPVKKDMLIAGDVGYLTANIKS--VRETRVGDTIT-SAETPTE
LEPA_OCEIH       T-GKEFEVNEVGVFTP-KTVVKKELHVGDVGYLTASIKN--VGDSRVGDTIT-HANRKAN
LEPA_STAES       T-GKEFEVTEVGINTP-KQLPVEELTVGDVGYIIASIKN--VDDSRVGDTIT-LAERPAD
LEPA_STRP3       N-GKTFDVTEVGIFTP-KAVGRDFLATGDVGYVAASIKT--VADTRVGDTVT-LANNPAK
LEPA_ONYPE       S-NSVYEVVEVGVYNP-KQIVKDFLAPGDVGYLTAAIKS--INHVRVGDTIT-SQTNQAL
LEPA_MYCGA       N-NVKYIVTEVGIKNP-NMQSRAYLEAGEVGYVTASIKT--IRDVHVGDTIT-NANNPCD
LEPA_MYCPN       S-NSVYQIVELGIKNP-FFEKQDVLKAGEIGWFSAGIKK--LRDVTVGDTIV-HAEDTTT
LEPA_MYCPE       N-NETFIVSALGVNTP-KIVNKEVLVAGEVGWIAASIKN--IKSISVGDTIT-DDANPAT
LEPA_UREPA       N-NKDYIVSELGIRTP-KIVNKTELVAGEVGWVAAAIKT--VKDINVGDTIT-HTNNPAD
LEPA_MYCPU       T-NKQFHVIELGVRTP-TEVKKPFLESGEVGWIAASIRD--AKDVSVGDTLT-LVKNPTK
LEPA_FUSNN       T-EKELEVLEAGIFSP-TMKSTDILSTGSVGYIITGVKT--IHDTRVGDTIT-SVKNPAL
LEPA_CLOTE       T-GRKYEVTETGVFVP-EYMKIDGLEAGDVGYITASIKN--VRDARVGDTIT-EAKRPAT
LEPA_CALS4       T-GKVFEVTEVGSFRP-DLYPVEELKAGEVGYIAANIKN--VKDTRVGDTIT-DADNPAD
LEPA_SYNPX       S-KKTYELDEIGIMAP-DQKKVDELHAGEVGYLAASIKA--VADARVGDTIT-LLSAPAD
LEPA_SYNY3       S-DKEYVIDELGVLSP-TQVQVEALHAGEVGYFAAAIKA--VADARVGDTIT-MANSPAA
LEPA_GLOVI       S-GKEFEIDEIGVLKP-FQVPVDELHAGEVGYIAAAIKL--VQDARVGDTIT-LVSNPAA
LEPA_DEIRA       A-GKNFEVDKVGTFSP-GLVVGQELSAGMVGWVAAGIKD--IQDAQVGDTLT-GSDRQTA
LEPA_BUCAP       T-GKTYFVDHLGIFTP-KKINKNYLKCGEVGWIVCGIKN--ISAAPVGDTLT-NAKNPAM
LEPA_BUCBP       T-KKIYNIEKIGIFTP-KPIFKDILKCGEVGWIICGIRN--ITGAPVGDTIT-QHPNSAK
LEPA_BLOFL       T-GQIYIVNQLGIFTP-KQVQRMSLNCGEVGWLVYTSKNHRVMGAPVGDTLT-LLINPAQ
LEPA_WIGBR       T-KKVYSIAQMGFFSP-NKTKTDILKCGEVGWIACSIKE--IKGAPVGDTIT-LASYPSE
LEPA_ECOLI       T-GQTYNADRLGIFTP-KQVDRTELKCGEVGWLVCAIKD--IHGAPVGDTLT-LARNPAE
LEPA_PSESM       T-GKLHLVDSVGVFNP-KHSATVDLKAGEVGFIIAGIKD--IHGAPVGDTLT-LSTTPDV
LEPA_COXBU       T-GKDYYADQIGHFTP-KRQPLEELSAGAVGFVVAGIKD--IFGAPVGDTLT-HAKQSAG
LEPA_XYLFT       T-GRSHQVDAVGVFTP-KRKTLAKLTAGEVGWVTASIKD--VHGAPVGDTLT-LTSDPAP
LEPA_NITEU       S-KANYLCEEVGVFQP-KAVSHKSLSAGEVGFIISGIKD--LKSAKVGDTVT-LADRPAG
LEPA_RALSO       T-GAQHLVEQVGVFSP-KSVPRESLSAGQVGFVIAGIKE--LKAAKVGDTITHVVPRKAD
LEPA_RICPR       T-NSVYTVEHVGFFTP-KKHISDVLYAGEIGFFTASIKR--VSDCKVGDTIT-DEKKSCE
LEPA_RHOPA       T-GAAYDVERVGYFTP-KMVNVEELGPGEVGFITAAIKE--VADTRVGDTIT-DDKKPVT
LEPA_BDEBA       T-DRDYEVLRMGKYKP-FPLMQDVLEAGEVGFIVCGIKD--IRDVQVGDTVT-SAKHPAT
LEPA_GEOSL       T-GRSYEALKVGVFAP-VMREVPQLAAGEVGFLIAGIKD--VADAKIGDTVT-HALKPCV
LEPA_HELPJ       T-GKKHGVLGLYYPNPLKKIPTKSLECGEIGIVSLGLKS--VTDIAVGDTLT-DAENPTS
LEPA_WOLSU       T-GKKHEVLNLMYPHPLAPQKTQEIKTGEIGIVVLGLKN--VTDIAVGDTMT-DAKNPTK
LEPA_STRCO       T-GATHELLEIGTNSP-EMLSADGLGVGEVGYLITGVKD--VRQSKVGDTVT-SQHKGAT
LEPA_MYCPA       T-GATHELLEVGIVSP-EPKASDGLGVGEVGYLITGVKD--VRQSKVGDTVT-SARHGAQ
LEPA_BIFLO       I-GMTHDPIEIGVISP-DMTRTKALGAGEVGYIITGAKD--VSQSKVGDTLT-SAVRPAA
LEPA_TROWT       T-GAEHTLLEVGVSNP-EPQSRHSLSVGEVGYFITGVKD--VRKSRVGDTIT-TDTHTAT
LEPA1_RHOBA      A-GSVHDVVELGQFAP-SRVPCDELVAGQVGYLICNIKS--LGDVHIGDTIS-IAGNDPA
LEPA_CHLTE       N-DKIFMADEIGTMSL-KRNPVDILEAGNVGYLICSIKD--VKDAKVGDTVT-LVENPAA
LEPA_PORGI       T-EKEYDADEVGVLRL-DMEPRSEVKTGDVGYIISGIKT--SREVKVGDTIT-HVAKPAK
LEPA_TREPA       N-GAEYRVEETGVFVFNLIARE-ALCAGDVGYLSANVKT--VSDVQVGDTIT-DASCPCD
LEPA_TREDE       T-GGEYKVEETGTFVLDLVKQD-SLQAGEVGYIIAGIKT--VSDVGVGDTIT-DAAAPCK
LEPA_BORBU       T-NSEHLIEEIGIFKISLERKD-TLEAGDVGYFIAGIKN--ISDVKIGDTVT-LCDFPAL
LEPA2_RHOBA      A-DRDFTVDELGYNQFKLVPKK-ELTAGEVGYIVAGVKT--VQDIEIGDTIT-LANRPAD
LEPA_CHLTR       TKGSSFEVLGIGAFLPEATLMEGSLRAGQVGYFIANLKK--VKDVKIGDTVT-TVKHPAK
