CLUSTAL format seed alignment for MF_00076

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HIS7_SACS2      -----------------MSRSANITRETKETKIEVLLDIDRKGEVKVSTPIPFFNHMLIT
HIS7_SULTO      ----------------MSTRSVRKIRETKETKIELYLDIDKKGEVKVSTPVNFLNHMLST
HIS7_METTH      ---------------MITMRRSMKTRETLETHVKVDLEIDGSGKSSVNTGLGFLDHMLES
HIS7_METAC      ------------------MRTGRISRKTKETDIQLELNLDGKGVADISTGLGFFDHMLAS
HIS7_METJA      -------------MFGGNMRIFEVMRETKETNIYLKINIDGTGKYKIDTGIPFFDHLLAS
HIS7_HALSA      ----------------MTDRTAAVTRETAETDVAVTLDLDGDGEHTVDTGIGFFDHMLAA
HIS7_METKA      ---------------MNSVRTADVKRTTKETEVEVSVNLDGSGRAKVDTGLPFFDHLLHQ
HIS7_MYCLE      ---------MTNTEVGKTTRRARIERRTSESDIVVELDLDGTGQVHIDTGVSFYDHMLTA
HIS7_MYCTU      ---------MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTA
HIS7_CORGL      --------------MTVAPRIGTATRTTSESDITVEINLDGTGKVDIDTGLPFFDHMLTA
HIS7_STRCO      -----------------MSRVGRVERTTKETSVLVEIDLDGTGKTDIATGVGFYDHMLDQ
HIS7_DEIRA      -----------------MPRTAAVTRTTKETDITVRLDLDAAPYEQPATGHGFFDHMLDA
HIS7_NOSS1      MQISD---YPQLNLSSVP-RIASVHRITGETNVQVTVNLDGTGICKAATGIPFLDHMLHQ
HIS7_SYNY3      MPESS---TPSLLIPNFPPRAAAVHRVTKETDVRVSLNLMGSGLCHVATGVPFLDHMLHQ
HIS7_TRIEI      MQISDRLSSSTAPILNLPVRRASVKRKTGETDVTVNLNLDGVGNCQANTGIPFLDHMLHQ
HIS7_PSEAE      ----------------MAERKASVARDTLETQIKVSIDLDGTGKARFDTGVPFLDHMMDQ
HIS7_RALSO      -----------------MSRRAEVTRNTSETQIRVALDLDGTGKQTLNTGVPFLDHMLDQ
HIS7_AGRFC      ----------------MAERKGEIIRKTNETSVSVRVDIDGTGKSKISTGVGFFDHMLDQ
HIS7_RHIME      ------------MADVMPSRTGQVSRKTNETAISVSVNVDGTGVSKIATGVGFFDHMLDQ
HIS7_BRUME      -------------MTAESTRKASIERSTKETSIAVSVDLDGVGKFDITTGVGFFDHMLEQ
HIS7_RHILO      ----------------MAPRSAEASRKTKETDISVSVHVDGSGKSDIATGVGFFDHMLDQ
HIS7_CERS4      ------------------MRKAEISRKTAETDISVTVDLDGTGRYDIRTGVGFFDHMMDQ
HIS7_AZOBR      ----------MDQSLANGVGGASIERNTTETRIRVAVNLDGTGVYDVKTGVGFLDHMLEQ
HIS7_CAUVC      -----------------MARTAEVVRETKETQIRVWIDLDGTGVSTISTGIGFYDHMLES
HIS7_LACLA      -----------------MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTL
HIS7_STAAM      -------------------MIYQKQRNTAETQLNISIS-DDQSPSHINTGVGFLNHMLTL
HIS7_LISIN      ------------------MRSASKTRITGETSIELSINLDSQADSTISTGVGFLDHMLTL
