CLUSTAL format seed alignment for MF_00073

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUSB_BACSU      ------------------------------------------------------------
NUSB_BACHD      ------------------------------------------------------------
NUSB_LISIN      ------------------------------------------------------------
NUSB_CLOPE      ------------------------------------------------------------
NUSB_CLOAB      ------------------------------------------------------------
NUSB_THEMA      ------------------------------------------------------------
NUSB_THEM4      ------------------------------------------------------------
NUSB_FUSNN      -----------------------------------------------------------M
NUSB_STRCO      ------------------------------------------------------------
NUSB_FRACC      ------------------------------------------------------------
NUSB_MYCTU      ------------------------------------------------------------
NUSB_COREF      ------------------------------------------------------------
NUSB_STRP1      ------------------------------------------------------------
NUSB_STRPN      ------------------------------------------------------------
NUSB_LACLA      ----------------MFQIELDEEPVAPKVLEFFKNLPENATAEQSLETFQKTFSFLHE
NUSB_LACSS      ------------------------------------------------------------
NUSB_RIPO1      MPPRQQPRRISRELALLSLSQI---NATPEKLEQIEINNLILAAIRTLTTESQDMLETAA
NUSB_SYNY3      MLARQQPRRVARELSLLSLSQLSRKDTKPETLEQGDLEALLLAATRTLSGEVHEILETAS
NUSB_YERPE      ------------------------------------------------------------
NUSB_PHOLL      ------------------------------------------------------------
NUSB_ECOLI      ------------------------------------------------------------
NUSB_SALTI      ------------------------------------------------------------
NUSB_VIBCH      ------------------------------------------------------------
NUSB_HAEIN      ------------------------------------------------------------
NUSB_RALSO      ---------------------------------------------------------MTQ
NUSB_BURM1      ------------------------------------------------------------
NUSB_NEIMA      ------------------------------------------------------------
NUSB_PSYA2      ------------------------MTDQLKRAISAAQTAQINDQQAEATRIASSSAGDQT
NUSB_CAUVC      ------------------------------------------------------MS----
NUSB_NOVAD      ------------------------------------------------------MT----
NUSB_RHIME      ------------------------------------------------------MTNTPS
NUSB_AGRRK      ------------------------------------------------------MSNQDN
NUSB_AGRFC      ------------------------------------------------------MSDVEN
NUSB_BRUME      ------------------------------------------------------MNSIPE