LEPA_LEPIN       T-GKDFTVNEVGINRINLTPKE-SLETGEVGYIIAGIKK--VSDAKTGDTVT-LFSNPTK
LEPA_THEMA       N-KKVYEVQEVGVFLP-EMEPVDSLSAGEVGYIIAGIKE--VSDARVGDTIT-SANDPVD
LEPA_AQUAE       T-GKEYEVTEVGAQTP-KMTKFDKLSAGDVGYIAASIKD--VRDIRIGDTIT-HAKNPTK
GUF1_YEAST       T-KEKYEVKDIGIMYP-DRTSTGTLKTGQVGYLVLGMKD--SKEAKIGDTIMHLSKVNET
GUF1_HUMAN       T-QKTYEVNEVGVLNP-NEQPTHKLYAGQVGYLIAGMKD--VTEAQIGDTLCLHKQ--PV
                                         :  * :* .    :         ***:         

LEPA1_LACPL      KPLAGYREMNPMVYAGIYPTDNAKFTDLREALEKLKLNDAALEFEAESSQALGFGFRCGF
LEPA_LACJO       KPLPGYRQIPPMVYSGMYPVDNQKYDDLKEALQKLQLNDAALEFEPETSQALGFGFRCGF
LEPA_OCEIH       EALPGYRRLNPMVFCGMYPVDTNDYNDLREALERLELNDSSLQYEPETSQALGFGYRCGF
LEPA_STAES       KPLQGYKKMNPMVFCGLFPIDNKDYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGF
LEPA_STRP3       EALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGF
LEPA_ONYPE       LPLPGYKQMNSVVFCGLYPVETNKYDILKEALEKLKLNDSSLIFEPESSNALGLGFRTGF
LEPA_MYCGA       KPLVGYRKVSSMVYAGLYPVDTADYQNLKVAMEKIVLTDAALEYEYETSNALGFGVRCGF
LEPA_MYCPN       PPLPGYKKVLPMIYCGLYPIDNNDYQNLKMAMEKIILSDVALEYEYETSQALGFGVRCGF
LEPA_MYCPE       TSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGF
LEPA_UREPA       KPLPGYKKILPMVYCGLYPIDTSQYDDLKEAMAKISLSDAALTYEYETSQALGFGIRCGF
LEPA_MYCPU       EALPGYKKVKAVVFTGFYPIDGKDYPVLKESLEKISLSDSSITWELESSKALGFGFRVGF
LEPA_FUSNN       FPLAGFKPAQSMVFAGVYPLFTDDYEELREALEKLQLNDASLTFVPETSIALGFGFRCGF
LEPA_CLOTE       EALEGYRPAIPMVFSGIYPVDGAKYGELKEALEKLQINDAALSFEPETSIALGFGFRCGF
LEPA_CALS4       SPLPGYKEVVPMVFCGIYPADGEDYENLKEALEKLQLNDASLVFEPDTSAALGFGFRCGF
LEPA_SYNPX       EALPGYTEAKPMVFCGLFPTEADQYPDLRDALDKLQLSDAALKYEPETSSAMGFGFRCGF
LEPA_SYNY3       EPLPGYTEANPMVFCGLFPIDADQYPDLKDALEKLKLNDAALSYEPETSSAMGFGFRCGF
LEPA_GLOVI       TPLPGYQEAMPVVFCGLYPTDSDQFEDLREALDKLSLNDAALHFEPESSGALGFGFRCGF
LEPA_DEIRA       EPFPGFKPAQPVVFSGLYPTDTEDYRKLRDALEKLKLNDAAFSFEPETSEALGFGFRCGF
LEPA_BUCAP       NMLTGFKKIKPQIYAGLFPVTSDQYEIFRDALGKLSLNDSSLFYEPINSTALGFGFRCGF
LEPA_BUCBP       KVLSGFKKIKPKIYAGLFTIQSNQFSLFRDALGKLSLNDASLFYEPEHSLALGHGFRCGF
LEPA_BLOFL       KSLPNFKKIQPYVYAGLFPAGSTSQKVFADALYKLSLNDSSLHYESEYSEYLGLGFRCGF
LEPA_WIGBR       KMLPGFKKIFPKVFASIFPTISEKYQSLKNGLIKLSLNDSSLFYEYENSDSLGMGFRCGF
LEPA_ECOLI       KALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPESSSALGFGFRCGF
LEPA_PSESM       DVLPGFKRIQPQVYAGLFPVSSDDFEDFREALQKLTLNDSSLQYSPESSDALGFGFRCGF
LEPA_COXBU       SPLPGFKQVKPQVFAGLFPINSEEYEPFREALAKLRLNDAALFYEPESSEALGFGFRCGF
LEPA_XYLFT       KPLPGFQEVQPRVFAGLFPVDAEDYPDLREALEKLRLNDAALRFEPENSEAMGFGFRCGF
LEPA_NITEU       EPLAGFKEIKPQVFAGLYPVESNQYDALRAALEKLQLNDASLHFEPETSQALGFGFRCGF
LEPA_RALSO       APLPGFKEVKPQVFAGLYPVEANQYEALRESLEKLQLNDASLQFEPEVSQALGFGFRCGF
LEPA_RICPR       QALPGFKPNIPVVFCGFYPTDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGF
LEPA_RHOPA       DMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGF
LEPA_BDEBA       QPLAGFQRIKPMVFAGIFPVVASEYENLKDALDKLCLNDSSLTFEVEKSAALGFGYRCGF
LEPA_GEOSL       TPLGGFKEVKPMVFSGLYPIDTAQYEQLRDALAKLKLNDSSFSFEPETSLALGFGFRCGF
LEPA_HELPJ       KPIEGFMPAKPFVFAGLYPIETDRFEDLREALLKLQLNDCALNFEPESSVALGFGFRVGF
LEPA_WOLSU       EAIDGFQPAKPFVFAGLYPIDTDRFEELRDALNKLKLNDSSIQYEPETSVALGFGFRVGF
LEPA_STRCO       EALGGYKDPRPMVFSGLYPLDGSDYPELREALDKLQLNDAALVYEPETSAALGFGFRVGF
LEPA_MYCPA       EALTGYREPKPMVYSGLYPVDGSDYPDLRDALDRLRLNDAALTYEPETSVALGCGFRCGF
LEPA_BIFLO       EPLPGYRDPKPMVYAGLFPIDNAQFPELRDALDKLKLNDAALIYTPETSVALGFGFRCGF
LEPA_TROWT       VPLPGYSNPKPMVFSGIYPLNGNEYSALREGLDRLKLSDASIVYTPETSAALGFGFRCGF