HIS7_LISMO      ------------------MRTATKTRVTAETSIELSINLDSQVESTISTGVGFLDHMLTL
HIS7_CLOAB      ---------------MEEKRTAFIERKTTETSIEVDINLDGEGKYDIDTGIGFFDHMLEL
HIS7_ALKHC      ------------------MRKATIERKTGETQISLTFAVDGEGQSNLTTGVPFMTHMLDL
HIS7_BACSU      ------------------MRKAERVRKTNETDIELAFTIDGGGQADIKTDVPFMTHMLDL
HIS7_CALS4      ------------------MRKAEVKRKTAETDIYVELNIDGKGSYDIKTGIGFFDHMLSL
HIS7_AQUAE      ------------------MREAEVFRETRETKIKLYINLDGSGNYEVNTPVGFLTHMLES
HIS7_ARCFU      --------------------MKKFSRKTEETEVEVVL----GEELKVDTGIAFLDHMLKT
HIS7_PYRAE      ---------------------MPYVRKTLETEVAVELR--RGGDLAVETPIPFLTHMLET
HIS7_PYRFU      -----------------------MRRTTKETDIIVEIG----KKGEIKTNDLILDHMLTA
HIS7_THEMA      ------------MTVERLENGVIVQRNTNEIEISITLD-TVHGKLEGSTGVNFFDHLLNT
                                         * * *  : : .           *   :  *::  

HIS7_SACS2      LLTYMNSTAIVSATDK---LPYDDHHIVEDVAITLGLAIKTALGDKRGIKRFSHQIIPMD
HIS7_SULTO      LFYYMNSTATLIAEDK---QNFDDHHVVEDTAIVIGEAFKEALGDKKGIRRFSHQIIPMD
HIS7_METTH      VARHGLLDLEVEARGD---LEVDDHHTVEDVALTLGEALREALGDKSGIRRMAHAMVPMD
HIS7_METAC      FSRHSEFDLKVRAEGD---LYVDEHHLVEDVGIVLGRALAEVLGDMSGIARFGEARIPMD
HIS7_METJA      FAKHGCFDLIVKARGD---LEIDDHHTVEDVGICLGLALNQIE--KRNIFRFGWAIIPMD
HIS7_HALSA      FAKHGLFDVTVRCDGD---LDVDDHHTVEDVGIALGAAFSEAVGEKRGIQRFADRRVPLD
HIS7_METKA      FAFHGRIDVEIKARGD---LEVDDHHTVEDVGICLGKALNEALGDREGIRRIAWALVPMD
HIS7_MYCLE      LGSHASFDLTVCTKGD---VEIEAHHTIEDTAIALGQAFGQALGNKKGIRRFGDAFIPMD
HIS7_MYCTU      LGSHASFDLTVRATGD---VEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMD
HIS7_CORGL      FGVHGSFDLKVHAKGD---IEIDAHHTVEDTAIVLGQALLDAIGDKKGIRRFASCQLPMD
HIS7_STRCO      LGRHGLFDLTVKTDGD---LHIDSHHTIEDTALALGAAFRQALGDKVGIYRFGNCTVPLD
HIS7_DEIRA      LARHSRLGISISGTGD---LHIEPHHLIEDTGITLGQALSQALGDRKGIERYGSAFVPMD
HIS7_NOSS1      ISSHGLIDLDVQAKGD---WEIDDHHTNEDVGITLGQALAKALGDRKGIVRFGNFLAPLD
HIS7_SYNY3      IASHGLIDLEVNATGD---IEIDDHHTNEDVGITLGQALAEALGDRRGINRFGHFIAPLD
HIS7_TRIEI      ISSHGLIDLDVQAVGD---IEIDDHHTNEDVGITLGQALKQALGDRKGIVRFGHFLAPLD
HIS7_PSEAE      IARHGLIDLDIECKGD---LHIDDHHTVEDIGITLGQAFAKAIGDKKGIRRYGHAYVPLD
HIS7_RALSO      IARHGMVDLDVTATGD---THIDDHHTVEDVGITLGQAVAKAIGDKKGIVRYGHSYVPLD
HIS7_AGRFC      LSRHSLIDMDIEVQGD---LHIDDHHTVEDTGIAIGQAIAKALGDRRGITRYASLDLAMD