NUSB_HYPNA      ------------------------------------------------------MTQ---
NUSB_RICCN      ------------------------------------------------------MS----
NUSB_RICRS      ------------------------------------------------------MS----
NUSB_RICPR      ------------------------------------------------------MS----
NUSB_CHLTR      -----------------------------------------------------MSVMASD
NUSB_CHLMU      ---------------------------------------------------MIMSVMASD
NUSB_CHLPN      -----------------------------------------------------MATLSPE
NUSB_BORBU      ------------------------------------------------------------
NUSB_CAMC5      ------------------------------------------------------------
NUSB_PERMH      ------------------------------------------------------------
NUSB_DEIRA      ------------------------------------------------------------
                                                                            

NUSB_BACSU      ------------MKRRTAREKALQALFQIDVSDI---AVNEAIEHALDE-----------
NUSB_BACHD      ------------MNRRLSRLRAVQALYQMDVIDT---SMEKAIESVLDEG----------
NUSB_LISIN      ------------MKRREAREKALQALFQIELNEM---SLDQAIKNIMED-----------
NUSB_CLOPE      ------------MNRVKSREYLLQLAYQMEITSE---TALETFNSFMENEDIS-------
NUSB_CLOAB      ------------MNRKKSREVAMKLLFEISINKN---SISDTIEHYKENNEI--------
NUSB_THEMA      ----------MKTPRRRMRLAVFKALFQHEFRRD--EDLEQILEEILD------------
NUSB_THEM4      ----------MLKSRHKMREAIFKSLFQWDFNKE--EILEEISKEHI-------------
NUSB_FUSNN      NKNFEEQEKKAKGGVRLAREEVFKLVFGVEATESASEELKQAFDIYLQNSEEL------I
NUSB_STRCO      -----------MAARNTARKRAFQILFEGDQRGADVLTVLADWVRHSRS-----------
NUSB_FRACC      ------------------------------MRASAVPEILAARLAQS-------------
NUSB_MYCTU      -----MSDRKPVRGRHQARKRAVALLFEAEVRGISAAEVVDTRAALAEA-----------
NUSB_COREF      -MSESRQGYKRHGARYKARRRAVDILFEAESRDVDPVAIIDDRKTLSNAV----------
NUSB_STRP1      ----------MTNSFQNSRRDLRERAFQALFNIEMGAELLAASQFAYGYDKVTG-----E
NUSB_STRPN      ----------MTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTHDR--------E
NUSB_LACLA      NVLEKYTSDLFTPSTLKEELDEQLAQAENNAQSQLSELLKNTKRFVLNYDN--------D
NUSB_LACSS      -----------MPNFNRHQIRQAAFQVLFTLNANQSLELEDAYQAVLTMDQFDA-----E
NUSB_RIPO1      SEVTQGNERLLKSETQSANVQSARAMVSEALKLTQGAINRLAHAIELPEMI--------Q
NUSB_SYNY3      AELSRSHERLLNSEIRASNLNSAKAMLEEAMTLTETVINRLALAVDLPETL--------Q
NUSB_YERPE      ---------MKPAARRRARECAVQALYSWQLSKNDIADVELQFLS----EQD--------
NUSB_PHOLL      ---------MKPAARRRARECAVQAIYSWQLSGNSIADVELQFLS----EQD--------
NUSB_ECOLI      ---------MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLA----EQD--------
NUSB_SALTI      ---------MKPAARHRARECAVQALYSWQLSQNDIADVEYQFLA----EQD--------
