CLUSTAL format seed alignment for MF_00080

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IF3_HELPY       --------------------------MSR--NEVLLNGDIN-FKEVRCVGDNGEVYGIIS
IF3_HELPJ       --------------------------MSR--NEVLLNGDIN-FKEVRCVGDNGEVYGIIS
IF3_CAMJE       --------------------------MSKE-KEVLLNEEIR-ADEIRCVGDDGKVYGIIS
IF3_BUCAI       ------------------MKGGKIVQLTR---PNRINSEIR-AIKVRLTGVEGDQIGIVN
IF3_BUCAP       ------------------MKGGKRIQFTR---PNRINNEIR-AIKVRLTGVEGDQIGIVN
IF3_ECOLI       ------------------MKGGKRVQTAR---PNRINGEIR-AQEVRLTGLEGEQLGIVS
IF3_SALTY       ------------------MKGGKRVQTAR---PNRINSEIR-AQEVRLTGLEGEQLGIVS
IF3_KLEPN       ------------------MKGGKRVQTAR---PNRINGEIR-AQEVRLTGLEGEQLGIVS
IF3_SERMA       ------------------MKGGKRVQPAR---PNRINREIR-AQEVRLTGVDGEQIGIVS
IF3_PROHU       ------------------MKGGKRIQSTR---QNRINSEIR-AHEVRLTGLDGEQIGVVS
IF3_VIBCH       ------------------MKGGRRGQVPVKQNQHRLNGEIRGVREVRLTGADGESVGIVS
IF3_HAEIN       ---------------------------MNR--PNRINEEIR-VKEVRLIDQNGEQAGIVS
IF3_PASMU       ------------------MKTVKKAPVANR--PNRINDEIR-VKEVRLIDQDGEQAGIVS
IF3_PSEPH       ------------------MIIKRDMRQDKRAAPKAPINENISAREVRLIGADGEQIGIVS
IF3_PSESM       ------------------MIIKREMRQDKRAAPKAPINENISAREVRLIGADGEQIGIVS
IF3_PSEAE       ------------------MIIKREMRQDKRAQPKPPINENISAREVRLIGADGQQVGVVS
IF3_NEIMA       -----------------------MIAQER---EARINGEIT-AKEVRLISESGEQLGVVS
IF3_XYLFA       ------------------MGDCNISTSDNK--QNRKNHEIR-VPRVRVIGSDGEMVGVLS
IF3_RHOS4       ------------------MARRPHNAPPQRETGPRVNERIR-CPEVRLIGANGENIGVVT
IF3_RICPR       ------------MYLFINIIWRNFISKNN---LPKANREIK-AKEVRLVDENSEMYGVVN
IF3_AQUAE       ------------------------MSKLK---EYRVNRQIR-AKECRLIDENGQQIGIVP
IF3_CHLMU       --------------------------MAL---NLKINRQIR-APRVRVIGSSGEQLGILS
IF3_CHLTR       --------------------------MAL---NLRINRQIR-APRVRVIGSAGEQLGILS
IF3_CHLPN       --------------------------MAL---NFKINRQIR-APKVRLIGSAGEQLGILA
IF3_MYCLE       --------------------------MST---ETRVNERIR-VPEVRLIGPGGEQVGIVR
IF3_MYCTU       --------------------------MST---ETRVNERIR-VPEVRLIGPGGEQVGIVR
IF3_STRCO       --------------------------MSA---EPRINDRIR-VPEVRLVGPSGEQVGIVP
IF3_DEIRA       -----------------------MITIAK---DLKVNEQIR-VRQVRLIGAEGEQIGIID
IF3_THEMA       ----------------------MGIGVNT---DLPRNEQIK-APKVRVVDENGKMIGVMP
IF3_GEOSE       --------------------------MSK---DFIINEQIR-AREVRLIDQNGDQLGIKS