HIS7_RHIME      LSRHSLIDMEIKAEGD---LHVDDHHTVEDTGIAIGQALAKALGDRRGITRYASIDLAMD
HIS7_BRUME      LSRHSLIDMRVMAKGD---LHIDDHHTVEDTGIALGQAVAKALGERRGIVRYASLDLAMD
HIS7_RHILO      LSRHSLIDMTVRAKGD---LHIDDHHTVEDTGIALGQALTKALGERRGIMRYASIDLAMD
HIS7_CERS4      LARHALIDITLRCEGD---LHIDDHHTVEDCGIALGQALTRALGDKRGIRRYGSFHLAMD
HIS7_AZOBR      LSRHSLMDLSVAAEGD---VHIDAHHTTEHSGIAIGQAVAKAVGDRKGIQRYGHAYVPMD
HIS7_CAUVC      FARHGGFDLKVETKGD---LHIDMHHTVEDTGIVLGQAIHKALDGFKGIRRFGSAYIPMD
HIS7_LACLA      LTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEALGNKLGIRRYGSFTIPMD
HIS7_STAAM      FTFHSGLSLNIEAQGD---IDVDDHHVTEDIGIVIGQLLLEMIKDKKHFVRYGTMYIPMD
HIS7_LISIN      FSKHSRITLNVKADGD---TYVDAHHTVEDVGITLGLCLKEALSDKASINRYGSSYVPMD
HIS7_LISMO      FAKHSRVTLNVKADGD---TYVDAHHTVEDIGITLGLCLKEALADKASINRYGSAYVPMD
HIS7_CLOAB      MSKHGLIDLKVKVIGD---LKVDSHHTVEDTGIVIGECINKALGNKKSINRYGTSFVPMD
HIS7_ALKHC      FTKHGHFNLTIDAKGD---TEVDDHHTTEDLGICLGLALKEALADKKGIRRYGSAFVPMD
HIS7_BACSU      FTKHGQFDLSINAKGD---VDIDDHHTTEDIGICLGQALLEALGDKKGIKRYGSAFVPMD
HIS7_CALS4      FAKHGLFDLKVIAKGD---LEVDTHHTVEDVGIVLGTAFLKASGDKKSIKRFSTFYVPMD
HIS7_AQUAE      FAKHGRFDLKVEAEGD---VHVSHHHTVEDCGIVLGQAVLKALGDKKGIRRYGYSIIPMD
HIS7_ARCFU      LSRHSGIKLRVKA------KGDLEHHVIEDVAIALGKALAGV--DKKGLERFGDAIVPMD
HIS7_PYRAE      LLKYAGLGGVVKAVEL--RKLDDGHHVIEDVAIAVGRALDALLEDRRGIARFGHAVVPMD
HIS7_PYRFU      FAFYLGKDMRITATYD------LRHHLWEDIGITLGEALRENL--PEKFTRFGNAIMPMD
HIS7_THEMA      FCHYSGLGLRVSTCES---KDGILHHLIEDFGISLGLAFRELF-DYTKVRRFGEATVPMN
                .  :      :             **  *. .: :*  .         . * .    .::

HIS7_SACS2      DALVLVSLDISNRGMAFVNLNLK------RSEIGG-------LATENVPHFFQSFAYNSG
HIS7_SULTO      DALVLVAVDISGRGVSNIELNLE------RDEIGG-------LATENIIHFFQTFSYNSG
HIS7_METTH      DALATVALDLSGRPYTVLELE-FD-----DAVIGD-------VKSQNIGHFIESLAVSAA
HIS7_METAC      EALAEVALDVGGRNYLVLKAE-FA-----SPQVGQ-------FSTQLVRHFFETLASNAK
HIS7_METJA      DARATVAIDLSGRSYCVGNYE-PK-----REFVGD-------LATENINHFFESVASYGM
HIS7_HALSA      EAVASVVVDVSGRAVYEFDGG-FS-----QPTVGG-------LTSRMAAHFWRTFATHAA
HIS7_METKA      EALVECAVDISGRPYFVLKGYRPR-----RNRIGSP-----PLSTENVSHFWKSFCDHAG
HIS7_MYCLE      ETLVHAVVDVSGRPYCVHTGEPD------HLQHNIISGSSVPYSTVINRHVFESLAANAR
HIS7_MYCTU      ETLAHAAVDLSGRPYCVHTGEPD------HLQHTTIAGSSVPYHTVINRHVFESLAANAR