LEPA1_RHOBA      PALPGYDRPKRMVYCGLFPSDGQDFSELRDALERLAVNDPSFEFEPETSDALGFGFRCGF
LEPA_CHLTE       ERLAGYKDVKPMVFSGLYPVESNEFEDLRESLEKLSLNDASLVYTPETSAALGFGFRCGF
LEPA_PORGI       EAIAGFEEVKPMVFAGVYPIEAEDFENLRASLEKLQLNDASLTFQPESSVALGFGFRCGF
LEPA_TREPA       TPRAGFRRVKPVVFSSVYPVDTDECEQLREALERLALNDASISWERDSSLALGHGFRCGF
LEPA_TREDE       APLSGFKEVKPVVFSSVYPTDTNDYEELRESFEKLKLNDASLTWEKDSSLALGHGFRCGF
LEPA_BORBU       SPLEGFKEVKPVVFSSVYPVDANQYDDLLKAMDRLKLNDASLTFEKDSSSALGHGFKCGF
LEPA2_RHOBA      EPIPGYQPARQVVFSSVYPMSTDEYQDLTKALEKLSINDAALTFEKDSSAALGFGYRCGF
LEPA_CHLTR       EPLEGFKEIKPVVFAGIYPIDSSDFDTLKDALGRLQLNDSALTIEQENSHSLGFGFRCGF
LEPA_LEPIN       ESVPGYKEAKPMVFAGLFPINGEQFDELVDAIEKLKLNDAALVFEKESSIALGFGFRVGY
LEPA_THEMA       EALPGYREIKPMVFAGMFPGLPEYYEELRKALEKLKLNDSALYFEPTMSPAMGFGFRCGF
LEPA_AQUAE       EPVPGFQPAKPMVYAGIYPAEDTTYEELRDALEKYAINDAAIVYEPESSPALGMGFRVGF
GUF1_YEAST       EVLPGFEEQKPMVFVGAFPADGIEFKAMDDDMSRLVLNDRSVTLERETSNALGQGWRLGF
GUF1_HUMAN       EPLPGFKSAKPMVFAGMYPLDQSEYNNLKSAIEKLTLNDSSVTVHRDSSLALGAGWRLGF
                     .:      :: . :.        :   : :  :.* :.      *  :* * : *:

LEPA1_LACPL      LGLLHMDVIQERLEREFNLELITTAPSVTYHVRMT-DG-------TEKKVENPAEMPEA-
LEPA_LACJO       LGLLHMDVVQERLEQEFGMDLIMTAPSVDYHAIMN-DG-------STKLIDNPADLPDA-
LEPA_OCEIH       LGLLHMEIIQERIEREFGINLITTAPSVIFEVEKT-DG-------EVLNIDNPSEMPDP-
LEPA_STAES       LGMLHMEIIQERIEREFGIELIATAPSVIYQCILK-DG-------SEVSVDNPAQMPER-
LEPA_STRP3       LGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTT-DE-------DMIEVSNPSEFPDP-
LEPA_ONYPE       LGLLHMEIIQERISREFGVEVIATAPSVIYHVYSI-KG-------EKLLVDNPSKLPST-
LEPA_MYCGA       LGLLHMDVIRERIVREYNIPLILLAPSVMYKCYLT-DG-------QELKVDNPANMPER-
LEPA_MYCPN       LGLLHMDVIKERLEREYNLKLISAPPSVRYKVLLT-NG-------EELELDNPSLLPER-
LEPA_MYCPE       LGLLHMDVIRERLDREFNIALIATAPSVIYKVLLN-DG-------TILEIDSAAKLPDK-
LEPA_UREPA       LGLLHMDVIRERIAREFNIELILTAPSVIYKIELT-NN-------QEISIDSPAKMPEP-
LEPA_MYCPU       LGMLHMEVLQERLKREFNIDIIATAPSVEYKVYLT-NN-------KVEIVSNPSDLPDR-
LEPA_FUSNN       LGLLHMEIIVERLRREYNIDLISTTPSVEYKVSID-NQ-------EEKVIDNPCEFPDP-
LEPA_CLOTE       LGLLHMDIIQERIEREFNLDIITTAPSVIYKVTKT-NK-------ETIDVTNPTNLPEE-
LEPA_CALS4       LGLLHMEIVQERLEREYNLNLVTTAPSVIYKVYKT-NG-------EVLELDNPTKMPPP-
LEPA_SYNPX       LGLLHMEIVQERLEREYDLDLIVTAPSVIYKVNMI-DG-------SEVMVDNPATLPDP-
LEPA_SYNY3       LGLLHMEIVQERLEREYNLDLITTAPSVIYRVTTT-DE-------EVIEVDNPSLLPPI-
LEPA_GLOVI       LGLLHMEVVQERLEREYDLDLVTTAPSVVYRVNKT-DG-------TVLEVQNPADLPPS-
LEPA_DEIRA       LGLLHAEIIQERLEREYDLDLIATAPAVVYRVTLT-NG-------EIFETQNPAEFPTR-
LEPA_BUCAP       LGLLHMEIVQARLEREYSLNLISTAPNVIYQIEFN-NG-------EKIYLDTPSNFPVD-
LEPA_BUCBP       LGILHMEIVQARLEREYNLQIIATSPTVIYKIIMI-DN-------TNYYLDTPHKLSTL-
LEPA_BLOFL       LGLLHMEIIQERLKREYAIDLIITTPGVMYEVLVV-DD-------QIIYVDNPLKLLSI-
LEPA_WIGBR       LGLLHMDIVKERLEREYQIELIITEPTVIYEILKK-DN-------TKIHVKSPSKIPNK-
LEPA_ECOLI       LGLLHMEIIQERLEREYDLDLITTAPTVVYEVETT-SR-------EVIYVDSPSKLPAV-
LEPA_PSESM       LGMLHMEIIQERLEREYNLDLITTAPTVIFELLLK-TG-------ETIYVDNPSKLPDL-
LEPA_COXBU       LGMLHMEIVQERLEREYNLELITTAPTVSYEILAK-QG-------EMLYVDNPSHLPEP-
LEPA_XYLFT       LGMLHMEIVQERLEREYDLNLITTAPTVIYEVLKN-DG-------TLVAMDNPAKMPPI-
LEPA_NITEU       LGLLHLDIVQERLEREYDMDLITTAPTVVYQVVLR-DG-------KITEIENPSRLPDL-
LEPA_RALSO       LGLLHMEIVQERLEREFDMDLITTAPTVVYQVMQR-DG-------TTVQVENPAKMPDP-
LEPA_RICPR       LGLLHLEIIQERLSREFDLDLITTAPSVIYKINML-DG-------QNLEIHNPADLPDL-
LEPA_RHOPA       LGLLHLEIIQERLSREFDLDLIATAPSVIYKMKLT-DG-------TEMEIHNPVDMPDV-
LEPA_BDEBA       LGLLHMEIVQERLEREFNLDLITTAPTVVYRITKT-DG-------TEMMLENPSGMPVE-