NUSB_VIBCH      -----MGASVKPAARRNARQFALQAIYSWQITKENVATIEEQFLTSGKYDEEEHRAAEPA
NUSB_HAEIN      --MTEQKQVKKPSARRRARECTVQALYSWAVSGNTAEQVELAFVL----DQD--------
NUSB_RALSO      DNSPAKPKAPPKSARRRARELALQGLYQWLLNRNDPGVVEAHLHD----AQG--------
NUSB_BURM1      ---------MKKSARRQSRELATQGLYQWLLSNASSGEIDAQLRG----ALG--------
NUSB_NEIMA      ----------MKTARRRSRELAVQAVYQSLINRTAAPEIAKNIRE----MPD--------
NUSB_PSYA2      FDMSESSYKTSHTAIRKARRFAMQGLYEWLVTDRRF-DIDGKLGWKANAPHDIAARTRAT
NUSB_CAUVC      --------GNRIQPRSVARLAAVQALYQMEVSGAG-----VDSVIREFGEHRFDRDVEGE
NUSB_NOVAD      --------QISGKARAAARLAAVQALYQADMEQTP-----LHLLLDEFHQHRLGAEIEDV
NUSB_RHIME      ----DQP-LKQVNQRGAARLAAVQALYQMDVGGTG-----VLEIVAEYEEHRLGKELDGD
NUSB_AGRRK      ----ERP-AKTANQRGAARLAAVQALYQMDIGGTG-----VLEVVAEYEAHRLGQELDGD
NUSB_AGRFC      GGEPRQPSVKPANQRGAARLAAVQALYQMDVGGTG-----VMEVVAEYEAHRLGQEVDGD
NUSB_BRUME      G-RPTPNLQRTANKRGVARLAAVQALFQMDVAGTG-----VMEVVAEYEAFRLGKEVDGT
NUSB_HYPNA      ----EMPFDVTRARRAGARLAAVQALYEMEQTEKS-----ARATIREFMEDRLGLGPDGT
NUSB_RICCN      --------SNKINKKSIARIAAVQAIYQNILQNNDDMDDIMQNVLSFYQNNNAITDLPEN
NUSB_RICRS      --------SNKINKKSIARIAAVQAIYQNILQNNDDMDDIMQNVLSFYQNNNSITDLPEN
NUSB_RICPR      --------TNKINKKSIARIAAVQALYQNILQNNYDMYDIMQNILACYHSNNSI-DLPKN
NUSB_CHLTR      KAC-APVRASRPFPKQKLRELVLQALYALEIDPEGEDSLVSLLMTEASVS----------
NUSB_CHLMU      SAR-AVVCTSRPFPKQKLRELVLQALYALEMAPKGEDSLVSLLMTEASVS----------
NUSB_CHLPN      KFSGSPISISKEFPQQKMREIILQMLYALDMAPSAEDSLVPLLMSQTAVS----------
NUSB_BORBU      --------------MHEVRVLAFQKIYSIDINQSAMDDIFDIFNIEDKDLDIE-------
NUSB_CAMC5      -----------MATRHQVRQAVVSLLYAHEMGSEMNEFKDEFLEEKK-------------
NUSB_PERMH      ----------MGKYRKKAREIVFRTLYTYDIKGGDLFEIMEDHIKDIRGK----------
NUSB_DEIRA      MTRRREKAVQPVGTRRAAREFVFRVLFEADRGDVPLQAVFTRAEGVMREGDD------TF
                                                                            

NUSB_BACSU      ----EKTDPFFEQLVHGVLEHQDQLDEMISKHLVN-WKLDRIANVDRAILRLAAYEMAYA
NUSB_BACHD      ----EEASSFMSDLVSGTVTHQEELDRLYADHLQG-WTVDRIGNVDRAILRMALYELYYV
NUSB_LISIN      -----EQDDYMEQLVEGVMANKAEIDAIIEPNLDN-WRIDRLNKVDLSLLRLSVYEIKYL
NUSB_CLOPE      --KDDLDLAYIKSGLLGIEENKEKLDSLIESQLVK-WKLNRISKVNLSILRISTYEILFA
NUSB_CLOAB      ---ENLDFEYIERILRGIDENMEYIDSKIEESSKK-WKISRISKINITILRMAAYEIFFE
NUSB_THEMA      ETYDKKAKEDARRYIRGIKENLSMIDDLISRYLEK-WSLNRLSVVDRNVLRLATYELLFE
NUSB_THEM4      VSLEPNLQELAVNYLKGIRENIDVIDEIISKYLKN-WTLERLSVTDRNILRLGTYELIYV
NUSB_FUSNN      GTLNENQLEFLKSSIDGIAKNYDNIKDIIKKNTQN-WAYERIGVVERALLIVATYEFIF-
NUSB_STRCO      DTRQPPVSEYTMELVEGYAGRAERIDELIAQYSVD-WTLDRMPVVDRNILRLGAYELLWV
NUSB_FRACC      ---DPPVSEYAVELVEGVVERRGEIDERIARYAEG-WTLERMPPVDRNILRIAVLELLWR
NUSB_MYCTU      KPDIARLHPYTAAVARGVSEHAAHIDDLITAHLRG-WTLDRLPAVDRAILRVSVWELLHA