HIS7_CORGL      EALVESVVDISGRPYFVISGEPD------HMITSVIGGH---YATVINEHFFETLALNSR
HIS7_STRCO      ESLAQVTVDLSGRPYLVHT-EPE------NMAPMI--GE---YDVTMTRHILESFVAQAQ
HIS7_DEIRA      ETLAHVVLDLSGRAHLAFE--PE------TLDVYGDAGG---MTHYHLREFLRGFCNHAG
HIS7_NOSS1      EALVQVALDFSGRPHLSYGLQIP------TERVGT-------YDTQLVREFFVALVNHSQ
HIS7_SYNY3      EALVQVTLDFSGRPHLSYGLQIP------TERVGT-------YDTQLVREFFVAVVNHSQ
HIS7_TRIEI      EALVEVALDFSGRPHLSYGLEMP------TQRVGN-------YDTQLVREFFVALANNSL
HIS7_PSEAE      EALSRVVIDFSGRPGLQMHVPFT------RASVGG-------FDVDLFMEFFQGFVNHAQ
HIS7_RALSO      EALSRVVIDFSGRPGLEFHVPFT------RARVGS-------FDVDLSIEFFRGFVNHAG
HIS7_AGRFC      ETMTKAAVDISGRPFLVWNVNFS------APKIGT-------FDTELVREFFQALAQNAG
HIS7_RHIME      ETMTRAAVDVSGRPFLVWNVTFT------SPKIGT-------FDTELVREFFQALAQHAG
HIS7_BRUME      DTLTGAAVDVSGRAFLVWNVNFT------TAKIGT-------FDTELVREFFQAFAMNAG
HIS7_RHILO      ETLTRAAIDVSGRPFLVWNVSFS------SPKIGT-------FDTELVREFFQALAQNAG
HIS7_CERS4      DALVRAALDLSGRPFLVWNLPFP------TEKIGS-------FDTELVREFFQALATHGG
HIS7_AZOBR      ETLTRVALDFSNRPYLIWKVSFS------RDKIGD-------MDTELFREWFQAFAMAAG
HIS7_CAUVC      ETLTRCAIDLSNRPYLIWKVEFK------RPKVGE-------MDTELFKEFHHAFAMNSG
HIS7_LACLA      EALVTCDLDISGRPYLVFHADLSG-----NQKLGG-------YDTEMTEEFFRALAFNAG
HIS7_STAAM      ETLARVVVDISGRPYLSFNASLS------KEKVGT-------FDTELVEEFFRAVVINAR
HIS7_LISIN      ESLGFCALDLSGRSYLVFDAELT------NPKLGD-------FDTELVEEFFQAVAFNTE
HIS7_LISMO      ESLGFCALDLSGRSYLVFDAELT------NPKLGD-------FDTELVEEFFQAVAFNTE
HIS7_CLOAB      ESLCQVSMDISGRAFLVFDGEFT------CEKLGD-------FQTEMVEEFFRALAFNAG
HIS7_ALKHC      ETLAQVVVDLSNRPHLEFRADMP------SEKVGT-------FDTELVHEFLWKLALEAR
HIS7_BACSU      EALAQVVIDLSNRPHLEMRADFP------AAKVGT-------FDTELVHEFLWKLALEAR
HIS7_CALS4      EALVRVSLDISGRPYLYYDLPLK------AERVGN-------FETETVEEFFRAFAYNFG
HIS7_AQUAE      EALVLSSIDISGRP-LFFYEDKDL-----RGKITE-------FDFELIWEFFKGFALESR
HIS7_ARCFU      DAVAICGLDFSGRGVLVVEGTFGD---GEMRE-------------EDFLHFLDTLCRNAG
HIS7_PYRAE      ESIVMAAVDLGGRAYWVVRAKLPDVTIGGYPL-------------RMFPHFVRTLAVEAK
HIS7_PYRFU      DALVLVSVDISNRPYANVDVNIK------DAEEG--------FAVSLLKEFVWGLARGLR
HIS7_THEMA      EALVGCYVDLSGRPFFQKNFEFS------VEKIED-------MPVEGFEEFMCGFVNHAR
                ::     :*...*                                    .    .     

