CLUSTAL format seed alignment for MF_00075

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IF1_MYCH2       --------------------------MANLPKEQKLLFQGKVTHVFNAQEYEVTL---EN
IF1_MYCSP       -----------MEKLTYYQEITFNGKKQKRKKEEVIKMTGKVTKMHSTKNYDVLL---EN
IF1_MYCPU       -----------------------------MS-DKSIKMQAKVLKMFSTDKYELEL--LEN
IF1_MYCS5       -----------------------------MAK-DAIKLRAKVLEAYSMDDYLVEL---EN
IF1_MYCMO       -----------------------------MAK-DAIKMTGKVIKAYNTDEYDVEL---EN
IF1_PARUW       -----------------------------MAKEDTIKIEGSVEELLPNMHFRVSL---QN
IF1_CHLTR       ----------------------------MAKKEDTIVLEGRVEELLPGMHFRVML---EN
IF1_CHLAB       ----------------------------MAKKEDTIVLEGRVKELLPGMHFKILL---EN
IF1_CHLPN       ----------------------------MAKKEDTLVLEGKVEELLPGMHFRVIL---EN
IF1_MYCPN       ----------------------MQPKFNNQAKQDKLVLTGKILEIIHGDKFRVLL---EN
IF1_MYCGE       ------------------------------MKNDKLFLTGKILEIIHGDKYRVML---EN
IF1C_JASNU      ----------------------------MKEKEAKWVVEGLVTEGHPSGMFRVQL---DN
IF1C_ORYSI      ------------------MTEKKNRREKKNPREAKITFEGLVMEALPNGMFRVRL---EN
IF1C_LOLPR      ------------------MTEKKNRREKKNPREAKVTFEGLVTEALPNGMFRVRL---EN
IF1C_EPIVI      ------------------------------MKEQKWIHEGLITESLTNGMFWVRL---DN
IF1C_LEUFR      ------------------------------MKRQKWIHEGLITESPSNGMFRVRL---DN
IF1C_DAUCA      ------------------------------MKEQKWIHEGLITESLPNGMFRIRL---DN
IF1C_BOROF      ------------------------------MKEEKWIHEGLITESLPNGMFRVRL---DN
IF1C_BREMA      ------------------------------MKEQKWIHEGLITESLPNGMFRVRL---DN
IF1C_PHAAO      ------------------------------MKEQKLIHEGLITESLPNGMFRVRL---DN
IF1C_AMBTC      ------------------------------MKEQKLIHEGLITESLPNGMFQVRL---DN
IF1C_ACOAM      ------------------------------MKEQKLIHEGLITESLPNGMFWVRL---DN
IF1C_SPIOL      ------------------------------MKEQKWIHEGLITESLPNGMFWVRL---DN
IF1C_DIOEL      ------------------------------MKEQKLIHEGVIIESLPNGMFRVRL---DN
IF1C_VITVI      ------------------------------MKEQKWIHEGLITESLPNGMFRVRL---DN
IF1C_CERDE      ------------------------------MKEQKLIHEGLITESLPNGMFRVRL---DN
IF11_SYMTH      -----------------------------MARSDMIEVDGVIVEPRSNGFFTVRL-DLEN
IF1_SOLUE       -----------------------------MSKEDSIEVTGTVLEKFPSGLFSVQL---EH
IF1C_TETOB      MNQLKKSFSPTEGKKDQNNLINDPQKNKQKKQKKLVDMEGLVTHNLSNGKFRLKL---EN
IF1_UREPA       -----------------------------MADTEKLKMLGKIVEVLQGGNFRVQL---EN
IF1_MYCPE       -----------------------------MSKEGKITLKGKVVTALQGGQFKVLL---EN
IF1_AYWBP       -----------------------MSKNNLNETESKIEIEAKVVELLSNDKFKVEL---PN
IF11_CHRVO      -----------------------------MSKEDMIELEGVVIEMLPESRFRVRL---DN
IF1_RHOPB       -----------------------------MAKEELIQFEGLVTEILPDARYRVQL---DA
IF1_BRADU       -----------------------------MAKEELIQFEGLVTEILPDARYRVQL---DA
IF12_DECAR      -----------------------------MAKEELLEMQGVVNDVLPDTRFRVTL---EN
IF12_POLAQ      -----------------------------MAKEELLEMEGLVDEILPDSRYRITL---DN
IF13_ACISJ      -----------------------------MAKEELIEMQGKVDEVLPDARYRVTL---DN
IF11_ACISJ      ----------------------------MSNKEQLIEMQGKVDEVLPDSRFRVVL---EN
IF12_METFK      -----------------------------MAKEELIEMQGKVDEILPDSRFRVTL---DN
IF11_AZOSB      -----------------------------MAKEELLEMSGTVLEVLPDARYRVTL---DN
IF11_ACIAC      -----------------------------MSKEDLIEMQGKVEEVLPDSRFRVTL---DN
IF12_ACISJ      -----------------------------MAKEELIEMQGSVTEVLPDSRFRVTL---DN
IF11_AROAE      -----------------------------MAKEELIEMSGMVVEVLPDSRFRVTL---DN
IF12_POLSJ      -----------------------------MAKEELIEMHGLVDEVLPDSRFRVTL---DN
IF1_RHORT       -----------------------------MAKEELIEMDGVVTDVLPDSRFKVQL---DN
IF12_THIDA      -----------------------------MAKEEVIEMEGVVNEVLPQTRFRVTL---DN
IF12_AROAE      -----------------------------MAKEELLEMEGVVNEVLPDTRFRVTL---EN
IF13_CUPPJ      -----------------------------MAKEELVEFGGRVSEVLPDSRFRVTL---EN
IF11_CUPPJ      -----------------------------MAKEELIEFGGVVSEALPDNRYRVLL---EN
IF12_RALSO      -----------------------------MAKEELIEFEGVVSEALPDNRFRVQL---EN
IF11_BORPE      -----------------------------MAKEELIELNGIVDEVLPDSRYRVKL---DN
IF12_BORA1      -----------------------------MAKEELIELQGVVDEVLPDSRYRVTL---DN
IF13_BURCA      -----------------------------MAKEELLELDGVVDEVLPDSRFRVTL---EN
IF11_BURP0      -----------------------------MAKEELIELDGIVDEVLPDSRYRVTL---DN
IF12_BURCM      -----------------------------MAKEELLELDGIVDEVLPDSKYRVTL---EN
IF12_PARXL      -----------------------------MAKEELLELDGIVDEVLPDSRYRVTL---DN
IF1_MYCGA       ------------------------------MKETNLSIKGVVKEIIKGDKFKVLL---EN
IF1_ANADE       ----------------------------MSEKEAGIEVQGTVEEALAGGMYRVKV---DQ
IF1_THET2       ----------------------------MAKEKDTIRTEGVVTEALPNATFRVKL---DS
IF1_DEIGD       --------------------MPEQREKRKKEESDVVRAEGVVEEALPNTTFRVKL---DS
IF1_DEIRA       --------------------MPEQREKKKKDESDSVRAEGVVEEALPNTTFRVKL---DT
IF1_PETMO       -----------------------------MAKKDVVVMQGYIIEALPNANFKVKL---DN
IF1C_CHLVU      ---------------------------MTRKNIDLIEMEGVVTQCLSNGMFRVKL---EN
IF1C_TUPAK      --------MRLAPIKLVVNYYVLFGKSLNQEKENLIEMKGVITQCLSNGMFRVKL---EN
IF1_AZOC5       -----------------------------MAKEELLEFEGTVTEVLPDGNFRVRL---DN
IF1_RHOBA       ----------------------------MGKKEEAFEVEGTVTQALANTRFRVQL---ET
IF12_STRAW      ----------------------------MTKNKNVIEVEGKVVECLRSAMFTVEL---EN
IF1C_NEPOL      -----------------------------MNKQGLFQMEGLVIESLPNAMFRVRL---QN
IF1C_OSTTA      ----------------------------MASNRELIEMEGVVVESLPNAMFQVEL---EN
IF1C_PSINU      -----------------------------MKEHDLINMEGIVTESLPNAMFRVFL---DN
IF1C_ADICA      -----------------------------MKKQNLIDMEGTVTESLPNATFRACL---DN
IF1C_PINKO      -----------------------------MKKQNLIHAEGLVTESLPNGMFRVLT---DN
IF1C_MESVI      -----------------------------MERQNLIEMEGVITESLPNAMFRVHL---DN