IF3_BACSU       -------------------------MISK---DQLVNEGIR-AREVRLIGQNGDQLGIKS
IF3_LISMO       --------------------------MSK---DMLVNDGIR-AREVRLIDQDGEQLGVKS
IF3_BACHD       --------------------------MSK---DMLVNEGIR-AREVRLIGANGDQIGVKS
IF3_LACLA       ----------------MRRRTNIAKQDNR---KPMMNGAIR-AREVRLIGAEGEQLGVTP
IF3_STRP1       ----------------------MKIIAKK---DLFINDEIR-VREVRLVGLEGEQLGIKP
IF3_MYXXA       ----------------MIREQRSSRGGSR---DQRTNRRIR-AREVRVVGSDGSQLGVMP
IF3_BORBU       -----------MINRNANRDRDRSRSNDK---ELKINYRIK-AREVRVIFENGTQ-EVLS
IF3_TREPA       ------------------MYWGGSLADNK---SLRINGSIR-VREVRLVDAVGQQCGVVP
IF3_SYNY3       -------------------MADKRRPQRD---LPQINERIR-FPEIRVIDSDGAQLGIIT
IF3_MYCFE       ---------------------MQPQGKMKKPTAEHMINENIPFQKVFVIGANGEKVGVLS
IF3_MYCGE       ---------------MIQLAQNAKHPSKKE--QKPLVNEQIAFNQFTLIDENSTNLGIVK
IF3_MYCPN       MPLILDQGCFVSESRFHRLAQNIKQGSRREREQKPLINDKIGFNEFILIDENGSNLGTVR
IF3_UREPA       --------------------MSSNNDARKN--Q-PLINDQIRFRTMVVIDDHGNNLGEMN
                                                                    .       

IF3_HELPY       SKEALHI-AQNLGLDLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAKKKQK--QIEIKE
IF3_HELPJ       SKEALKI-AQNLGLDLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAKKKQK--QIEIKE
IF3_CAMJE       SDEALEI-ANRLGLDLVMIAADAKPPVCKIMDYGKFRYQQEKKQKEAKKKQK--VIDIKE
IF3_BUCAI       LREALKK-SEELGLDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQK--VIHIKE
IF3_BUCAP       LREALEK-AEELGLDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQK--VIQVKE
IF3_ECOLI       LREALEK-AEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQK--VIQVKE
IF3_SALTY       LREALEK-AEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQK--VIQVKE
IF3_KLEPN       LREAIEK-AEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQK--VIQVKE
IF3_SERMA       LNEALEK-AEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSTKEQKEEQK--VIQVKE
IF3_PROHU       LKEALEK-AEEAGADLVEISPNAEPPVCRIMDYGKFLYEKSKTLKEQKKEQK--VIQVKE
IF3_VIBCH       IQEALAT-AEESGLDLVEISPNAEPPVCRVMDYGKFLFEKSKATKEQKKKQK--QIQIKE
IF3_HAEIN       IQQALEMMAEQAELDLVEISPNAEPPVCRIMNYGKFLYEKSKTAKEQKKKQK--VVQVKE
IF3_PASMU       IQQALEM-AEQAELDLVEISPNAEPPVCRIMNYGKFLYEKGKAAKEQKKKQK--VVQVKE
IF3_PSEPH       IDEALRI-AEEAKLDLVEISADAVPPVCRVMDYGKSIFEKKKQIAAAKKNQK--QIQVKE
IF3_PSESM       IDEALRI-AEEAKLDLVEISADAVPPVCRVMDYGKSIFEKKKQVAAAKKNQK--QIQVKE
IF3_PSEAE       IDEAIRL-AEEAKLDLVEISADAVPPVCRIMDYGKHLFEKKKQAAVAKKNQK--QAQVKE