LEPA_GEOSL       LGLLHMEIIQERLEREFNLDLITTAPTVVYKVHRI-KG-------DVITIESANQLPPL-
LEPA_HELPJ       LGLLHMEVIKERLEREFSLNLIATAPTVVYEVHLT-DN-------SIKYVQNPSELPPE-
LEPA_WOLSU       LGMLHMEVIKERLEREFDLDLIATAPTVIYHLTLT-DG-------SEVSVQNPSELPPE-
LEPA_STRCO       LGLLHLDVIRERLEREFGLDLIATAPNVVYRVIME-DG-------TEHTVTNPSEFPE--
LEPA_MYCPA       LGLLHMEITRERLEREFDLDLISTSPNVVYRVIKE-DG-------TEIVVTNPSDWPE--
LEPA_BIFLO       LGLLHMEIVNERLSREFGLDLIQTAPNVTYDVTAE-DG-------SQHHVTNPSEFPD--
LEPA_TROWT       LGLLHMEIVSERLNREFGLATISTAPSVAYEITPD-GE-------KTLVVMNPSDFPS--
LEPA1_RHOBA      LGLLHMEIVQQRLEQESDIDLVQTAPNVTYEITDK-RG-------VTKNIHKPQDVPDP-
LEPA_CHLTE       LGLLHMEIIQERLEREYGVNIITTVPNVEYRVIMT-SG-------ETVEVDNPSKMPET-
LEPA_PORGI       LGLLHMEIVQERLDREFNMNVITTVPNVSYKVYDK-KG-------GCKEVHNPSGLLEP-
LEPA_TREPA       LGLLHLEVVQQRLEREFNQTVIFTAPQVQYYVFLK-TG-------QRIVCDNPAHYPLE-
LEPA_TREDE       LGLLHLEIVQERLEREFDQSVIFTAPSVRYKLTMR-TG-------EEIICDNPADYPDE-
LEPA_BORBU       LGLLHLEVIQERIEREFNLNVILTSPSVRYKIIPK-KG-------ESYFIETPEQFPGN-
LEPA2_RHOBA      LGLLHLDVVQERLQREFDIGLVISAPSVQYKIKLK-DG-------TTQDVDNPTYWPDP-
LEPA_CHLTR       LGLLHLEIIFERISREFDLDIIATAPSVIYKVVLK-NG-------KTLFIDNPTAYPDP-
LEPA_LEPIN       LGLLHMEIVQERLEREFNLDLITTAPSVKYIIRSK-NG-------EVEEIDNPSRFPEP-
LEPA_THEMA       LGPLHMEVVRERIEREFDLAVILTAPNVRYRVKLR-NG-------EEIEITDPSKFPDE-
LEPA_AQUAE       LGLLHMEIVQERLEREYGVKIITTAPNVIYRVKKKFTD-------EVIEVRNPMDFPDN-
GUF1_YEAST       LGSLHASVFRERLEKEYGSKLIITQPTVPYLVEFTDG--------KKKLITNPDEFPDGA
GUF1_HUMAN       LGLLHMEVFNQRLEQEYNASVILTTPTVPYKAVLSSSKLIKEHREKEITIINPAQFPD--
                 ** ** .:   *: :*     :   * * :                      .       

LEPA1_LACPL      --SA-IKEIREPYVKAQIMVPNDYVGAVMELAQ-RKRGEFDTMEYLDSN-RVNVVYHIPL
LEPA_LACJO       --GE-YKEVQEPYVKAEIMVPNDFVGPVMELCQ-RKRGEFVTMDYLDKY-RVNVIYNMPL
LEPA_OCEIH       --QV-VEQIREPYVEATIMVPNEYVGPVMEISQ-KKRGNFIDMQYLDDI-RVNVVYHIPL
LEPA_STAES       --DK-IEHIYEPFVKATMMVPNDYVGAVMELCQ-RKRGQFINMDYLDDI-RVNIVYEIPL
LEPA_STRP3       --TR-VAFIEEPYVKAQIMVPQEFVGAVMELSQ-RKRGDFVTMDYIDDN-RVNVIYQIPL
LEPA_ONYPE       --QM-IDRIEEPFIKATIMCPEIYIGKVMELSQ-NKRGALQNIEYIDSQ-RVMINYLLPF
LEPA_MYCGA       --NR-IKSMLEPYVKLSISTPDEFIGPIMELCQ-NFRGEYMELSEIDSS-RKVLVYEIPL
LEPA_MYCPN       --SR-IKSISEPFVRVYIDLPDHYLGTVIDLCQ-NFRGQYEKLEEIDID-RKRLVYLMPL
LEPA_MYCPE       --TL-YKEIQEPFAKAEIIVPDDFLGNVMELCQ-NYRGEYLDLVNVDST-RKKVTYLIPL
LEPA_UREPA       --TS-IKLIKEPFVKLAIITPDNYVGAIMELCQ-SRRGIYDDLEVIDGT-RRKLIYKMPL
LEPA_MYCPU       --NY-IKNIKEPFIRSFILVTEEFIGGIMELCQ-SKRGVYVNIEYID-K-RVKIIYELPL
LEPA_FUSNN       --GRGKITIQEPYIRGKVIVPKEYVGNVMELCQ-EKRGIFISMDYLDET-RSMLSYELPL
LEPA_CLOTE       --SE-IAYMEEPIVECSIITPSDYVGPIMELCQ-NRRGVFKDMQYIETT-RVVLNYDIPL
LEPA_CALS4       --TQ-IDHIEEPIVEATIMVPTDYVGPVMELCQ-ERRGVYLGMEYIEKT-RVLLKYEMPL
LEPA_SYNPX       --QK-RESIEEPYVKMEIYAPNEYNGALMGLCQ-ERRGEYIDMKYITTD-RVTLIYELPL
LEPA_SYNY3       --QK-RLKVEEPFIKVEMITPETYVGTLMELCQ-SRRGVFKDMKFFTQT-RTALIYELPL
LEPA_GLOVI       --QL-RTSIEEPYVKVELITPQEFVGTLMELSQ-GRRGIFKDMRYLTPT-RTTLIYEIPL
LEPA_DEIRA       --DR-IEKVEEPYIKLSVMLPEDYVGPVMQLLQ-ERRGSMQTMNYVGK--RVELVYEVPF
LEPA_BUCAP       --NK-IRKIKEPIVECNILLPPKFLGPVMKLCI-KKRGTEINMIYHE-Q-QVSLKYHIPM
LEPA_BUCBP       --QK-IKEIREPIAKCLILLPIKYLGNTLLLCS-QRRGVQNDISYYN-N-QILLDYSIPM
LEPA_BLOFL       --TG-IKEIREPIVLCNFLMPKKYLGEIIVLCV-EKRGVQVSLVYKA-D-QVMLTYELPM
LEPA_WIGBR       --KY-INELREPIVNCKILSPKKYLGKIISLCV-EKRGIQNNLIYLE-N-KVIIIYIIPM
LEPA_ECOLI       --NN-IYELREPIAECHMLLPQAYLGNVITLCV-EKRGVQTNMVYHG-N-QVALTYEIPM