IF1_SYNJA       -----------------------------MSKEDAIEVEGVVTESLPNAMFRVDL---DN
IF1_GLOVI       -----------------------------MAKQDVIEMEGTVVESLPNAMFRVEL---DN
IF1_SYNY3       -----------------------------MSKQDLIEMEGTVMESLPNAMFRVDL---DN
IF1_ACAM1       -----------------------------MAKQDAIEMEGTVTESLPNAMFRVDL---DN
IF1C_SPIMX      -----------------------------MKKQNLVEMEGTITESLPNAMFRVCL---DN
IF1C_CYCTA      -----------------------------MNKQNLIDVEGSVTESLPNGMFRVRL---DN
IF1C_ZYGCR      -----------------------------MKKQNLIEMEGVVTESLPNAMFRVYL---DN
IF1C_STAPU      -----------------------------MRKQNLIEMEGIVTESLPNAMFRVCL---DN
IF1C_CHAVU      -----------------------------MSKQNLIEIEGLVTESLPNAMFRVCL---DN
IF1C_CHAGL      -----------------------------MKKQNLIEMEGIVTESLPNAMFRVSL---DN
IF1C_ANGEV      -----------------------------MKKQDLIDMEGIVTESLPNAMFRVCL---DN
IF1C_HUPLU      -----------------------------MKKQKLIDMEGVVTESLPNTMFRVCL---DN
IF1C_ANEMR      -----------------------------MKKQDLIDMEGVVTESLPNAMFRVCL---DN
IF1C_MARPO      -----------------------------MEKQKLIDMEGVVIESLPNATFRVYL---DN
IF1C_PHYPA      -----------------------------MKKQNLIDMEGVVTESLPNAMFRVCL---DN
IF1C_ANTAG      -----------------------------MEKQNLIDMEGVVTESLPNAMFRVCL---DN
IF12_DESVH      -----------------------------MAADDHIEMEGVVEEALPGTLFRVVL---EN
IF12_NOVAD      -----------------------------MAKEDLLTLEGVIDEILPDGRFGVML---EN
IF1_PSELT       -----------------------------MPKDDVIKMEGTITEARRNATFLVEL---DN
IF1_THEM4       ----------------------------MSNKEDIIKMEGTIVEALPNAMFRVEL---EN
IF1_FERNB       -------------------------MIYLKNKEDVIRMEGTIVEALPNAMFRVQL---DN
IF1_THEMA       -----------------------------MGKEDVIRMEGTIIEALPNAMFRVEL---DN
IF1_RICCK       -----------------------------MSKDDLIQFTGTVLELLPNANFRVKL---EN
IF1_RICBR       -----------------------------MSKDDLIQFTGTVIELAPNATFRVKL---EN
IF1_PELUB       -----------------------------MSKQEMLSFSGIVEDLLPNAMFRVKL---EN
IF1_ERYLH       -----------------------------MAKEELLEMRGKVVELLPNAMFRVEL---EN
IF11_NOVAD      -----------------------------MAKEELLEMRGTVVELLPNAMFRVRL---EN
IF1_GLUOX       -----------------------------MSKEDLIEFTGTVMELLPNAMFRVTL---DN
IF1_ACICJ       -----------------------------MSKEDMIEFSGTVAELLPNAMFRVKL---DN
IF1_MAGSA       -----------------------------MAKEDVIEFSGTVTELLPNAMFRVKL---DN
IF1_BARQU       -----------------------------MSKEEVLEFSGIVTELLPNAMFRVKL---EN
IF1_RHOS1       -----------------------------MAKEDTLEFPGVVKELLPNATFRVEL---DN
IF1_DINSH       -----------------------------MAKEELLEFPGVVKELLPNATFRVEL---EN
IF1_PARDP       -----------------------------MAKEEMLEFPGVVKELLPNATFRVEL---EN
IF1_HYPNA       -----------------------------MSKEELIEFEGTVVELLPNATFRVKL---EN
IF1_RHILO       -----------------------------MPKEEVLEFPGVVTELLPNAMFRVKL---EN
IF1_AGRFC       -----------------------------MTKEEVLEFPGIVTELLPNATFRVKL---EN
IF1_CAUVC       -----------------------------MAKEELLEFPGTVSELLPNATFRVKL---EN
IF1_PARL1       -----------------------------MSKEELLEFPGVVTELLPNATFRVKL---EN
IF1_AQUAE       --------------------MGKKKRKQEHEKERGILLEGEVVEALPNGMFRVKL---ET
IF1_MAGMM       --------------MCQNGAQGSFRGAPPLSKEDVIEMEGTVLENLPNAMFKVEL---EN
IF1_METCA       -----------------------------MSKEDHIEMEGKVIETLPNTTFRVQL---DN
IF1_DICNV       -----------------------------MSKEENIELTGTVIETLPNTMFRVEL---EN
IF1_COXBR       -----------------------------MAKEESIEMQGTVVDSLPNTTFRVKL---EN
IF1_BAUCH       -----------------------------MTKEESIEIQGIVLDTLANAVFRVEL---EN
IF1_FRATN       -----------------------------MAKEDCIEMEGVVLEALPNTMFRVEL---EN
IF1_BLOPB       -----------------------------MTKEDSFEMHGTVLDTLPNTMFRVKL---EN
IF1_BLOFL       -----------------------------MIKEDNIEMHGIVLDTLPNTMFRVQL---EN
IF1_LEGPC       -----------------------------MAKEDHIEMAGTVIDTLPNTMFRVEL---EN
IF1_BUCCC       ------------------------------MKEKNIEMQGTVIDTLPNTTFKVEL---EN
IF1_PSESM       -----------------------------MSKEDSFEMEGTVADTLPNTMFRVEL---EN
IF1_SACD2       -----------------------------MAKEDNFELEGEVIDTLPNTTFRVKL---EN
IF1_ALKEH       -----------------------------MAKEESIKMNGTVIETLPNTMFRVEL---EN
IF1_HAHCH       -----------------------------MAKEGNIEMEGTIIDTLPNTMFRVQL---EN
IF1_HALHL       -----------------------------MAKEDSIRMQGVIVDTLPNTMFRVEL---EN
IF1_BUCBP       -----------------------------MTKEDCIEMQGVVIDTLPNTMFRVQL---DN
IF1_BUCAI       -----------------------------MSKEENIEMQGVVIDTLPNTMFRVEL---EN
IF1_BUCAP       -----------------------------MTKEDNIEMQGIVIDTLPNTMFRVEL---EN
IF1_MARHV       -----------------------------MAKSDVIEMEGVIVDTLPNTMFRVEL---SN
IF1_CHRSD       -----------------------------MAREDHIEMEGVVVDTLPNTMFRVEL---EN
IF1_MANSM       -----------------------------MAKEDCIEMQGTILETLPNTMFRVEL---EN
IF1_ACTSZ       -----------------------------MAKEDSIEMQGTILETLPNTMFRVEL---EN
IF1_HAEDU       -----------------------------MAKEDCIEMQGTILETLPNTMFRVEL---EN
IF1_NITOC       -----------------------------MAKEDSIEMEGTVVDTLPNTMFRVEL---EN
IF1_IDILO       -----------------------------MAKEDSIEMQGTVLDTLPNTMFRVEL---EN
IF1_PSEA6       -----------------------------MAKEDCIEMEGTVLDTLPNTMFRVEL---EN
IF1_WIGBR       -----------------------------MTKEENIEMQGIVLDTLPNTMFKVEL---EN
IF1_PSYIN       -----------------------------MAKEDSIEMQGTIIDTLPNTMFRVEL---EN
IF1_COLP3       -----------------------------MAKEENIEMQGTVLDTLPNTMFRVEL---EN
IF1_PHOPR       -----------------------------MAKEDVIEMQGTVQDTLPNTMFRVEL---EN
IF1_ALIF1       -----------------------------MAKEDAIELQGTVLDTLPNTMFRVEL---EN
IF1_XYLFT       -----------------------------MSKDDCIEFEGTVSETLPNTTFRIKL---ES
IF1_XANCB       -----------------------------MSNDDSIEFEGSVSETLPNTTFRVKL---EN
IF1_ACIAD       ----------------------------MANKEELIEFEGVVTETLPNTMFRVRL---EN
IF1_PSYWF       ----------------------------MAKKDDIIEFEGEVIDTLPNTLFKVRL---EN