IF3_NEIMA       VREALAM-AEGQDVDLVEISPTAKPPVCKLMDYGKYKYQQAKKRDEAKKNQK--QVQIKE
IF3_XYLFA       RDEALAM-AEKEGLDLVEIQPQADPPVCKVMNFGKFKFEQQKKANEAKKKTK--QVEIKE
IF3_RHOS4       PSRAMMM-AEEAGLDLVEISPNAEPPVCKIMDFGKFKYEQQKREAEARKKQH--IIEIKE
IF3_RICPR       IREALDM-AERAGLDLVEISPNAVPPVCKILDFGKFKYESKKRLHEARKKQK--VVVLKE
IF3_AQUAE       IEEALKI-AEEKGLDLVEIAPQAKPPVCKIMDYGKFKYELKKKEREARKKQREHQIEVKD
IF3_CHLMU       IKEALDL-AREADLDLVEVASNSEPPVCKIMDYGKYRYDVTKKEKDSKKAQH--QVRVKE
IF3_CHLTR       IKEALDL-AKEANLDLVEVASNSEPPVCKIMDYGKYRYDVTKKEKDSKKAQH--QVRIKE
IF3_CHLPN       IKDALDL-AREAGLDLVEVASNSEPPVCKIMDYGKYRYGLTKKEKDSKKAQH--QVRIKE
IF3_MYCLE       IEDALRV-AADADLDLVEVAPNARPPVCKIMDYGKYKYEVAQKARESRRNQQ--QTVVKE
IF3_MYCTU       IEDALRV-AADADLDLVEVAPNARPPVCKIMDYGKYKYEAAQKARESRRNQQ--QTVVKE
IF3_STRCO       LAKALEL-AQEYDLDLVEVAANARPPVCKLMDYGKFKYESAMKAREARKNQA--HTVIKE
IF3_DEIRA       TREAMNM-AREKSLDLVMVSPQAVPPVCRLLDYGRFRYEQQQNEKENRKRAR--SQEVKA
IF3_THEMA       TRKALEL-AREKGLDLVLVAPNENPPVARIMDYGKYKYQLTKKQKENKK--K--PVQMKQ
IF3_GEOSE       KQEALEI-AARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEARKKQK--VINVKE
IF3_BACSU       RQEALEI-AGRANLDLVLVAANAKPPVCRIMDYGKFRFEQQKKEKEARKNQK--IINLKE
IF3_LISMO       KIDALQI-AEKANLDLVLVAPTAKPPVARIMDYGKFRFEQQKKDKEARKNQK--VIVMKE
IF3_BACHD       KAEALDM-ARNVNLDLVCVAPNAKPPVCRIMDYGKYRYEQQKKDKEARKKQK--TINVKE
IF3_LACLA       TSEALMQ-AENLNMDLVLISNQE-PPVAKIMDYTKFMFEQKKKQKEAKKKQA--VVSVKE
IF3_STRP1       LSEAQSL-ADASNVDLVLIQPQAVPPVAKLMDYGKFKFEYQKKQKEQRKKQS--VVTVKE
IF3_MYXXA       LEAALDR-ARTEGLDLVEISPMASPPVCKIMDYGKFKYEEKKKASEAKRAQV--TVLLKE
IF3_BORBU       IEDAIKK-AKEAGLDLVEVSPNVSPPVCKIIDYGKYKFHQEKRQKEQKKNQK--VIKLKE
IF3_TREPA       TPEALRM-ARDINLDLVEVAPQASPPVCKILDYGKYRFEMGKKLRDSKKRQR--LQTLKE
IF3_SYNY3       PNEAMEI-ADERGLDLVLVSETADPPVCRIMDYGKYKFEQEKKAREAKKKQH--TADVKE
IF3_MYCFE       TREAIEM-AKEQRLDLVLISVQP-KPIARILDYGKFKYERKKKQKAAKEKQT--VIQNRQ
IF3_MYCGE       MENALKL-AQEKQLDLVLIAPNPTKPIVKLLDFGRYTYDLKRKKRQAKKNQT--IIQTKE
IF3_MYCPN       RTDALKM-AEEKQLDLVLIGSNPAKPIVKLLDFGRYTYDLKRKKRQSKKNQT--IIQIKE
IF3_UREPA       RIDALNL-AASKNLDLVVIAKKGNIPVTKILDYGKYKYEQKRRQKESRKNQT--IIKVKE
                   *    :     *** :      *: ::::: :  :         :.         : 

IF3_HELPY       IKLSTQIAQNDINYKVKHAREFIESNKHVKFKVVLKGRESQNSKAGLDVLFRVQTMMQ--
IF3_HELPJ       IKLSTQIAQNDINYKVKHAREFIESNKHVKFKVVLKGRESQNSKAGLDVLFRVQTMMQ--
IF3_CAMJE       IKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIE--
IF3_BUCAI       IKFRPGTDEGDYQVKLRNLIRFLEDGDKAKITLRFRGREMAHQKIGVDVLNRVKNDLIE-