NUSB_COREF      DPVVAPVAEYTEAIINGVAVELDTIDDLLSEHIADTWLLERLPSVDRAVLRVACWEMLYN
NUSB_STRP1      DAQVLELPIFLLSLVTGVNNHKEELDNLISTHLKKGWSLERLTLTDKTLLRLGLFEIKYF
NUSB_STRPN      DTDV-QLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEITSF
NUSB_LACLA      RPEDLEAPEYFTQLVDGVLDKKEDLEANISKYLTKTWSFSRLTLVEQAILQVSSYEILYT
NUSB_LACSS      EVTPVEVPAYLAFLVSGVTENQAALDAALTPYLKKGWQLSRLAKPDLIILRLGLFEMQNS
NUSB_RIPO1      LASQYEVREYALELIGAVNRRRTEIDQQLEAVLVD-WQLNRLPKIDRDILRIAVAEILFL
NUSB_SYNY3      LAGQMEVRKFALELIGTVCRRRQQIDEQLQEAMVD-WQLSRLAKIDQDILRLAIAELDYL
NUSB_YERPE      --VKDVDIAYFRELLSGVAVNAASLDALMAPFLS--RQLEELGQVERAVLRIALFELSKR
NUSB_PHOLL      --VTGVDVTYFRELLSGVAVNAAKLDALMAPYLS--RQLEELGQVEKAILRIAMFELSYR
NUSB_ECOLI      --VKDVDVLYFRELLAGVATNTAYLDGLMKPYLS--RLLEELGQVEKAVLRIALYELSKR
NUSB_SALTI      --VKDVDVLYFRELLSGVATNSAYLDGLMKPYLS--RLLEELGQVEKAVLRIALFELSKR
NUSB_VIBCH      LAAPETDVSYFRDLLAGVVLNHNELDSKLRPFVS--RPMQDLDMMELALLRLAMYEMTRR
NUSB_HAEIN      --MDGVDKPYFRKLFRQTIENIETVDFSISPYID--RAFDELDPIETAILRLAVYELRFE
NUSB_RALSO      --FNKADRAHFDALLHGAIREEATLTESFTPFLD--RPVAELSPVERAALLVGAYELVHC
NUSB_BURM1      --YDKADKALLDAILHGVIREHATLVDALTPSLD--RPIDQLSPVERAVLLIATFELTHH
NUSB_NEIMA      --FAKADEELFNKLFFGTQTNAAEYIRQIRPLLD--RDEKDLNPIERAVLLTACHELSAM
NUSB_PSYA2      NAMHTVHIGYYHEMMRDIPEQIDALNTLITQQLD--REINKLDTVEHAILLIGAYELQNR
NUSB_CAUVC      -QLAAADETFFADLARGVVTNQAKIDQGIVKRLASGWRLERLDATARAVLRAGAFELMYR
NUSB_NOVAD      -EYAKADVAFFDDVVKGVDARRDEIDGLLSARLAKGWALPRLDRTMLQILRAGAYELMAR
NUSB_RHIME      -TYLRADASWFRSIVAGVVRDQRKLDPLIGSALQDDWALSRLDSTVRAILRAGTFEILER
NUSB_AGRRK      -TYLKADASWFRSIVSGVVREQTRLDPLIGSALQDDWALSRLDSTVRAILRAGTFEILDR
NUSB_AGRFC      -TYLKADPSWFRSIVSGVVRDQTKIDPLVRSALLEDWPLSRLDATVRAILRAGTFEILER
NUSB_BRUME      -QYLDADPQWFRAIVAGVVEDQLKLDPMIHQALTEDWPLSRLDSTLRAILRAGAWELKAR
NUSB_HYPNA      -PVEDADPDLFKSIVNSVVEHQAKIDTAILARLAEGWKLTRLDATMRALLRAGAAEFIAH
NUSB_RICCN      -LKISLSISHFKMLVKSVFENIHKLDEIIDNHLTNDKDPAHMPILLRALLRVSICELLFC
NUSB_RICRS      -LKISLSISHFKMLVKLVFENIHKLDEIIDNHLTNDKDPAHMPILLRALLRVSICELLFC
NUSB_RICPR      -FKISLSISHFKMLVKSVFENINKLDEIIDNHLTNAKDSVHMPILLRALLRVSICELLFC
NUSB_CHLTR      ----KKNAAYALMFCRAIRANQPDLDALLDATIRT-TTLARLTIIERNILRMMLFEHQQN
NUSB_CHLMU      ----KKNVLYALMFCKAIRANQSELDALLNATIRT-TTLANLTIIERNILRMMLFEHQQN
NUSB_CHLPN      ----QKHVLVALNQTKSILEKSQELDLIIGNALKN-KSFDSLDLVEKNVLRLTLFEHFYS
NUSB_BORBU      ---NESIKSFYSSLVIGTFDNLEHIDSLIRDISLN-WSLERMDKVDLAILRMGVYSLKFQ
NUSB_CAMC5      --IRNERKIQALETFDAICLKKGELDEILKPYLKE-KDIERIGIVELAILRLGVYEMKFT
NUSB_PERMH      --LSKKTVDYIYSILKGIDEHLPEIDDILRENLKN-WRLERLGYPERALLRLGVYELLFS
NUSB_DEIRA      PQLGPDALHFAEELVTGLERHREAIDDVLHRTIRG-WTFDQMAQTDLNVLRLATYELMYT
                                                         :       *     .    