IF1_HYDCU       -----------------------------MSKQDVIEFDGEVIETLPNTMFKVRL---EN
IF1_SALRD       -----------------------------MAKEEAIEKDGEVIEALPNAQFRVRL---EN
IF1_FLAJ1       -----------------------------MAKQSAIEQDGSIIEALSNAMFRVEL---EN
IF1_GRAFK       -----------------------------MAKQAAIEQDGTIIEALSNAMFRVEL---EN
IF1_CYTH3       -----------------------------MSKQSSIEQDGKILEALSNAMFRVEL---SN
IF1_PARD8       -----------------------------MAKQSAIEKDGVIVEALSNAMFRVEL---EN
IF1_PORGI       -----------------------------MSKQTAIEQDGVILEALSNAMFKVEL---QN
IF1_HELAH       -----------------------------MARDDVIEVDGKVIEALPNATFKVEL---DN
IF1_ARCB4       -----------------------------MAKDDVIVVDGKVIEALPNAMFRVEL---DN
IF1_CAMJR       -----------------------------MAKDDVIEIDGTVLEALPNANFKVEL---DN
IF1_CAMHC       -----------------------------MSKDDVIEIDGNVIEALPNATFKVEL---DN
IF1_HELHP       -----------------------------MAKDDVIEVDGKVIEALPNATFRVQL---EN
IF1_SULDN       -----------------------------MAKSDVIEVDGKIIEALPNATFRVEL---EN
IF1_WOLSU       -----------------------------MAKDDVIEVDGKVIEALPNATFRVEL---DN
IF1_NITSB       -----------------------------MAKDDVIEVDGIVKEALPNAMFRVEL---EN
IF1_SULNB       -----------------------------MAKDDVIEIDGKVVEALPNATFRVEL---DN
IF1_MYCCT       -----------------------------MAKETEMEFEGTVVEVLPNAQFKVKL---EN
IF1_MESFL       -----------------------------MAKEAEMEFEGTVVEVLPNAKFKVQL---EN
IF1_SPIKU       -----------------------------MAKTDLLEVQGTILEVLPNTMFKVQL---KN
IF11_DECAR      -----------------------------MAKEDYIEMLGEVVENLPNATFKVRL---EN
IF1_NEIMB       -----------------------------MAKEDTIQMQGEILETLPNATFKVKL---EN
IF1_NITEC       -----------------------------MAKEETIQMQGEVIETLPNATFRIKL---EN
IF1_NITMU       -----------------------------MAKEETIQMQGEILETLPNATFRVKL---EN
IF11_METFK      -----------------------------MAKEDRIEMQGEVLENLPNATFRVKL---EN
IF11_POLAQ      -----------------------------MSKDDVIQMAGEVVENLPNAMFRVKL---EN
IF12_CHRVO      -----------------------------MAKEDTIQMQGEVLENLPSATFKIKL---EN
IF1_METPP       -----------------------------MSKDDVIQMQGEILENLPNATFRVKL---EN
IF12_CUPMC      -----------------------------MAKDDVIQMQGEVLENLPNATFRVKL---EN
IF12_AZOSB      -----------------------------MAKEDVIEMQGEVTENLPNATFRVKL---EN
IF11_THIDA      -----------------------------MSKEDVIQMQGEVIENLPNATFRVKL---EN
IF1_TREPA       -----------------------------MTKEEAIEVDGVVKEALPNTTFRVQL---QN
IF1_BORAP       ----------------------------MDIKEEAIETEGIVKESLPNTMFRVEL---KN
IF1_TREDE       -----------------------------MAKEEAIEVEGIVKESLPNTMFRVEL---KN
IF1_VESOH       -----------------------------MSKSDYIELEGFVKEKLPNTTFMVEL---EN
IF1_RUTMC       -----------------------------MSKSDYIELEGVVKEKLPNTIFTVEL---EN
IF1_FUSNN       -----------------------------MSKKDVIELEGTIVEALPNAMFKVEL---EN
IF1_ACHLI       -----------------------------MAREDLIEVEAKVKEILPNTKFIVEL---DN
IF1_DEHMC       -----------------------------MPKKDAIEVEATVLEALPSAAFRVQL---SN
IF1_CHLPM       -----------------------------MAKEESIEIEGVILEALPNAQFKVEL---EN
IF1_PELLD       -----------------------------MAKEEAIEIEGVILEALPNAQFKVKL---EN
IF1_CHLTE       -----------------------------MAKEESIEVEGEILEALPNAQFRVKL---EN
IF1_ALCBS       -----------------------------MAKEEQIELEGVIVDTLPNTMFRVKL---DN
IF1_BIFAA       -----------------------------MAKDGVIEVEGQVVEALPNAMFRVEL---EN
IF1_OENOB       -----------------------------MAGNDVIEIEGVIKETKPNANFIVEL---EN
IF1_LACP7       -----------------------------MSKTDVVEIEGTVIEKLPNAMFSVEL---EN
IF1_CHLAA       ----------------------------MSKKKDVIEMEGTITEPLPNAMFRVQL---DN
IF1_PELCD       -----------------------------MAKEEAIEVEGKVVEPLPNAMFRVKL---DN
IF1_CUTAK       ----------------------------MAKKEGALELEGTVVEALPNAMFRVEL---KN
IF1_ACIC1       ----------------------------MAKKDGVIEIEGQVIEPLPNAMFRVEL---AN
IF1_TROW8       ----------------------------MAKKDGVIELEGSVLEALPNATFRVEL---SN
IF1_STRCO       ----------------------------MAKKQGAIEIEGTVVESLPNAMFKVEL---QN
IF1_THEFY       ----------------------------MAKKDGAIEIEGTVIESLPNAMFRVEL---DN
IF1_COREF       -----------------------------MAKEGAIEVEGRVVEPLPNAMFRVEL---DN
IF1_SALAI       ----------------------------MPKKDGAIEIEGRVIEPLPNAMFRVEL---AN
IF1_KINRD       ----------------------------MPKKDGVIEIEGTVIEALPNAMFRVEL---SN
IF1_PAEAT       ----------------------------MAKKDGVIEIEGVVTEALPNAMFRVEL---TN
IF1_LEIXX       ----------------------------MAKKDGVIEIEGSVIEALPNAMFRVEL---TN
IF11_DESAG      -----------------------------MAKEEAITVTGVVQEALPNAMFRVEL---EN
IF11_DESVH      -----------------------------MAKEDAIEVDGVVQEALPNAMFRVEL---QN
IF12_DESAG      -----------------------------MAKEDAIEVDGIVQEALPNAMFQVEL---EN
IF1_KORVE       -----------------------------MSKEDAIEVMAVVIEPLPNAMFKVEL---EN
IF1_LEPBL       -----------------------------MAKEEAITVDGTVLEPLPNAMFRVEL---EN
IF1_DESPS       -----------------------------MAKEEAIEVEGTIIEPLPNAMFRVEL---DN
IF1_SYNAS       -----------------------------MAKEEPIEVEGRVIEPLPNAMFRVEL---EN
IF1_GEOMG       -----------------------------MSKEEAIEVEGTVIEPLPNAMFRVEL---EN
IF1_GEOUR       -----------------------------MSKEEAIEVEGTVIEPLPNAMFKVKL---EN
IF1_CLOD6       -----------------------------MAKKDVIELEGTVSEALPNAMFKVKL---EN
IF1_ALKOO       -----------------------------MSKQDVIELEGVVKEALPNAMFIVTL---EN
IF1_CLONN       -----------------------------MSKDDVIEMQGTVLEALPNAMFQIQL---ES
IF1_ALKMQ       -----------------------------MSKEDVIEVEGVIKEALPNATFQVEL---EN
IF1_CLOAB       -----------------------------MSKEDVIEMQGTVLESLPNAMFEVEL---ES
IF1_HUNT2       -----------------------------MSKEDVIEVEGKVVEALPNAMFEVEL---EN
IF1_RUBXD       -----------------------------MAKEDVIEVEGTVTEALPNTQFRVEL---DN
IF1_MYXXD       -----------------------------MPKDDSIEVEGTVMEPLPNAMFRVVL---DN