LEPA_PSESM       --SA-IEDMREPIVRANILVPQEHLGNVITLCI-EKRGVQHDMLFLG-T-QVQVSYDLPM
LEPA_COXBU       --GK-IGEIREPIAVANILVPPTYLGAVITLCV-EKRGVQKKLLYLS-N-QVSMTYEIPL
LEPA_XYLFT       --NQ-INEIREPIIRSNILTPPDYVGAVITLCE-EKRGSQISITYLG-N-QVQVAYELPM
LEPA_NITEU       --SS-IEEIREPIITATILVPEEYVGTVMTLCT-GKRGIQKNMQYMG-R-QVMLVYEMPL
LEPA_RALSO       --SK-IESILEPIVTVNLYMPQEYVGAVITLCE-QKRGSQINMSYHG-R-QVQLTYEIPM
LEPA_RICPR       --QK-IASMEEPWIKATIIVPDEFIGTVLSLCT-EKRGIQLDHSYIS-N-RAKIVYKLPL
LEPA_RHOPA       --VK-IAEIEEPWIEATILTPDEYLGSVLKLCQ-DRRGNQKELTYVG-A-RAMVKYDLPL
LEPA_BDEBA       --TQ-IAKFEEPYVKVTLHTPTDYIGGILKLCE-DKRGIQQKMEYVTDK-KVIIEYKLPM
LEPA_GEOSL       --QE-IDYIEEPFILASIHTPNEFVGGILSLCE-EKRGVQREIKYLTPT-RVMIIYELPL
LEPA_HELPJ       --NH-IACIKEPFVRATIITPSEFLGNLMQLLN-NKRGIQEKMEYLNQS-RVMLTYSLPS
LEPA_WOLSU       --QK-IAKMEEPYVRATIIVPSEYLGNVITMVS-RRRGVQEKMEYINET-RVMLVYAIPT
LEPA_STRCO       --GK-INEVYEPVVRATILAPTEFIGSIMELCQ-TRRGTLLGMDYLSED-RVEIRYTLPL
LEPA_MYCPA       --GK-VRTVYEPVVKTTIIAPSEFIGTIMELCQ-SRRGELGGMDYLSPE-RVELRYTMPL
LEPA_BIFLO       --GK-IKKIVEPMVAADIITPKEFIGAVMDLCQ-DHRGIMGTMEYISTD-RVEMHYRIPL
LEPA_TROWT       --GK-IKEIKEPTVKVSILSPKEYIGSIMELCQ-ARRGVMQGIEYFGSV-RAELIYVMPL
LEPA1_RHOBA      --GD-IEKFCQPIVRCNVIVPEEYIGPVMKLCQ-ERRGIQKGHEVLGAS-RAMLTYDIPL
LEPA_CHLTE       --TK-INWIEEPYVSMQIITMSEYIGNIMKLGM-ERRGEYKNTDYLDTS-RVNIHFEFPL
LEPA_PORGI       --TL-IDHIEEPFIRASVITNTAYIGPIMTLCL-GKRGVLVKQEYISGD-RVEIFYDLPL
LEPA_TREPA       --QE-IAQVHEPYIRATIITPTEVLGAVMTLCI-EKRAYQTAVNYLDQK-RVELVYEMPL
LEPA_TREDE       --GL-IASAEEPYIKATLITPTNYLGNVMSLCM-EKRGVQTNMTYLDEK-RVEMTYEMPL
LEPA_BORBU       --EA-IESVLEPYIKANIIVPTEFLGNIMSVCL-LKRGVQTNLIYLDTK-RVELIYKMPL
LEPA2_RHOBA      --ST-IDSVSEPYIKAQILIPEEYVGPVMELCR-EHRSESQTMNYLSAG-RLEVTSEMPL
LEPA_CHLTR       --AL-IEHMEEPWVHVNIITPQEYLSNIMSLCM-DKRGICLKTDMLDQH-RLVLSYELPL
LEPA_LEPIN       --IT-IESTEEPYVKATVITPNEYVGNIMSLAM-DKRGIQLDTVYLTQD-KVQLTYEIPL
LEPA_THEMA       --GE-ILEAYEPYVDLSIITPSEYIGAIINLVQNEKRGELRITENAGKN-RVILRFDAPL
LEPA_AQUAE       --AGLIEYVEEPFVLVTIITPKEYVGPIIQLCQ-EKRGIQKNMTYLDPN-TVYLEYEMPL
GUF1_YEAST       TKRVNVAAFHEPFIEAVMTLPQEYLGSVIRLCD-SNRGEQIDITYLNTNGQVMLKYYLPL
GUF1_HUMAN       --KSKVTEYLEPVVLGTIITPDEYTGKIMMLCE-ARRAVQKNMIFIDQN-RVMLKYLFPL
                           :*     .       .  : :     *.               :    * 

LEPA1_LACPL      SEIIFDFFDKLKSNTRGYASLDYDLDGYRASDLVKIDILLNGDQVDALSFIAHRDFAPAR
LEPA_LACJO       AEIIYDFFDELKSSTKGYASLDYEITGYRATDLVKIDMLLNKEPIDALSFIAHREEAQNR
LEPA_OCEIH       SEIVFDFFDQLKSNTKGYASFDYELIGYQQSNLVKMDILLNGDTIDALSFVVHRDFAYER
LEPA_STAES       SEVVFDFFDQLKSNTKGYASFDYEFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYER
LEPA_STRP3       AEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYER
LEPA_ONYPE       SEIIYSYFDKLKSLTKGYASFDYEIDKYRVSKLQKMDILLNGEIVDALSLIVHHDFAYER
LEPA_MYCGA       AEIIYSFFDKLKSVTKGYASLDYELIGYRDSNLVKVDILLNGQKVDALSFISHTQFVYQK
LEPA_MYCPN       GEIIYSFFDKLKSITKGYASLNYEFDQYQVSQLAKVEIMLNKQKVDALSFIAHHDFAFQR
LEPA_MYCPE       AEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDR
LEPA_UREPA       AEIMYSFFDSLKSITKGYATMDYELIGYQAEKLVKIDIMLNGNKVDALSIIAHRDFAYGK
LEPA_MYCPU       SEIILDFFDKLKSISKGYASFDYEFIEYRDADLVKVDILLNKEKVDAFSFISHRENAYER
LEPA_FUSNN       AEIVIDFYDKLKSRTKGYASFEYELSEYKISNLVKVDILVSGKPVDAFSFIAHNDNAFHR
LEPA_CLOTE       NEIIYDFFDALKSRSRGYASLDYELKGYTQSKLVKLDILLNGDNVDALSMIVPEERAYSR
LEPA_CALS4       NEIIYDFFDALKSRTRGYASLDYEFKGYKKSDLVKLDILVNGEVVDALSMIVHKDKAYEK
LEPA_SYNPX       AEVVTDFFDQMKTRTQGYASMEYSLIGYRKNQLVRLDVLINGERADALTTIVHQDKAYNV
LEPA_SYNY3       AEVVTDFFDQLKSRTKGYASMEYQLIGYRENPLVKLDILVNGDGVDALAMIVHRDKAYYV