NUSB_BACSU      ED---IPVNVSMNEAIELAKRFGDD-KATKFVNGVLSNIKSDIEQS--------------
NUSB_BACHD      DD---IPKNVSFNEAIELAKAFGGE-DAGRFINGVLSKTMEAYKPKDK------------
NUSB_LISIN      DD---VPNRVSLNESIEIAKIYSDE-KSSKFINGVLANIAPEDK----------------
NUSB_CLOPE      ED---VPGKVSINEAIELCKKYSDN-KSVSFINGVLDKVYKNMQ----------------
NUSB_CLOAB      KD---IPCKVSANEAVELAKSYAEE-NSFSFVNGVIGNLINSSEEK--------------
NUSB_THEMA      KD---IPIEVTIDEAIEIAKRYGTE-NSGKFVNGILDRIAKEHAPKEKFEL---------
NUSB_THEM4      DD---IPIEVTLDEMIELGKTYGTE-NSGKFVNGVLDKIAKAEAPKEKFEL---------
NUSB_FUSNN      KN---APIEVIANEIIELAKEYGNE-KSYEFVNGILANIEKSKK----------------
NUSB_STRCO      DA---TPDAVVLDEMVQLAKEFSTD-ESPAFINGLLGRLKELK------PSLRRE-----
NUSB_FRACC      PD---VPDRVAIDEAVELAKNLSTH-RSPAFVNGLLASLVEGKGLATPAESTGRGSAVDS
NUSB_MYCTU      AD---VPEPVVVDEAVQLAKELSTD-DSPGFVNGVLGQVMLVTPQLRAAAQAVRGGA---
NUSB_COREF      PD---VPVTTAVVEAVEIASQYSTD-KAGAYINATLDNMASKVDELRERAANPGAVSGSD
NUSB_STRP1      DE---TPDRVALNEIIEVAKKYSDE-TSAKFINGLLSQYVSGAPSANKS-----------
NUSB_STRPN      D----TPQLVAVNEAIELAKDFSDQ-KSARFINGLLSQFVTEEQ----------------
NUSB_LACLA      E----TPDVVAVNEAVELSKDFSDE-KSSRFINGVLTNFLK-------------------
NUSB_LACSS      TE---APAKVALNEALELAKQFTDD-QAKGFINGVLSKFVEA------------------
NUSB_RIPO1      E----IPNKVAINEAIEMAKRYSDD-EGYRFINGVLRRFTERLRITNN------------
NUSB_SYNY3      G----VPQKVAINEAVELAKRYSGQ-DGHRFINGVLRRVTEKKTDGAPVTPGEPR-----
NUSB_YERPE      DD---VPYKVAINEAIELAKTFGAE-DSHKFVNGVLDKVAPTVRKRK-------------
NUSB_PHOLL      DD---VPYKVAINEAIELAKVFGAE-DSHKFVNGVLDKSGPAVRRKR-------------
NUSB_ECOLI      SD---VPYKVAINEAIELAKSFGAE-DSHKFVNGVLDKAAPVIRPNKK------------
NUSB_SALTI      SD---VPYKVAINEAIELAKTFGAE-DSHKFVNGVLDKAAPVIRPNKK------------
NUSB_VIBCH      ED---VPYKVVINEAIELAKVFAAE-DSHKFVNGVLDKAAPHVRKKA-------------
NUSB_HAEIN      LD---VPYKVVINEAIEVAKVFGAD-ESHKYINGVLDKIAPALGRK--------------
NUSB_RALSO      VD---IPYKVVINEAVELAKTFGGV-EGYKYVNGVLDKLAAQVRAVEVAARR--------
NUSB_BURM1      IE---TPYRVVINEAVELAKTFGGS-DGYKYVNGVLDKLAAKLRPAETQARRNG------
NUSB_NEIMA      PE---TPYPVIINEAIEVTKTFGGT-DGHKFVNGILDKLAAQIRPDEPKRR---------
NUSB_PSYA2      LE---IPYKVVLDEAMKLNNHFGAT-DAHKLINAVLDRMAVELRAPEIEADSKANLRTSQ
NUSB_CAUVC      SD---VPTEVVINEYVEIAKSFFEG-PESGFINGALDAIARDARD---------------
NUSB_NOVAD      RD---VNVGTVITEYVDVAHAFFEE-REAKFVNGLLDAVAKDVR----------------
NUSB_RHIME      KD---VPVPVIVTEYVEIAKAFFQD-EEPKLVNAVLDRIAKQVRGDQRK-----------
NUSB_AGRRK      KD---VPVAVIVTEYVEIAHAFFDD-DEPKLVNAVLDRIAKQVRGEAKK-----------
NUSB_AGRFC      KD---VPVAVIVTEYVEIARAFFEH-DEPKLVNAVLDRIAKQVRGEAKR-----------
NUSB_BRUME      KD---VPTAVIVSEYVDIAKAFYTE-DEPKLVNAVLDRLALVIRGESRGAKPRHKS----
NUSB_HYPNA      QE---LSDAIILSEYVSLAHDFFDE-GDAKFANAVLQNMGRDLRA---------------
NUSB_RICCN      PT---TPAKVVINEYTDIANDMLNE-HEIGFVNSVLDKIAKEHTRLI-------------
NUSB_RICRS      PT---TPAKVVINEYTDIANDMLNE-HEIGFVNSVLDKIAKEHTRLI-------------
NUSB_RICPR      ST---TPAKVVINEYTDIANDLLNE-HEIGFVNSILDKIAQENNKIS-------------
NUSB_CHLTR      QDCCPVPVAVLIAETTRLIKKFSYS-EGSSLILAVLGSIFDHPAPALDAPLEPTSMCG--
NUSB_CHLMU      QESSPIPTAVLIAETTRLIKKFSYV-EGSSLILAVLGSIFDQVAQ------EPASMCG--
NUSB_CHLPN      P---PINKAILIAEAIRLVKKFSYS-EACPFIQAILNDIFTDSSL------NENSLSI--
NUSB_BORBU      NFE--NSKRAIIDEAILIAKKYGSK-NSYKFINGILDALLKNMESGIEKK----------
NUSB_CAMC5      GT----DKAVIINEAIELAKELGGD-SAPKFINGVLDALKGEM-----------------
NUSB_PERMH      DIE---DKGRVFMDILDLTKCYIDNPDTVKFINGVLSTVYKNRQKVNQ------------
NUSB_DEIRA      PE----PHPPVIESAVRIARKFGGD-DSGRFVNGVLAGLSRNLREEVGESPAADMTAPAP