IF1_LACLC       -----------------------------MAKDDVIEVDGKVVDTMPNAMFTVEL---EN
IF1_STRS2       -----------------------------MAKEDVIEIEGKVVDTMPNAMFTVEL---EN
IF1_STRGC       -----------------------------MAKDDVIEVEGKVIDTMPNAMFTVEL---EN
IF1_CALS4       -----------------------------MAKDDVIEVEGTVIEALPNAMFQVQL---DN
IF1_CALS8       -----------------------------MSKEDVIELEGTVIEALPNAMFQVQL---DN
IF1_LEUMM       ------------------------------MANDVIEIEGKVKETLPNAMFQVEL---EN
IF1_SYNWW       -----------------------------MAKEDVIEVEGTVVEPLPNTMFKVEL---DN
IF1_SYNFM       -----------------------------MAKEDAIEVEGTVVETLPNAMFRVEL---PN
IF1_STAHJ       -----------------------------MAKQDVIELEGTVLDTLPNAMFKVEL---EN
IF1_LACBA       -----------------------------MAKSDVIEVEGKVTETLPNAMFRVEL---EN
IF1_LACRD       -----------------------------MAKADVIEVEGKVTETLPNAMFKVEL---EN
IF1_PEDPA       -----------------------------MAKDNVIEIEGTVKETMPNAMFKVEL---EN
IF1_LACSS       -----------------------------MAKDDVIEIEGKVTDTLPNAMFKVEL---EN
IF1_LACH4       -----------------------------MAKDDVIEVEGKVVDTLPNAMFKVEL---EN
IF1_LACPL       -----------------------------MAKEDVIEIQGTIKETLPNAMFKVEL---EN
IF1_LACP3       -----------------------------MAKDDVIEIQGTVTDTLPNAMFKVKL---EN
IF1_LISMO       -----------------------------MAKEDVIEVEGVVQETLPNAMFNVEL---EN
IF1_ENTFA       -----------------------------MAKEDMIEVEGTVVETLPNAMFKVEL---EN
IF1_BACAH       -----------------------------MAKDDVIEVEGTVLETLPNAMFKVEL---EN
IF1_BACSU       -----------------------------MAKDDVIEVEGTIVETLPNAMFKVEL---EN
IF1_OCEIH       -----------------------------MAKDDVIEVEGTVTDTLPNAMFKVEL---EN
IF1_BACSK       -----------------------------MAKEDVIEVEGTVIEPLPNAMFRVEL---EN
IF1_DESHY       -----------------------------MSKEDVIEVEGKVLEPLPNAMFLVEL---SN
IF1_MOOTA       -----------------------------MAKEDVIEVEGKVIEPLPNAMFRVEL---AN
IF1_PELTS       -----------------------------MSKQDVIEVEGTVIEPLPNAMFRVEL---QN
IF12_SYMTH      -----------------------------MSKDDVIEVEGTVVENLPNAMFRVEL---PN
IF1_CARHZ       -----------------------------MSKDDVIEVEGTVVEPLPNAMFRVEL---DN
                                                       . :        :         

IF1_MYCH2       GIKLNCHIAGKMKIHHIKIIIGDMVKVEISPYDLSKGRIVYRF-K---------------
IF1_MYCSP       DQEIKAYISGKMSLHNIKLIPGDMVDVEISPFNLTLGRIVFRH-K---------------
IF1_MYCPU       KVIIKGHISGKMRIHKIRILPGDIVDVEISPHDLSNGRITYRH-K---------------
IF1_MYCS5       KQQIKAKISGKMRVNRIRILPGDLVDVELSSYDLTKGRITYRH-K---------------
IF1_MYCMO       GIVVRAHISGKIRVHHITILRGDTVDVELSTYDLTKGRIVYRH-R---------------
IF1_PARUW       GLNVIAHLCGKMRMKNIRVLVGDVVTVEMSPYDLSKARIIFRQ-R---------------
IF1_CHLTR       GVPITAHLCGKMRMSNIRLLVGDRVTVEMSTYDLTKARVVYRH-R---------------
IF1_CHLAB       GMPVTAHLCGKMRMSNIRLLVGDRVTVEMSAYDLTKARVVYRH-R---------------
IF1_CHLPN       GMPVTAHLCGKMRMSNIRLLVGDRVTVEMSAYDLTKARVVYRH-R---------------
IF1_MYCPN       NVEVDAHLAGKMRMRRLRILPGDLVEVEFSPYDLKLGRIIGRK-----------------
IF1_MYCGE       NVEVDAHLAGKMKMKRTKILPGDVVEVEFSPYDLKLGRITQRK-----------------
IF1C_JASNU      GARVLGYISGKIRRKAIRIMQGDRVQIELSHYDLTKGRIIYRLPPPPIPKPKDSEDDSED
IF1C_ORYSI      DTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRL-PHKDSKRTEDSKDTED
IF1C_LOLPR      DTIILGYISGKIRSSSIRILMGDRVKIEVSRYDSSKGRIIYRL-PHKDSKRIEDSKDSED
IF1C_EPIVI      KDLIIGYVSGNIRHSFIRILPGDKVKIEVSRYNSTRGRIIYRL-RNKYYKD---------
IF1C_LEUFR      XDLIPSYVSGKIRRSLIRILPGDKVKIEVSRYDSTRGRIIYRL-RNKDSKD---------
IF1C_DAUCA      QDMILGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRL-RNKDSKD---------
IF1C_BOROF      EDLVLGYVSGKIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRL-RNKDSKD---------
IF1C_BREMA      EDFILGYISGRIRRSFIRILPGDRVKIEISRYDSTRGRIIYRL-RNKDSNY---------
IF1C_PHAAO      EDLILGYISGRIRRSFIRILPGDRVKIEMSRYDSTRGRIIYRL-RKKDSND---------
IF1C_AMBTC      GDLVLGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRL-RNKDSND---------
IF1C_ACOAM      EDLVLGYISGRIRRSSIRILPGDRVKIEVSRYDSTRGRIIYRL-RNKDSNE---------
IF1C_SPIOL      EDPILGYVSGRIRRSSIRILPGDRVKIEVSRYDSTRGRIIYRL-RNKDSND---------
IF1C_DIOEL      EDLILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTKGRIIYRL-RNKDSND---------
IF1C_VITVI      ENMILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTKGRIIYRI-RNKDSNN---------
IF1C_CERDE      EKMILGYVSGRIRRSFIRILPGDRVKIEVSRYDSTRGRIIYRL-RNKDSND---------
IF11_SYMTH      QPEVIAHLGGKLRRHYIRVVPGDRVTVELSPYDLTRGRIVYRY-RH--------------
IF1_SOLUE       ERVVLAHLAGRLRRNRIRVLAGDKVTLELSPYDLTKGRITFRH-R---------------
IF1C_TETOB      GVEVIGHLSGKIRQNRIKIVVGDKVTVELSPYDLTKGRITYRH-R---------------
IF1_UREPA       GITIMSHVSGKMRVNKINILPGDTVDVELSPYDLTRGRITYRH-RDN-------------
IF1_MYCPE       NVEIIANVSGKIRVYKIQILKGDTVEVELSPYDLTRGRIIYRI-S---------------
IF1_AYWBP       KKTIIAYVSGKIRINNIRILPGDKVRIELSPYYPTQARITYRF-K---------------
IF11_CHRVO      NMEILAYGSGKMKMHRIRVLLGDRVTVEMSPYDLTKGRINFRH-PTANPGAG--------
IF1_RHOPB       GHEIVAYTAGKMKKNRIKTLAGDRVTIEMSPYDLEKGRLIFRH-KDERPGGGPPRGAPPR
IF1_BRADU       GHEIVAYTAGKMKKNRIKTLAGDRVTVEMSPYDLEKGRLIFRH-KDERPATSGGPPRGGA
IF12_DECAR      GHELIAYTSGKMKKNHIRILVGDKVTLELSPYDLSKGRITFRH-IENRGTPN-------P
IF12_POLAQ      GHKLIAYTAGRVKKNHIRILAGDKVSLEVSPYDLSKGRITFRH-IDKKQSFA-------G
IF13_ACISJ      GHQLIAYTGGKMRKFRIRILAGDLVTLEMSPYDLNKGRVTFRH-IENRTRTT-------P
IF11_ACISJ      GHTLIAYSGGKMRKHRIRVLAGDTVSLEMSPYDLTKGRITFRH-LEPRAGGA-------P
IF12_METFK      GHILVAYTGGKMRKNHIRILAGDKVTVEMSPYDLAKGRIIFRH-IEASSSRP-------F
IF11_AZOSB      GHSLVAYGAGKMRKHHIRIIAGDKVLLELSPYDLSKGRITFRH-IEGRAPMT--------
IF11_ACIAC      GHQLIAYAGGKMRKHRIRVLAGDRVSLELSPYDLNKGRLTFRH-IEGRGPRA--------
IF12_ACISJ      GHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH-LAGRGPGP-------G
IF11_AROAE      GHNLVAYSAGKMRKHHIRILCGDKVSLELSPYDLSKGRITFRH-LEGRGPLG--------
IF12_POLSJ      GHKLVAYTSGKMRKNHIRILAGDQVSLELSPYDLSKGRITFRH-IAGRGPGP--------
IF1_RHORT       GHEVMAYSAGKMKKHRIRIMVGDRVDMEMTPYDLTKARITYRH-KVGGPPGPVTGGGNRP