LEPA_GLOVI       AEVITDFFDQMKSRSRGYASMEYQLIGFREGNLVRLDIVLNGEPVDSLSCITHADKAPEV
LEPA_DEIRA       AEILYDFHDRLKSISRGYASMDYEQLGYREGDLRKVDIMVNNEVIDALAVIVHESKTYSL
LEPA_BUCAP       NEVVLNFFDELKSVSSGYASLEYDFKYFKTVKMVRIDILINSERVDALTVISYYKNAQNR
LEPA_BUCBP       SEVVLNFFDQLKSVSSGYASLEYNFELYKVAHVKCLDILVNYKKIDSLSTIVHKTKILNQ
LEPA_BLOFL       SEIILDFFDRMKSISNGYASLEYTFNRFQASDMVCIEILINGQRVNALAVIVHRITAEFQ
LEPA_WIGBR       SEIILDFFDKLQSISNGYASLDYKFKCFNKTDSVVIQTYINKKLIDSLTKVINKNYINLY
LEPA_ECOLI       AEVVLDFFDRLKSTSRGYASLDYNFKRFQASDMVRVDVLINGERVDALALITHRDNSQNR
LEPA_PSESM       NEVVLDFFDRLKSVSRGYASLDYHFDRYQSANLVKLDVLINGEKVDALALIVHRDNAHYK
LEPA_COXBU       SEVVLDFFDRLKSASRGYASLDYSFNHFQAADLVKLDILISGQKVDALATIVHRDLAYTR
LEPA_XYLFT       AEVVLDFFDKLKSVTRGYASLDYHFLRFQEGPFVRVDTLINGDRVDALSVIVHRHQAERR
LEPA_NITEU       NEVVMDFFDRLKSVSRGYASLDYEFKEFRAADLVKLDILINSDRVDALSLIVHRASSQHR
LEPA_RALSO       GEIVLDFFDRLKSVSRGYASMDYEFKEYRPSDVVKVDMLINGDKVDALSIIVHRSNSAYR
LEPA_RICPR       NEIVYDFYDRLKSCSKGYASFEWQMDVYELSDLVNLRILVNGEVVDALSTIVHRSRAEQR
LEPA_RHOPA       NEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGR
LEPA_BDEBA       NEMVMDFYDRLKSISKGYASLEYEFVGFEESDLVKLDILINGEAIDALSLIVHRSKAQNR
LEPA_GEOSL       NEVVLDFYDRLKSITKGYASLDYEHLNYRRSDLVRMNILINGEAVDALSLIIHRDKAYYR
LEPA_HELPJ       NEIVMDFYDKLKSCTKGYASFDYEPIENREANLVKLDVRVAGDVVDALSIIIDKNKAYEK
LEPA_WOLSU       NEIVMDFYDKLKSGTKGYASFDYEPIEYREGDLAKLDIRVAGEIVDALSIIVPKEKSYER
LEPA_STRCO       AEIVFDFFDQLKSKTRGYASLDYEPTGEQTSSLVKVDILLHGDKVDAFSAITHKDAAYAY
LEPA_MYCPA       GEIIFDFFDSLKSRTRGYASLDYEEAGEQEAQLVKVDILLQGEAVDAFSAIVHKDAAFAY
LEPA_BIFLO       AEIVFDFFDQLKSRTKGYASLDYHEDGEQSADLVKVDILIQGEKVDAFSAIVHRDKAYSY
LEPA_TROWT       AEIVFDFFDSLKSRTKGYASFDYNPEGSQPADLVKVDILLQGNKVDAFSAIVHSSKAYSY
LEPA1_RHOBA      AEVIYDLHDRIKSCTRGYGTLDYEMVGYEEADLCRLDILVNGNRVDALSVVCHRADADRR
LEPA_CHLTE       GEVVFDFHDKLKSISKGYASMDYEYIGYRRSDLVKLDVLLNGEPVDALSSIVHRSKSYEW
LEPA_PORGI       GEIVIDFYDKLKSISKGYASFDYHLHDFRESKLVKLDILLNGEPVDALSTLTHVDNSVTF
LEPA_TREPA       AEILFGFYDRLKSISHGYASFDYELIESKLTDLVKVDILINGKPVDALAQLCYRPHARRR
LEPA_TREDE       AEVLFDFYDRLKSISRGYASFDYEVIETRPTDLAKIDILINGKPVDALAQLAYKPSAYDK
LEPA_BORBU       SEILFDFYDKIKSVSRGYASFDYELLDYEYTDLVRLDILVNGDRVDALSQLVFKDSARTK
LEPA2_RHOBA      GEVLFDFYGKLKMITRGYGSFDYVPIEYRKTDIVKVDILVNKEPVDALAYLVHRDKSRAR
LEPA_CHLTR       NEIVSDFNDKLKSVTKGYGSFDYRLGDYKKGAIIKLEILINDEAVDAFSCLVHRDKAESK
LEPA_LEPIN       AELIFEFYDKLKSFTRGYASLDYEPSGYKASQLVKMDILVNGEPVDALSMIVHRSKAEQR
LEPA_THEMA       AEIIYDFFDRMKAVSRGYASMDYEFKEYRRSDLVKVTILVNKEPVDALSFIVHRSKAYQM
LEPA_AQUAE       SEIIVDFHDKIKSISRGFASYDYEFIGYRPSDLIKLTVLINKKPVDALSFIVHADRAQKF
GUF1_YEAST       SHLVDDFFGKLKSVSRGFASLDYEDAGYRISDVVKLQLLVNGNAIDALSRVLHKSEVERV
GUF1_HUMAN       NEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNTVEELVTVVHKDKAHSI
                  .::    . ::  : *:.: ::            :   :  .  : :  :         

LEPA1_LACPL      GREIAAKLKTIIPRQNFEIPVQATIGSKVIARTNIKAYRKDVTAHLYGGDRTRRMKLLEK
LEPA_LACJO       ARQMTTMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRRAKLLEK
LEPA_OCEIH       GKQIVEKLKELIPRQQFEVPVQAAIGNKIVARSNIKAVRKDVTAKLYGGDITRKRKLLEK
LEPA_STAES       GKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLSKCYGGDISRKRKLLEK
LEPA_STRP3       GKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEK
LEPA_ONYPE       GKAICETLKEFIPKQMFEIPIQAALGKKIIARQTIKAMRKDVTAKLYGGDVTRKKKLLEK
LEPA_MYCGA       AKKIVEKLKTLIPRHLFEIPIQAAVGSKIISRETIKAMRKNVLAKCYGGDVSRKKKLLEQ
LEPA_MYCPN       AKKFCVKLKELIPKHLFEIPIQATIGSKVIARETIKAVRKDVTAKLYGGDVTRKKKLLEK