                             .   :               . :                        

NUSB_BACSU      ------------------------------------------------------------
NUSB_BACHD      ------------------------------------------------------------
NUSB_LISIN      ------------------------------------------------------------
NUSB_CLOPE      ------------------------------------------------------------
NUSB_CLOAB      ------------------------------------------------------------
NUSB_THEMA      ------------------------------------------------------------
NUSB_THEM4      ------------------------------------------------------------
NUSB_FUSNN      ------------------------------------------------------------
NUSB_STRCO      ------------------------------------------------------------
NUSB_FRACC      IPGQPS------------------------------------------------------
NUSB_MYCTU      ------------------------------------------------------------
NUSB_COREF      APVAPWDDSEELPAEDEAEDSRP-------------------------------------
NUSB_STRP1      ------------------------------------------------------------
NUSB_STRPN      ------------------------------------------------------------
NUSB_LACLA      ------------------------------------------------------------
NUSB_LACSS      ------------------------------------------------------------
NUSB_RIPO1      ------------------------------------------------------------
NUSB_SYNY3      ------------------------------------------------------------
NUSB_YERPE      ------------------------------------------------------------
NUSB_PHOLL      ------------------------------------------------------------
NUSB_ECOLI      ------------------------------------------------------------
NUSB_SALTI      ------------------------------------------------------------
NUSB_VIBCH      ------------------------------------------------------------
NUSB_HAEIN      ------------------------------------------------------------
NUSB_RALSO      ------------------------------------------------------------
NUSB_BURM1      ------------------------------------------------------------
NUSB_NEIMA      ------------------------------------------------------------
NUSB_PSYA2      KAAAKPALKTDNSTNNNADIDTTTVAEKPTASNKPRISANNTSVKRNSASKALANISDY>
NUSB_CAUVC      ------------------------------------------------------------
NUSB_NOVAD      ------------------------------------------------------------
NUSB_RHIME      ------------------------------------------------------------
NUSB_AGRRK      ------------------------------------------------------------
NUSB_AGRFC      ------------------------------------------------------------
NUSB_BRUME      ------------------------------------------------------------
NUSB_HYPNA      ------------------------------------------------------------
NUSB_RICCN      ------------------------------------------------------------
NUSB_RICRS      ------------------------------------------------------------
NUSB_RICPR      ------------------------------------------------------------
NUSB_CHLTR      ------------------------------------------------------------
NUSB_CHLMU      ------------------------------------------------------------
NUSB_CHLPN      ------------------------------------------------------------
NUSB_BORBU      ------------------------------------------------------------
NUSB_CAMC5      ------------------------------------------------------------
NUSB_PERMH      ------------------------------------------------------------
NUSB_DEIRA      ADTAPADTAPADPAASEPDEPRDA------------------------------------