IF12_THIDA      GFEITAYASGKMRKHRIRILAGDKVTVEMSPYDLTKGRINFRH-KDAHQAPRPTVARRYN
IF12_AROAE      GVEVQAYASGKMRKHRIRILAGDKVSVELSPYDLTKARISFRH-KDERPAGAPSQFRRR-
IF13_CUPPJ      GFEVWAYSSGRLKKNRIRILAGDRVTLEMSPYDLTKGRINYRH-KV--------------
IF11_CUPPJ      GVEIWAYASGKMQKHRIRILAGDRVTLEMSPYDLTKGRINFRH-KS--------------
IF12_RALSO      GVEVWAYASGKMQKHRIRILAGDRVKLEMSPYDLTKGRINYRH-K---------------
IF11_BORPE      GIEVGAYASGRMRKHRIRILAGDRVTLEMSPYDLTKGRINFRH-KDERSGPPSRPPQHRR
IF12_BORA1      GVAVGAYASGRIRKHRIRILAGDRVTLEMSPYDLTKGRINFRH-KDERPSSAPANRNFVR
IF13_BURCA      GAVVAAYASGRMRKHRIRILAGDRVKLELSVYDLTKGCINFRH-KDERASPGVPRNRFVR
IF11_BURP0      GVVVGAYASGQMRRHRIRILAGDRVTLELSVYDLTKGRINFRH-KDERRSDAAPRASARR
IF12_BURCM      GVVVGAYASGRMRKNHIRILAGDRVTLELSMYDLTKGRINFRH-KDANSTRPPRSGQPRR
IF12_PARXL      GVVVGAYASGRMRKNHIRILAGDRVTLELSVYDLTKGRINFRH-KDERATGG------GG
IF1_MYCGA       NLLIEAHVSGKIRMHKIRILPGDSVEVEFSPYDLTKGRIIYRH-----------------
IF1_ANADE       GPVVLAYASGKMKKFHIRIIPGDRVKLELSPYDLSRGRITYRD-K---------------
IF1_THET2       GPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK-----------------
IF1_DEIGD       GHDILAYISGKMRIHYIRILPGDRVVLEISPYDTSRGRIVYRK-----------------
IF1_DEIRA       GHDILAYISGKMRIHYIRILPGDRVVLEISPYDTSRGRIVYRR-----------------
IF1_PETMO       GHEILAHISGRMRKNFIKILPGDRVTVEVSVYDLNKGRIVKRE-KVNKD-----------
IF1C_CHLVU      GFLVLAHVSGKIRRNSIRILLGDRVAVELSPYDLHRGRITFRL-RPGSKT----------
IF1C_TUPAK      GFKVIAHISGKIRRNFIRILLGDSVIVELSPYDLTRGRIIYRL-KPTNSSTETLRFNTNL
IF1_AZOC5       DHQILAYAAGKMKKNRIRTIEGDRVVVEMSPYDLDRGRINFRH-KAEGNAPPPGARRQQN
IF1_RHOBA       GNEVMAHVAGRMRKHFIRIVPGDKVRVELSPYDLTKGRIVYRE-R---------------
IF12_STRAW      GHQVLAHISGKIRKNYIKIMLEDRVLVELPPYDLTRGRIVFRY-RN--------------
IF1C_NEPOL      GFVILAHISGKIRRNYIRIIVGDRVLCELTPYDLTKGRIVYRQ-RSTPRP----------
IF1C_OSTTA      GFQVLAHISGKIRRNSIKILLGDRVTVELTPYDLTKGRIIYRL-RKDRTQ----------
IF1C_PSINU      GCHVLTHISGKIRRNYIRILPGDRVKVELSIYDLTKGRILYRI-RNEASKDTL-------
IF1C_ADICA      GCQVLTHISGRMRRSYIRILPGDRVRVELSPYDLTKGRIIYRL-RSRHTNNSQ-------
IF1C_PINKO      GCQILTHISGRIRRNSVRILPGDRVKVELSAYDLTKGRIIYRL-SNKS------------
IF1C_MESVI      GFNVLAHISGKIRRNYIRILPGDRVKIELTPYDLTKGRITYRL-RKR-------------
IF1_SYNJA       GFNVLAHISGKIRRNYIKILPGDRVKVELSPYDLNKGRITYRL-KKK-------------
IF1_GLOVI       SFNILAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRL-RK--------------
IF1_SYNY3       GFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRL-KNKK------------
IF1_ACAM1       GFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRL-RKK-------------
IF1C_SPIMX      GCYVLAHISGKIRRNYIRILIGDRVKVELSPYDLSKGRITYRL-RIKSINDSNDLIK---
IF1C_CYCTA      GCQVPTHISGKIRRNHVRILPGDRVKVELSPYDLTKGRIIYRL-RNKSSNDWITS-----
IF1C_ZYGCR      GCEVLAHISGKIRRNYIRILLADRVKVELSPYDLTKGRITYRL-RTKSNG----------
IF1C_STAPU      GCQVLAHISGKIRKNYIRILLGDRVKVELSPYDLTKGRITYRL-RTRSPS----------
IF1C_CHAVU      GCEVLTHISGKIRKNYIRILPGDRVKVELSPYDLTKGRITYRL-RSKNTNT---------
IF1C_CHAGL      GCQVLAHISGKIRRNYIRILPGDKVKVELSPYDLTKGRITYRL-RMKTTNG---------
IF1C_ANGEV      GCQVLTHISGKIRRNYIRILPGDRVRVELSPYDLTKGRIIYRL-RNKYPNGISQEVFRSM
IF1C_HUPLU      GCQVLTHVSGRMRRNYIRILPGDRVKVESSPYDLTKGRITYRF-HTKSSND---------
IF1C_ANEMR      GCQVLTHISGRIRRNYIRILPGDRVRVESSPYDLTKGRITYRL-RAKSSTD---------
IF1C_MARPO      GCIVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYRL-RAKSSNN---------
IF1C_PHYPA      GCEVLTHISGKIRRNYIRILPGDRVKVELTPYDLTKGRITYRL-RAKSSNS---------
IF1C_ANTAG      GCQVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYRL-RTKSSNP---------
IF12_DESVH      GHEVLAHLCGKMRKFRIRVLPGDKVTVHISPYDLTKGRIARRT-TTPSGGPRPARSGNRR
IF12_NOVAD      GHRIIAYTAGKMRKFRIRSIVGDSVRVEMTPYDLTKGRIVYRE-KVGGGGPGGVRRRR--
IF1_PSELT       GHKILAQISGRMRKNFIRLFPGDRVVVELSIYDLTKGRIVYRK-KLDRKGSDEGTGERS-
IF1_THEM4       GHKILAHISGKMRKNFIRLVPGDKVVVELTIYDLTKGRIVYRK-KS--------------
IF1_FERNB       GFKVLAHVSGKMRKNFIRLVPGDRVVVELTIYDLTRGRIVYRK-KLDSKGEEEILDDDE-
IF1_THEMA       GHKVLAHVSXRMRKNFIRLVPGDRVIVELSVYDLTRGRIVYRK-KPE-------------
IF1_RICCK       DHLIIAHTSGRMRKNRIRILLGDKVTVEMTPYDLTKGRVIHRH-----------------
IF1_RICBR       GHVIIAHTAGRMRKNRIRILLGDKVTVEMTPYDLTKGRVILRH-QS--------------
IF1_PELUB       GHIVTAHAAGKLRKNRIRVLQGDKVQVEMTPYDLTKGRITFRG-----------------
IF1_ERYLH       GHEVLGHTAGKMRKNRIRVLVGDEVLCELTPYDLTKARITYRF-MPGRGGPGQGPGPQ--
IF11_NOVAD      DHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRF-MPGRGGPGGF------
IF1_GLUOX       EHTILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLSKGRITFRF-K---------------
IF1_ACICJ       DHIILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRF-K---------------
IF1_MAGSA       DHEILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRY-K---------------
IF1_BARQU       DHEIIAHTAGRMRKNRIRVLAGDKIMVEMTPYDLTKGRITYRY-K---------------
IF1_RHOS1       GHELIAVMAGKMRKNRIRVLAGDKVQVEMTPYDLSKGRINYRF-K---------------
IF1_DINSH       GHEIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLTKGRINYRF-K---------------
IF1_PARDP       GHEIIAHMAGKMRKNRIRVLAGDKVQVEMNTYDLTKGRINYRF-K---------------
IF1_HYPNA       DHEIIAHTAGKMRKNRIRVLTGDKVMVEMTPYDLTKGRITYRF-K---------------
IF1_RHILO       EHEIIAHTAGRMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRF-K---------------
IF1_AGRFC       EHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRF-K---------------
IF1_CAUVC       DHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRF-K---------------
IF1_PARL1       EHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRF-K---------------
IF1_AQUAE       GQEVLAHIAGKLRVNFIRILPGDKVKVELSPYDLTRGRIVYRL-----------------
IF1_MAGMM       KHSLLCHISGRMRKNYIRILPGDKVTVQLTPYDLTKGRISYRH-K---------------
IF1_METCA       GHVVIAHISGKMRKNYIRILTGDRVKVELTPYDLSKARITFRH-R---------------
IF1_DICNV       GHQINAHISGRMRKHYIRILTGDKVKVEMTPYDLSKGRIVFRE-K---------------