IF3_BUCAP       IKFRPSTDEGDYQVKLRNLIRFLEDGDKVKITLRFRGREMAHQKIGIDVLNRVKNDLIE-
IF3_ECOLI       IKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQE-
IF3_SALTY       IKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQE-
IF3_KLEPN       IKFRPGTDEGDYQVKLRSLIRFLEDGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLVE-
IF3_SERMA       IKFRPGTDDGDYQVKLRNLIRFLEDGDKAKITLRFRGPEMAHQQIGMEVLNPLRKDLCED
IF3_PROHU       VKFRPGTDEGDYQVKLRNLIRFLEDGDKAKVTLRFRGREMAHQQIGMEVLNRIRQDLDE-
IF3_VIBCH       LKFRPGTDVGDYQVKLRNLIRFLEEGNKVKVTIRFRGREMAHQDIGVDVLNRLKEDTDE-
IF3_HAEIN       IKFRPGTDEGDYQVKLRSLIRFLEDGDKAKITVRFRGREMAHQDIGLDVLERVKNDLAE-
IF3_PASMU       IKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITVRFRGREMAHQDIGLEVLERVKNDLAE-
IF3_PSEPH       IKFRPGTEEGDYQVKLRNLVRFLSDGDRAKVSLRFRGREMAHQELGMELLKRVEADLQE-
IF3_PSESM       IKFRPGTEEGDYQVKLRNLVRFLSDGDRAKVSLRFRGREMAHQELGMELLKRVEGDLLE-
IF3_PSEAE       IKFRPGTEEGDYQVKLRNLVRFLSEGDKAKVSLRFRGREMAHQELGMELLKRVEADLVE-
IF3_NEIMA       IKFRPGTDEGDYQIKMRNINRFLADGDKVKVTLRFRGREMAHQQLGAQLLERVKEDLAE-
IF3_XYLFA       LKFRPVTDEGDYQIKLRNMRRFLEEGDKVKINIRFRGREMSHQELGRQMATRIEMDLGD-
IF3_RHOS4       IKFRPGTDTHDYDVKMRSVLKFLSEGDKVKVTLRFRGREMAHQELGLELLNRVAAHVSE-
IF3_RICPR       MKFKPNISIGDFETKLRKIKEFLKDGDKVKISLWFKGREILHKEVGHELFKRIELALEG-
IF3_AQUAE       IRMKVRIDEHDLQVKLKHMREFLEEGDKVKVWLRFRGRENIYPELGKKLAERIINELSD-
IF3_CHLMU       VKLKPNIDDNDFLTKVKQARAFIEKGNKVKVSCMFRGRELAYPEHGHKVVQRMCQGLE--
IF3_CHLTR       VKLKPNIDDNDFLTKAKQARAFIEKGNKVKVSCMFRGRELAYPEHGYKVIQRMCQGLE--
IF3_CHLPN       VKLKPNIDENDFSTKLKQARTFVEKGNKVKITCMFRGRELAYPEHGFKVVQKMSQGLE--
IF3_MYCLE       QKLRPKIDDHDYETKKSHVVRFLEAGSKVKVTIMFRGREQSRPELGYRLLQRLGADVA--
IF3_MYCTU       QKLRPKIDDHDYETKKGHVVRFLEAGSKVKVTIMFRGREQSRPELGYRLLQRLGADVA--
IF3_STRCO       MKLRPKIDPHDYDTKKGHVVRFLKQGDKVKITIMFRGREQSRPELGYRLLQRLAEDVA--
IF3_DEIRA       IKFRVKIDDNDFKTKTGHVRRFLNEGHKVKVTIMFRGRERTHPELGERILVRVAETLA--
IF3_THEMA       MKFRLKIDEHDYQTKVKHIRRFLEDGHKVRVVVMFIGREMMFAEKGKEILERVIKDTE--
IF3_GEOSE       VRLSPTIEEHDFNTKLRNARKFLEKGDKVKATIRFKGRAITHKEIGQRVLDRLSEACA--
IF3_BACSU       VRLSPTIDEHDFNTKLRNAIKFLEKGDKVKASIRFKGRAITHKEIGQRVLDRFSEACA--
IF3_LISMO       VRLSPTIDEHDFDTKLRNARKFLEKGDKVKCSIRFKGRAITHKEIGQKVLDRFAKACE--
IF3_BACHD       VRLSPTIEDHDFNTKLRNARKFLSKGDKVKAAIRFRGRAITHSEIGRNVLERLAKECE--
IF3_LACLA       VRLSPVIDQNDFDTKLRQAIKFLEKGDKVKVSIRFKGRMITHQDVGRQVMDKFAQATK--
IF3_STRP1       VRLSPVIDKGDFETKLRNGRKFLEKGNKVKVSIRFKGRMITHKEIGAKVLADFAEATQ--