HIS7_SACS2      ITLHISQLSGYNTHHIIEASFKALGLALYEATRIVDN---EIRSTKGII----
HIS7_SULTO      VNMHIIQLRGWNTHHVIEASFKGLGFSLYEASRIVYE---ETYSLKGSL----
HIS7_METTH      MNIHASVRG-RNDHHKAEALFKALALAIRDAVRVEHGE---IPSTKGKL----
HIS7_METAC      ITMHASVYG-DNDHHKIEALFKAFAYAMKRAVKIEGKE---VKSTKGTL----
HIS7_METJA      LNIHYEVIG-KNEHHKAEALFKAFGVALDLATKIDERKG--VISTKGEVKL--
HIS7_HALSA      VTLHCGVDG-ENAHHEIEALFKGVGRAVDDATRIDQRRAGETPSTKGDL----
HIS7_METKA      VTMHVVVRWWDNDHHAIEAMFKAVGRALGAAKEIVGDG---VPSTKGTLRRG-
HIS7_MYCLE      IALHVRVLYGRDPHHITEAQYKAVARALSEAVKFDPRFSGV-PSTKGVL----
HIS7_MYCTU      IALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGV-PSTKGAL----
HIS7_CORGL      ITLHVICHYGRDPHHITEAEYKAVARALRGAVEMDPRQTGI-PSTKGAL----
HIS7_STRCO      VALHVHVPYGRNAHHIVECQFKALARALRYASERDPRAAGILPSTKGAL----
HIS7_DEIRA      ATLHVRLLAGREAHHVIEAVMKAFARALRDAVAV---TSDALPSTKGSL----
HIS7_NOSS1      MTLHIRQLDGINSHHIIEATFKAFARAARMAIEVDPRRAGTIPSSKGVL----
HIS7_SYNY3      MTLHIRQLDGINSHHIIEATFKAFARAMRMAIEVDPRRADTIPSSKGVL----
HIS7_TRIEI      MTLHIRQLGGINSHHIIEAGFKAFARSLRMATEIDPRRVGEIPSSKGVL----
HIS7_PSEAE      VTLHIDNLRGHNTHHQIETVFKAFGRALRMAIELDERMAGQMPSTKGCL----
HIS7_RALSO      VTLHIDNLRGVNAHHQIETVFKAFGRALRMAVEIDPRAAGTIPSTKGAL----
HIS7_AGRFC      ITLHILNHYGANNHHIAETCFKAVARVLRTATEIDPRQAGRVPSTKGMLA---
HIS7_RHIME      ITLHVQNIYGANNHHVAETCFKSVARVLRTATEIDPRQAGRVPSTKGTLA---
HIS7_BRUME      ITLHINNHYGANNHHIAESTFKAVARVLRAALETDPRQKDAIPSTKGSLKG--
HIS7_RHILO      ITLHVTNHYGANNHHIAETCFKAVARALRAALEPDPRQPDAVPSTKGSLKG--
HIS7_CERS4      ITLHVDLIHGVNSHHIAEAAFKAVARSLREAVEPDPRRADAIPSTKGML----
HIS7_AZOBR      VTLHVECLYGENNHHIVESCYKALARALRAGIEIDPRKRDAVPSTKGTLGGSL
HIS7_CAUVC      ACIHLETLYGDNTHHVAESGFKALARALRQAVEIDPKTGGQAPSTKGVL----
HIS7_LACLA      ITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL----
HIS7_STAAM      LTTHIDLIRGGNTHHEIEAIFKAFSRALGIALTATDD--QRVPSSKGVIE---
HIS7_LISIN      MNLHLRVLYGKNTHHKIEALFKAFGRALREAITINPE-IKGVNSTKGVL----
HIS7_LISMO      MNLHLRVLYGKNTHHKIEALFKAFGRALREAITINPE-IKGVNSTKGVL----
HIS7_CLOAB      ITLHARVIYGKNNHHMIEGLFKAFGRALSEAVSKNTR-IKGVMSTKGSI----
HIS7_ALKHC      MNLHVIVHYGENTHHIIEAIFKALARALDEATTIDPR-VKGVPSTKGML----
HIS7_BACSU      MNLHVIVHYGTNTHHMIEAVFKALGRALDEATTIDPR-VKGIPSTKGML----
HIS7_CALS4      ITLHVELLHGVNTHHIIEASFKALGKALDEALKLDER-IDGIPSTKGIL----
HIS7_AQUAE      STLHIKVLDGKILHHVAEACFKSFAITLKEAVKVEGS---GVPSTKGVI----
HIS7_ARCFU      LNVYLSVKG-SNSHHKMEAAVKAVAISLKKALTKNGN---DYRSAKGVLD---
HIS7_PYRAE      ATIHIYARG-TDPHHKVEAAHKALGLALRQALSPG-----EGLSTKGVLG---
HIS7_PYRFU      ATIHIKQLSGENAHHIVEAAFKGLGMALRVATKESER----VESTKGVL----
HIS7_THEMA      ITVHFFKFFGKNDHHISESAMKSFGLAIAKALESSEK-----KTTKGVID---
                   :         **  *   *. .     .            : ** :