IF1_COXBR       GHVVTAHISGRMRKHYIRILTGDAVTVELTPYDLTRGRIVYRE-AGKKPPTSKAEE----
IF1_BAUCH       GHIVTAHISGKMRKNYIRILTGDKVTVELTPYDLKKGRITFRS-R---------------
IF1_FRATN       GHIVTAHISGKMRKNYIRILTGDKVVVEITPYDLTKGRIKFRS-K---------------
IF1_BLOPB       GHVIVAHISGKIRKNYIRILTGDKVTVELTPYDLSKGRIIFRS-R---------------
IF1_BLOFL       GHKITAHISGKIRKNYIRILTGDKVTVELTPYDLSKGRIIFRS-R---------------
IF1_LEGPC       GHIVTAHISGRMRKNYIRILTGDKVKVELTPYDLSKGRIIFRD-KG--------------
IF1_BUCCC       KHIVIAHISGKMRKNYIRILTGDKVTLELTPYDLSKGRIIFRS-R---------------
IF1_PSESM       GHVVTAHISGKMRKNYIRILTGDKVRVELTPYDLSKGRITYRA-R---------------
IF1_SACD2       GHVVTAHISGKMRKNYIRILTGDKVKVEMTPYDLSKGRITYRA-R---------------
IF1_ALKEH       GHVVTAHISGKMRKHYIRILTGDKVTVELTPYDLSKGRITYRA-R---------------
IF1_HAHCH       GHVVTAHISGKMRKNYIRILTGDKVKVEMTPYDLSKGRIVYRA-R---------------
IF1_HALHL       GHVVTAHISGKMRKHYIRILTGDKVTVELTPYDLNKGRIVYRE-R---------------
IF1_BUCBP       KHIVTAHISGKMRKNYIRILTGDKVTLELTPYDLSKGRIIFRS-R---------------
IF1_BUCAI       KHIVTAHISGKMRKNYIRILTGDKVTVELTPYDLTKGRIIFRS-R---------------
IF1_BUCAP       KHVITAHISGKMRKNYIRILTGDKVTIELTPYDLTKGRIIFRS-R---------------
IF1_MARHV       GHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRA-R---------------
IF1_CHRSD       GHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRA-R---------------
IF1_MANSM       GHVVTAHISGKMRKNYIRILTGDKVTIEMTPYDLNKGRIIFRS-R---------------
IF1_ACTSZ       GHVLTAHISGKMRKNYIRILTGDKVTVEMTPYDLTKGRIIFRA-R---------------
IF1_HAEDU       GHIVAAHISGKMRKNYIRILTGDKVTVEMTPYDLSKARIIFRA-R---------------
IF1_NITOC       GHVITAHISGKMRKHYIRILTGDKVTVQLTPYDLSKGRIVYRA-R---------------
IF1_IDILO       GHVVTAHISGKMRKHYIRILTGDTVTVQLTPYDLTKGRIVFRA-R---------------
IF1_PSEA6       GHVVTAHISGKMRKNYIRILTGDKVTCEMTPYDLSKGRIIYRA-R---------------
IF1_WIGBR       KHVVLAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIIFRS-R---------------
IF1_PSYIN       GHIVTAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVFRA-R---------------
IF1_COLP3       GHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIIFRA-R---------------
IF1_PHOPR       GHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRA-R---------------
IF1_ALIF1       GHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRA-R---------------
IF1_XYLFT       GHEVTAHISGRMRKNYIRILTGDRVKIEMTAYDLTKGRIIYRM-K---------------
IF1_XANCB       GYEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRM-K---------------
IF1_ACIAD       GHEVIAHISGKMRKHYIRILTGDNVKVEMTPYDLSKGRITYRA-R---------------
IF1_PSYWF       GHEIIAHISGKMRKHYIRILTGDKVKVEMTPYDLTKGRITYRG-KT--------------
IF1_HYDCU       GHEILAHISGRMRKNYIRILAGDKVKVELTPYDLTKGRITYRG-K---------------
IF1_SALRD       GHEILGLLSGKMRMNYIKILPGDRVKVEMSPYDLSKGRIVYRY-KN--------------
IF1_FLAJ1       GHIVIAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY-----------------
IF1_GRAFK       GHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY-----------------
IF1_CYTH3       GHQVIAHISGKMRMNYIKILPGDKVRMEMSPYDLTKGRIVFRY-K---------------
IF1_PARD8       GHEITAHISGKMRMHYIKILPGDKVRVEMSPYDLSKGRIAFRY-K---------------
IF1_PORGI       GHVITAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRISFRY-K---------------
IF1_HELAH       KHVVLCRISGKMRMHYIRIALGDRVKLELTPYSLDRGRITFRY-K---------------
IF1_ARCB4       GHVVLCHISGKMRMHYIKILPNDTVKVEITPYSLDKGRITHRY-K---------------
IF1_CAMJR       KHVILCHIAGKMRMHYIRIMPGDKVKVELTPYSLDKGRITFRY-K---------------
IF1_CAMHC       KHVILCHIAGKMRMHYIKIMPGDRVKVELTPYSLDKGRITYRY-K---------------
IF1_HELHP       GHIVLCHIAGKMRMHYIKILPGDMVKIELTPYSLDKGRITYRH-K---------------
IF1_SULDN       GHIILCHIAGKMRMHYIKILPGDKVKLELTPYSLDKGRITYRY-K---------------
IF1_WOLSU       KHVILCHIAGRMRMHYIKILPGDRVKIELTPYSLDKGRITFRY-K---------------
IF1_NITSB       GHVVLCHIAGKMRMHYIKILPGDKVKVELTPYSLDKGRITFRY-K---------------
IF1_SULNB       GHIVLCHIAGKMRMHYIKILPGDKVKVELTPYSLDKGRITFRY-K---------------
IF1_MYCCT       GVVINAHVSGKIRMHYIRILPGDKVTIVISPYDMTRGRITYRK-IGK-------------
IF1_MESFL       DIVIDAHVSGKIRMHYIRILPGDKVTVVISPYDMTRGRITYRK-IAKKAEV---------
IF1_SPIKU       GATILAHVSGKIRMNYIRILPGDTVVVEMSPYDLERGRIVFRH-K---------------
IF11_DECAR      GHIVHGFISGKMRMHYIRILPGDKVTVQLTPYDLTKARIVFRT-K---------------
IF1_NEIMB       DHIVLGHISGKMRMHYIRISPGDKVTVELTPYDLTRARIVFRA-R---------------
IF1_NITEC       GHIVLGHISGKMRMNYIRILPGDKVTVDLTPYDLTRARITFRT-K---------------
IF1_NITMU       GHIVLGHISGKMRMHYIRILPGDKVTVDLTPYDLSRARITFRA-K---------------
IF11_METFK      GHVVLGYISGKMRMHYIRILPGDKVTVEMTPYDLSRARIIFRA-K---------------
IF11_POLAQ      GHVFLGHISGKMRMHYIRILPGDKVTVEMTPYDLTRARIIFRA-K---------------
IF12_CHRVO      GHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRA-K---------------
IF1_METPP       GHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRA-K---------------
IF12_CUPMC      GHIVLGHISGKMRMNYIRILPGDKVTVELTPYDLSRARIVFRT-K---------------
IF12_AZOSB      GHMVLGHISGKMRMHYIRILPGDKVTVQLTPYDLTKGRIVFRT-K---------------
IF11_THIDA      GHVLLGHISGKMRMHYIRILPGDKVTVELTPYDLTKGRIVFRA-K---------------
IF1_TREPA       GHEILAYLSGRMRKHYIRIVPGDSVKVALSPYDLSRGRIMFRE-R---------------
IF1_BORAP       KHIVLAHLSGKMRKHFIKIVPGDKVKVELSPYDLTKGRIVYRE-K---------------
IF1_TREDE       GHVILAHLSGKMRKHYIKIVPGDTVKVALSPYDLTRGRIIFRE-R---------------
IF1_VESOH       GHCILAHISGKIRKHYIRILPGDKVTVEMTPYDLTKGRITFRH-K---------------
IF1_RUTMC       GHRILAHISGKIRKHYIRILPGDKVTVEMTPYDLTKGRIIFRH-K---------------
IF1_FUSNN       GHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRK-KN--------------
IF1_ACHLI       GHTVVAHVSGKIRIHNIRILPGDKVTVELSPYDLSRGRITYRK-K---------------
IF1_DEHMC       GHEVLAHISGKMRVHYIRILPGDRVLVELSPYDLTRGRVTYRF-KS--------------
IF1_CHLPM       GLVVLAHVSGKIRMHYIRILPGDKVKVQISPYDISKGRITYRY-K---------------
IF1_PELLD       SLEVLAHVSGKIRMHYIRILPGDKVKVQISPYDISKGRITYRY-K---------------