LEPA_MYCPE       SRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQ
LEPA_UREPA       SKIICERLKEVIPKHQFEIPIQASIGSKIIARETIKAVRKDVIAKCYGGDVSRKKKLLEQ
LEPA_MYCPU       SKELALKLKDVIPKQSFEIPIQAIIGAKVIARETIKAYRKDVTAKLYGGDVTRRQKLLKK
LEPA_FUSNN       GKAICQKLSEVIPRQQFEIPIQAALGSKIIARETIKAYRKNVIAKCYGGDITRKKKLLEK
LEPA_CLOTE       GRQMAEKLKEIIPRQMFEVPIQAAVGSKVIARETVRALRKDVLAKCYGGDISRKKKLLEK
LEPA_CALS4       GRKIVEKLKENIPRHLFEIPIQAAIGSRIIARETVKALRKNVLAKCYGGDVTRKKKLLEK
LEPA_SYNPX       GKALVEKLKELIPRQQFKIPIQASIGSRIIASTSISAIRKDVLAKCYGGDISRKKKLLKK
LEPA_SYNY3       GRAMVSKLKELIPRHQFKVPIQAAIGAKVIASEHIPALRKDVLAKCYGGDISRKKKLLQK
LEPA_GLOVI       GRQLTAKLKELIPRQQFQVPIQAAIGSKVVARENIAPLRKNVLAKCYGGDISRKKKLLEK
LEPA_DEIRA       GRKIVDKMAEVIPRQMFPVPVQAVIGAKIIARATVKAYRKDVLAKCYGGDISRKKKLLEK
LEPA_BUCAP       AREIVNKMKELIPRHQFDINIQATINNSIVARSTIKQLRKNVLAKCYGGDISRKKKLLKK
LEPA_BUCBP       AKNVVEKMKNLIPRHQFDIIIQAVIGTKVIVRTTIKQLRKNVLAKCYGGDVTRKKKLLKK
LEPA_BLOFL       GRILVNKLKSLILRQQFDIVIQAVIGKRVICRDVIKQLRKNVTHKCYGGDVTRKKKLLHN
LEPA_WIGBR       SKKTIENLKKIIPRQQFDIVIHIKINNKIISKGIVKQVRKNVLEKCYGGDVSRKKKLLKK
LEPA_ECOLI       GRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRKKKLLQK
LEPA_PSESM       GRALTEKMKELIPRQMFDVAIQAAIGGQIVARTTVKALRKNVLAKCYGGDVSRKRKLLEK
LEPA_COXBU       GRELTERLKDLIPRQMFEVAIQAAIGAKIIARTSVKALRKNVTAKCYGGDITRKRKLLEK
LEPA_XYLFT       GRELCEKMKDLIPRQMFDVAIQAAIGSQIISRSTVKAMRKNVLAKCYGGDISRKKKLLEK
LEPA_NITEU       GRELAQKMRELIPRQMFDIAVQAAIGAHIVARENVKALRKNVLAKCYGGDITRKRKLLEK
LEPA_RALSO       GREVAAKMREIIPRQMYDVAIQAAIGSNVIARENVKALRKNVLAKCYGGDISRKKKLLEK
LEPA_RICPR       GRALCIRLKDLIPRQQIDIAIQASVGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEK
LEPA_RHOPA       GRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEK
LEPA_BDEBA       GRLLAEKMKELIPRQMYQVAIQAAIGAKIIARETLGAIRKDVTAKCYGGDISRKRKLLEK
LEPA_GEOSL       GRDLVSKMKELIPRQMFEVVIQAAIGAKVIARETVKALRKDVLAKCYGGDITRKRKLLEK
LEPA_HELPJ       GRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRKRKLLEK
LEPA_WOLSU       GKELVEAMKEIVPRQLFEVAIQASVGNKIIARETVKSMGKNVTAKCYGGDITRKRKLLEK
LEPA_STRCO       GVRLVAKLRELIPRQAFEVPIQAAIGSRVIARETIRAIRKDVLAKCYGGDISRKRKLLEK
LEPA_MYCPA       GNKMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRKRKLLEK
LEPA_BIFLO       GVMMTKKLRSLIPRQQFEIPIQAAIGSRIIARENIRALRKDVLAKCYGGDITRKRKLLEK
LEPA_TROWT       GSSISKRLSELIPRQQFEVPIQAAIGSRVVARETIRAVRKDVVAKCYGGDITRKRKLLEK
LEPA1_RHOBA      GRAVAKKLKSEIERHMFEVAVQAAIGSRVIARETVPAMRKNVTAKCYGGDITRKRKLLQK
LEPA_CHLTE       GRKLCQKLKGIIPRQMYEVAIQAAIGSRVIARESISAMRKNVLAKCYGGDISRKRKLLEK
LEPA_PORGI       GRRMCEKLKELIPRQQFEIAIQAAIGAKIIARETIKPVRKDVTAKCYGGDISRKRKLLEK
LEPA_TREPA       AQAVCARLKEEISRQQFKIAIQGSIGGQIISRETVSPFRKDVLAKCYGGDITRKRKLLEK
LEPA_TREDE       ARLVCEKLKDEIPRQQFKIPIQGAIGSQIIARETISALRKDVLAKCYGGDITRKRKLLEK
LEPA_BORBU       AIGICKKLKDEIARQQFRIAIQGAIGSNVIARETISPVRKDVTAKCYGGDITRKRKLLEK
LEPA2_RHOBA      AMHYCEQLAEAIPRHQFKIPIQGAIGGTVIARTTIAPYRKDVTAKLYGGDVSRKKKLLEK
LEPA_CHLTR       GRSICEKLVDVIPPQLFKIPIQAAINKKIIARETIRALAKNVTAKCYGGDITRKRKLWDK
LEPA_LEPIN       GREIIEKLKDLIPRHQFMIPLQAAVGGKILARESISALRKNVTAKCYGGDITRKKKLLEK
LEPA_THEMA       ARKIVEKLKDLIPRHQFQIPIQAKAGGRIIARADIKALRKDVLAKCYGGDVTRKMKLLEK
LEPA_AQUAE       ARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLRANVTAKCYGGDVTRKKKLLEN
GUF1_YEAST       GREWVKKFKEYVKSQLYEVVIQARANNKIIARETIKARRKDVLQKLHASDVSRRKKLLAK
GUF1_HUMAN       GKAICERLKDSLPRQLFEIAIQAAIGSKIIARETVKAYRKNVLAKCYGGDITRKMKLLKR
                 .      :   :  :   : ::   .  ::    :     :*  : : .*  *: **  .