IF3_MYXXA       VKLRPKTEEHDYEFKVRNTRRFIEDGNKAKVVIQFRGREITHREQGTAILDDVAKDLK--
IF3_BORBU       VRMQPKIDAHDLDFKSKNILGFLKDGNKVKVTIRFRGRELAHTYLGYGILNSILEKVGD-
IF3_TREPA       VRMQPKINDHDMAFKAKHIQRFLDEGDKVKVTIRFRGRELAHTDLGFNVLQNVLGRLV--
IF3_SYNY3       VKMRYKIDEHDYQVRINQAKRFLKAGDKVKATVNFRGREIQHAHLAKELLDRMATDLA--
IF3_MYCFE       IRLTPLIGEHDLNVKARKAKEFLLDGDRIKVSLKFRGRESARPELGHKTLEKFYKAVED-
IF3_MYCGE       VVVKPTIAKHDLEFRAKQSKNWIEKGHHVKFIVRAFGRVSTRIELIEKVFDDFYQLVKD-
IF3_MYCPN       VVVKPTIAKHDLEFKAKQTTGWAEKGYHVKFVVRAFGRVSTRIELIEKVFNDFYLLVEP-
IF3_UREPA       IKIKPMIGEHDLKVRAENAKRWLEDKDNVKFVIEARGRMCTKDEFIVQAYEKFIDLIKD-
                  .       *   :      :     . :      *               .       

IF3_HELPY       --DLANPEKEPKTEGRFVSWMFVPKAKEAPKNEKKTKENNPPFNRINLMKGENHAKNED-
IF3_HELPJ       --DLANPEKEPKTEGRFVSWMFVPKAKEAPKNEKKTKENNPPFNRINLMKGENHAKNED-
IF3_CAMJE       --NEANRDKEPNFEGRYVNMLVTPKKA---------------------------------
IF3_BUCAI       --LATVEYFPSKIEGRQMIMILAPKKK---------------------------------
IF3_BUCAP       --LAIIESFPSKIEGRQMIMVLAPKKK---------------------------------
IF3_ECOLI       --LAVVESFPTKIEGRQMIMVLAPKKKQ--------------------------------
IF3_SALTY       --LAVVESFPTKIEGRQMIMVLAPKKKQ--------------------------------
IF3_KLEPN       --LAVVEAFPTKIEGRQMIMVLAPKKKQ--------------------------------
IF3_SERMA       MDLAVVESFPTKIEGRQMIMVLAPKKKQ--------------------------------
IF3_PROHU       --LATVESFPNKIEGRQMIMVLAPKKK---------------------------------
IF3_VIBCH       --FAVVESFPTKIEARQMIMVLAPKKK---------------------------------
IF3_HAEIN       --ISVVESAPGKLEGRQAVMVLAPKKK---------------------------------
IF3_PASMU       --ISVVESAPGRLEGRQAVMVLAPKKK---------------------------------
IF3_PSEPH       ---YGSVEQHPKMEGRQLIMVIAPKKKK--------------------------------
IF3_PSESM       ---YGSVEQHPKMEGRQLIMVIAPKKKK--------------------------------
IF3_PSEAE       ---YGTVEQHPKLEGRQLMMVIAPKKKK--------------------------------
IF3_NEIMA       ---VAQIESFPKMEGRQMVMMIAPKKK---------------------------------
IF3_XYLFA       ---DVVIESRPRLEGRQMVMMVAPRKKS--------------------------------
IF3_RHOS4       -AEAGKVEAMPKLEGRQMVMMIAPK-----------------------------------
IF3_RICPR       ---LIKIDQHAKMEGKQMIMIVSPDIKV--------------------------------
IF3_AQUAE       ---IAEVEVQPKKEGNFMIFVLAPKRKK--------------------------------
IF3_CHLMU       --DVGFVESEPKLNGRSLICVIAPGTLKTKKKQEKVHAQDEKQ-----------------