IF1_CHLTE       GLEVLAHVSGKIRMHYIRILPGDKVKVQISPYDLSKGRITYRY-K---------------
IF1_ALCBS       GHVITAHISGKMRKFYIRILTGDRVKVEMSPYDLTKGRITFRM-K---------------
IF1_BIFAA       KHIVLATISGKMRKNYIRILPQDRVVLEMSPYDLNRGRITYRY-K---------------
IF1_OENOB       GARIQAGVSGKIRKNYIRILVGDRVTVEMSPYDLTKGRITYRH-K---------------
IF1_LACP7       GHRVLAHISGKLRMNFIKIVPGDKVTLELSPYDLTKGRIIWRD-K---------------
IF1_CHLAA       GHEVLAHISGKMRMNYIRILKGDRVLVELSPYDLTRGRITYRY-K---------------
IF1_PELCD       GHTILAHISGKMRKFYIRILPGDRVTVELSPYDLTRGRITYRE-K---------------
IF1_CUTAK       GHRVLATISGKMRQHYIRILPSDRVVVELSPYDLTRGRIVYRH-K---------------
IF1_ACIC1       GHKVLAHISGKMRMHYIRILPGDRVVVELSPYDLNRGRIVYRY-R---------------
IF1_TROW8       GHKVLAHISGRMRQHYIRILPEDRVVVELSPYDLARGRIVYRY-K---------------
IF1_STRCO       GHQVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRY-K---------------
IF1_THEFY       GHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRY-K---------------
IF1_COREF       GHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRY-K---------------
IF1_SALAI       GHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRY-K---------------
IF1_KINRD       GHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRY-K---------------
IF1_PAEAT       KHVVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRY-K---------------
IF1_LEIXX       GHKVLAHISGKMRQHYIRILPEDRVIVELSPYDLTRGRIVYRY-K---------------
IF11_DESAG      GHEVLAHISGKMRKFHIRVLPGDKVSVELSPYDLTRGRITFRP-R---------------
IF11_DESVH      GHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLKRGRITYRM-K---------------
IF12_DESAG      GHTVLAHISGKMRKFYIRILPGDKVRVELSPYDLNRGRITYRM-K---------------
IF1_KORVE       KHQVLAHVSGKMRKNFIRILPGDRVAVELSPYDLTRGRIVYRY-K---------------
IF1_LEPBL       GHKVLAHISGKMRMHYIRILPGDKVTVELSPYDLSKGRITYRK-K---------------
IF1_DESPS       GHKVLAHISGKMRMHFIKILPGDRVTVELSPYDLTRGRVTFRT-KNTKKKK---------
IF1_SYNAS       GHRVLAHISGKMRMHFIKILPGDKVTVELSPYDLTRGRIIYRT-K---------------
IF1_GEOMG       GHVVLAHISGKMRKYFIKILPGDKVTVELSPYDLSRGRITYRA-K---------------
IF1_GEOUR       DHIVLAHISGKMRKYFIKILPGDKVTVELSPYDLTRGRITYRA-K---------------
IF1_CLOD6       GHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRK-K---------------
IF1_ALKOO       GHEVLGHISGKLRMNFIRILPGDKVTVELSPYDLSRGRITWRK-K---------------
IF1_CLONN       GQTILGHVSGKLRMNFIRILPGDKVTVELSPYDLSRGRITWRA-K---------------
IF1_ALKMQ       GHVVLAHLSGKLRMHFIRILPGDKVTVELSPYDLTRGRITWRK-K---------------
IF1_CLOAB       GQKILAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRA-K---------------
IF1_HUNT2       GHKVLAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRA-K---------------
IF1_RUBXD       GHNVLAHISGKMRMNYIRILPGDRVKVELSPYDLSRGRITYRY-RS--------------
IF1_MYXXD       GHKVLAHISGKMRMHFIRILPGDKVKVELSPYDLTRGRITYRA-K---------------
IF1_LACLC       GHQVLATISGKIRKNYIRILPGDKVQVELSPYDLTRGRITYRF-K---------------
IF1_STRS2       GHQVLATVSGKIRKNYIRILVGDRVTVELSPYDLTRGRITYRF-K---------------
IF1_STRGC       GHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRF-K---------------
IF1_CALS4       GHKVLAHVSGKLRMNFIRILPGDRVKVELSPYDLTRGRIVWRG-K---------------
IF1_CALS8       GHKVLAHVSGKLRMNFIRILPGDRVVVQLSPYDLTRGRIVWRS-K---------------
IF1_LEUMM       GAVILAHVSGKIRKNFIRILPGDRVTVEMSPYDLTKGRITYRF-R---------------
IF1_SYNWW       GHKVLAHISGKMRMNFVRILPGDRVMVELSPYDLNRGRIIYRF-K---------------
IF1_SYNFM       GHRILAHISGKMRMHFIRILPGDKVTVELSPYDLNRGRITYRS-KS--------------
IF1_STAHJ       GHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLSRGRITYRY-K---------------
IF1_LACBA       GHEILAHVSGKIRMHYIRILPGDRVTVEMSPYDLSKGRITYRF-K---------------
IF1_LACRD       GAEILAHVSGKIRMHYIKILPGDRVKVEMSPYDLTKGRITFRF-K---------------
IF1_PEDPA       GHEILAHVSGKIRMHYIKILPGDKVTVEMSPYDLSKGRITYRF-K---------------
IF1_LACSS       GAVILAHVSGKIRKNYIKILPGDRVTVELSPYDLTKGRITYRF-K---------------
IF1_LACH4       GATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK---------------
IF1_LACPL       GAEILAHVSGKIRMHYIRILPGDKVTVEMSPYDLTKGRITYRF-K---------------
IF1_LACP3       GAEILAHVSGKIRMHYIRILPGDKVTVELSPYDLTKGRITYRF-K---------------
IF1_LISMO       GHKVLATVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRF-K---------------
IF1_ENTFA       GHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRF-K---------------
IF1_BACAH       GHVVLAHVSGKIRMNFIRILPGDKVTVELSPYDLNRGRITYRF-K---------------
IF1_BACSU       GHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRY-K---------------
IF1_OCEIH       GHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRY-K---------------
IF1_BACSK       GHKILAHVSGKIRMNFIRILPGDKVTVELSPYDLTRGRITYRY-K---------------
IF1_DESHY       GHKVLAHVSGKIRMNFIRILPGDRVTVELSPYDLSRGRIVYRF-K---------------
IF1_MOOTA       GHRVLAHVSGKIRMNFIRILPGDRVTVELSPYDLNRGRIVYRY-K---------------
IF1_PELTS       GHKVLAHVSGKIRMNFIRILAGDRVMVELSPYDLTRGRIVYRY-K---------------
IF12_SYMTH      GHRVLAHVSGKIRMHFIRILPGDRVTVELSPYDLTRGRIVYRY-K---------------
IF1_CARHZ       GHKVLAHVSGKIRMNFIRILPGDRVTVELSPYDLTRGRIIYRH-K---------------
                   .      .:            :           . :  *                  

IF1_MYCH2       ---------
IF1_MYCSP       ---------
IF1_MYCPU       ---------
IF1_MYCS5       ---------
IF1_MYCMO       ---------
IF1_PARUW       ---------
IF1_CHLTR       ---------
IF1_CHLAB       ---------
IF1_CHLPN       ---------
IF1_MYCPN       ---------
IF1_MYCGE       ---------
IF1C_JASNU      ---------
IF1C_ORYSI      LKDTKDSKG
IF1C_LOLPR      LKDITDSKD
IF1C_EPIVI      ---------
IF1C_LEUFR      ---------
IF1C_DAUCA      ---------
IF1C_BOROF      ---------
IF1C_BREMA      ---------
IF1C_PHAAO      ---------
IF1C_AMBTC      ---------
IF1C_ACOAM      ---------
IF1C_SPIOL      ---------
IF1C_DIOEL      ---------
IF1C_VITVI      ---------
IF1C_CERDE      ---------
IF11_SYMTH      ---------
IF1_SOLUE       ---------