LEPA1_LACPL      QKAGKKRMKAVGKVEIPQEAFMAVLKTDEDEKPN--------------
LEPA_LACJO       QRRGKKRMKAVGRVEVPQDAFMAVLKMNDDDIKGK-------------
LEPA_OCEIH       QKEGKKRMKMVGSVEVPQEAFMAVLKMDDN------------------
LEPA_STAES       QKAGKAKMKAVGNVEIPQDAFLAVLKMDDE------------------
LEPA_STRP3       QKAGKKRMKAIGSVEVPQEAFLSVLSMDDDAKK---------------
LEPA_ONYPE       QKKGKKKMKTLGKVQLPQKAFLAILATK--------------------
LEPA_MYCGA       QKEGKKRLKAIGSVQIPQETFSKLLQDDE-------------------
LEPA_MYCPN       QKEGKKRLKAIGSVELPQELFSHLLKDED-------------------
LEPA_MYCPE       QKEGKKRLKAIGNVSVPHDTFVKILSEE--------------------
LEPA_UREPA       QKEGKKRLKAIGNVDVPQDAFVKVLSEN--------------------
LEPA_MYCPU       QKEGKKRMKSIGSVEVPQEAFLSVLKSNMDKK----------------
LEPA_FUSNN       QKEGKKRMKSIGNVEIPQEAFVSVLKLND-------------------
LEPA_CLOTE       QKEGKKRMRQIGSVEIPQEAFMSVLKTEE-------------------
LEPA_CALS4       QKEGKKRMRQIGTVEIPQEAFMSILKLDDQK-----------------
LEPA_SYNPX       QAKGKKRMKAMGKVDVPQEAFMAVLKLNDGGGS---------------
LEPA_SYNY3       QAKGKKRMKAIGTVDVPQEAFMAVLKLDPQ------------------
LEPA_GLOVI       QKKGKKRMKSIGSVDVPQEAFMAVLKLEG-------------------
LEPA_DEIRA       QKKGRARMKQFGTVEVPQEAFLAVLSTEE-------------------
LEPA_BUCAP       QKDGKKRMKKIGNVNMPKTAFLDILNIHKD------------------
LEPA_BUCBP       QKIGKKRMKQIGNITIPQEVFLKILNNN--------------------
LEPA_BLOFL       QKIGKKRMKQVGKVNLPNSVFMSILNRDS-------------------
LEPA_WIGBR       QKIGKKRMKKIGNFFLPQDSLFSILNIKKNKK----------------
LEPA_ECOLI       QKEGKKRMKQIGNVELPQEAFLAILHVGKDNK----------------
LEPA_PSESM       QKAGKKRMKQVGNVEIPQEAFLAVLRLE--------------------
LEPA_COXBU       QKAGKKRMKQVGKVAIPQEAFLAVLRVKNE------------------
LEPA_XYLFT       QKEGKKRMKQIGRVEIPQEAFLAVLQIDNK------------------
LEPA_NITEU       QKAGKKRMKRVGNVEIPQAAFLAILQVDGK------------------
LEPA_RALSO       QKEGKKRMKQVGSVEIPQEAFLAILRVEEK------------------
LEPA_RICPR       QKAGKKKMRQYGNIEIPQSAFIAALQIGGE------------------
LEPA_RHOPA       QKEGKKKMRQFGKVDIPQEAFIAALKVDS-------------------
LEPA_BDEBA       QKEGKKRMKAIGHVEVPQEAFLAILKVED-------------------
LEPA_GEOSL       QKEGKKRMKNVGNVELPQEAFLAILKVEEK------------------
LEPA_HELPJ       QKEGKKRMKAIGKVELPQEAFLAILKID--------------------
LEPA_WOLSU       QKEGKKRMKAIGRVELPQEAFLAVLKID--------------------
LEPA_STRCO       QKEGKKRMKMVGSVEVPQEAFIAVLSS-DDSAGSGKGKK---------
LEPA_MYCPA       QKEGKKRMKTIGRVDVPQEAFVAALSA-DAAG--DKSKK---------
LEPA_BIFLO       QKAGKKRMKMLGHVEVPQEAFIAALSTGEDSNDRDTKDKIRAAQKTEG
LEPA_TROWT       QKQGKARMKLIGRVEVPQEVFVATLSSYK-------------------
LEPA1_RHOBA      QKEGKKRMKAVGNVEISQKAFMAVLTDGE-------------------
LEPA_CHLTE       QKEGKKRMKQVGRVEVPQEAFLAVLNIDE-------------------
LEPA_PORGI       QKEGKKRMKQIGTVEVPQKAFLAVLKLD--------------------
LEPA_TREPA       QKEGKKRMKMVGDVEIPQTAFLSVLKEASDA-----------------
LEPA_TREDE       QKEGKKRMKMIGDVELPQSAFLAVLKTKED------------------
LEPA_BORBU       QKEGKKRMKMVGNVEIPQSAFLAVLKSNDN------------------
LEPA2_RHOBA      QKKGKAKMKQFGSVNIPQKAFISVLRTDKD------------------
LEPA_CHLTR       QKKGKKRMKEFGKVSIPNTAFVEVLKME--------------------
LEPA_LEPIN       QKEGKKRMKQIGNVEIPQEAFLAVLKTS--------------------
LEPA_THEMA       QKEGKKKLREIGRVTIPQEAFLALLKIGGEDEK---------------
LEPA_AQUAE       QKEGKKRMKQFGKVQLPQEAFLSVLKVE--------------------
GUF1_YEAST       QKEGKKHMKTVGNIQINQEAYQAFLRR---------------------
GUF1_HUMAN       QAEGKKKLRKIGNVEVPKDAFIKVLKTQSSK-----------------
                 *  *: :::  * . : :      *