IF1C_TETOB      ---------
IF1_UREPA       ---------
IF1_MYCPE       ---------
IF1_AYWBP       ---------
IF11_CHRVO      PRPSHHHRR
IF1_RHOPB       GQFRRR---
IF1_BRADU       QRGGQFRRR
IF12_DECAR      Q--AQRRRY
IF12_POLAQ      ---APYRRH
IF13_ACISJ      ---PARRRH
IF11_ACISJ      RR-PSPHRR
IF12_METFK      KP-AKRFAR
IF11_AZOSB      ---SRHQKR
IF11_ACIAC      ---PQRGAR
IF12_ACISJ      TG-SSSGNR
IF11_AROAE      ---PQRRRR
IF12_POLSJ      ---AQRPSR
IF1_RHORT       PPRQPRRR-
IF12_THIDA      ---------
IF12_AROAE      ---------
IF13_CUPPJ      ---------
IF11_CUPPJ      ---------
IF12_RALSO      ---------
IF11_BORPE      ---------
IF12_BORA1      R--------
IF13_BURCA      R--------
IF11_BURP0      R--------
IF12_BURCM      ---------
IF12_PARXL      ARNSQFRRR
IF1_MYCGA       ---------
IF1_ANADE       ---------
IF1_THET2       ---------
IF1_DEIGD       ---------
IF1_DEIRA       ---------
IF1_PETMO       ---------
IF1C_CHLVU      ---------
IF1C_TUPAK      K--------
IF1_AZOC5       FRRR-----
IF1_RHOBA       ---------
IF12_STRAW      ---------
IF1C_NEPOL      ---------
IF1C_OSTTA      ---------
IF1C_PSINU      ---------
IF1C_ADICA      ---------
IF1C_PINKO      ---------
IF1C_MESVI      ---------
IF1_SYNJA       ---------
IF1_GLOVI       ---------
IF1_SYNY3       ---------
IF1_ACAM1       ---------
IF1C_SPIMX      ---------
IF1C_CYCTA      ---------
IF1C_ZYGCR      ---------
IF1C_STAPU      ---------
IF1C_CHAVU      ---------
IF1C_CHAGL      ---------
IF1C_ANGEV      RD-------
IF1C_HUPLU      ---------
IF1C_ANEMR      ---------
IF1C_MARPO      ---------
IF1C_PHYPA      ---------
IF1C_ANTAG      ---------
IF12_DESVH      ---------
IF12_NOVAD      ---------
IF1_PSELT       ---------
IF1_THEM4       ---------
IF1_FERNB       ---------
IF1_THEMA       ---------
IF1_RICCK       ---------
IF1_RICBR       ---------
IF1_PELUB       ---------
IF1_ERYLH       ---------
IF11_NOVAD      ---------
IF1_GLUOX       ---------
IF1_ACICJ       ---------
IF1_MAGSA       ---------
IF1_BARQU       ---------
IF1_RHOS1       ---------
IF1_DINSH       ---------
IF1_PARDP       ---------
IF1_HYPNA       ---------
IF1_RHILO       ---------
IF1_AGRFC       ---------
IF1_CAUVC       ---------
IF1_PARL1       ---------
IF1_AQUAE       ---------
IF1_MAGMM       ---------
IF1_METCA       ---------
IF1_DICNV       ---------
IF1_COXBR       ---------
IF1_BAUCH       ---------
IF1_FRATN       ---------
IF1_BLOPB       ---------
IF1_BLOFL       ---------
IF1_LEGPC       ---------
IF1_BUCCC       ---------
IF1_PSESM       ---------
IF1_SACD2       ---------
IF1_ALKEH       ---------
IF1_HAHCH       ---------
IF1_HALHL       ---------
IF1_BUCBP       ---------
IF1_BUCAI       ---------
IF1_BUCAP       ---------
IF1_MARHV       ---------
IF1_CHRSD       ---------
IF1_MANSM       ---------
IF1_ACTSZ       ---------
IF1_HAEDU       ---------
IF1_NITOC       ---------
IF1_IDILO       ---------
IF1_PSEA6       ---------
IF1_WIGBR       ---------
IF1_PSYIN       ---------
IF1_COLP3       ---------
IF1_PHOPR       ---------
IF1_ALIF1       ---------
IF1_XYLFT       ---------
IF1_XANCB       ---------
IF1_ACIAD       ---------
IF1_PSYWF       ---------
IF1_HYDCU       ---------
IF1_SALRD       ---------
IF1_FLAJ1       ---------
IF1_GRAFK       ---------
IF1_CYTH3       ---------
IF1_PARD8       ---------
IF1_PORGI       ---------
IF1_HELAH       ---------
IF1_ARCB4       ---------
IF1_CAMJR       ---------
IF1_CAMHC       ---------
IF1_HELHP       ---------
IF1_SULDN       ---------
IF1_WOLSU       ---------
IF1_NITSB       ---------
IF1_SULNB       ---------
IF1_MYCCT       ---------
IF1_MESFL       ---------
IF1_SPIKU       ---------
IF11_DECAR      ---------
IF1_NEIMB       ---------
IF1_NITEC       ---------
IF1_NITMU       ---------
IF11_METFK      ---------
IF11_POLAQ      ---------
IF12_CHRVO      ---------
IF1_METPP       ---------
IF12_CUPMC      ---------
IF12_AZOSB      ---------
IF11_THIDA      ---------
IF1_TREPA       ---------
IF1_BORAP       ---------
IF1_TREDE       ---------
IF1_VESOH       ---------
IF1_RUTMC       ---------
IF1_FUSNN       ---------
IF1_ACHLI       ---------
IF1_DEHMC       ---------
IF1_CHLPM       ---------
IF1_PELLD       ---------
IF1_CHLTE       ---------
IF1_ALCBS       ---------
IF1_BIFAA       ---------
IF1_OENOB       ---------
IF1_LACP7       ---------
IF1_CHLAA       ---------
IF1_PELCD       ---------
IF1_CUTAK       ---------
IF1_ACIC1       ---------
IF1_TROW8       ---------
IF1_STRCO       ---------
IF1_THEFY       ---------
IF1_COREF       ---------
IF1_SALAI       ---------
IF1_KINRD       ---------
IF1_PAEAT       ---------
IF1_LEIXX       ---------
IF11_DESAG      ---------
IF11_DESVH      ---------
IF12_DESAG      ---------
IF1_KORVE       ---------
IF1_LEPBL       ---------
IF1_DESPS       ---------
IF1_SYNAS       ---------
IF1_GEOMG       ---------
IF1_GEOUR       ---------
IF1_CLOD6       ---------
IF1_ALKOO       ---------
IF1_CLONN       ---------
IF1_ALKMQ       ---------
IF1_CLOAB       ---------
IF1_HUNT2       ---------
IF1_RUBXD       ---------
IF1_MYXXD       ---------
IF1_LACLC       ---------
IF1_STRS2       ---------
IF1_STRGC       ---------
IF1_CALS4       ---------
IF1_CALS8       ---------
IF1_LEUMM       ---------
IF1_SYNWW       ---------
IF1_SYNFM       ---------
IF1_STAHJ       ---------
IF1_LACBA       ---------
IF1_LACRD       ---------
IF1_PEDPA       ---------
IF1_LACSS       ---------
IF1_LACH4       ---------
IF1_LACPL       ---------
IF1_LACP3       ---------
IF1_LISMO       ---------
IF1_ENTFA       ---------
IF1_BACAH       ---------
IF1_BACSU       ---------
IF1_OCEIH       ---------
IF1_BACSK       ---------
IF1_DESHY       ---------
IF1_MOOTA       ---------
IF1_PELTS       ---------
IF12_SYMTH      ---------
IF1_CARHZ       ---------