IF3_CHLTR       --DIGFVESEPKLNGRSLICVIAPGTLKTKKK----------------------------
IF3_CHLPN       --DIGFVEAEPKLAGRSLICVVAPGTVKTKKKQEKSHAQDENQ-----------------
IF3_MYCLE       --DYGFVETSAKQDGRNMTMVLAPHRGAKTRASARHPEVPG--------AGSVQDIDATG
IF3_MYCTU       --DYGFIETSAKQDGRNMTMVLAPHRGAKTRARARHPGEP---------AGGPPPKPTAG
IF3_STRCO       --DLGFVESNPKQDGRNMIMVLGPHKKKTEAMAEARQAQEARKADAKANPGKSQNAAETD
IF3_DEIRA       --DVGAPEGNPSMMGMDMNMIMAPKAPASPKKDKADRPEGDAGDTDMAAPAPAPAAAPET
IF3_THEMA       --DLATVESPPKMEGRDMWMVLKPKNS---------------------------------
IF3_GEOSE       --DIAVVETAPKMDGRNMFLVLAPKNDNK-------------------------------
IF3_BACSU       --EVATVETKPKMDGRSMFLMLAPKNEKQ-------------------------------
IF3_LISMO       --DLCTIEQRPKMDGRSMFLVLAPLHEK--------------------------------
IF3_BACHD       --DIAIVEAKPKMEGRSMFLVLAPKTDK--------------------------------
IF3_LACLA       --EVAVVEQRAKMDGRQMFLQLAPIKK---------------------------------
IF3_STRP1       --DIAIIEQRAKMDGRQMFMQLAPISDKK-------------------------------
IF3_MYXXA       --DVAVVEQMPRMEGRLMFMILAPTPKVAQKARELVRQAATAAKRPPPPGAPGAGKSAAG
IF3_BORBU       --VNYVLESAAKMEGKTMFLIVAPKFKK--------------------------------
IF3_TREPA       --CGYSVEKQAAMEGRSMSMTLTPKSKK--------------------------------
IF3_SYNY3       --TEADIQQAPKREGRNMMMFLSPKKV---------------------------------
IF3_MYCFE       --LADIAKEAELVNDRFLDMYLQPNKIKVNKYRKEHNLVDKNSDSQDKSVSEEDTNEGEQ
IF3_MYCGE       --VVEIQKPLTASSKTMYAALLVPLKR---------------------------------
IF3_MYCPN       --AVEVQKPLTASSKTMYSALLVPRKK---------------------------------
IF3_UREPA       --YGTVVQANKKVSNYRYETIIEPIKK---------------------------------
                                     . *                                    

IF3_HELPY       ----------------------------------
IF3_HELPJ       ----------------------------------
IF3_CAMJE       ----------------------------------
IF3_BUCAI       ----------------------------------
IF3_BUCAP       ----------------------------------
IF3_ECOLI       ----------------------------------
IF3_SALTY       ----------------------------------
IF3_KLEPN       ----------------------------------
IF3_SERMA       ----------------------------------
IF3_PROHU       ----------------------------------
IF3_VIBCH       ----------------------------------
IF3_HAEIN       ----------------------------------
IF3_PASMU       ----------------------------------
IF3_PSEPH       ----------------------------------
IF3_PSESM       ----------------------------------
IF3_PSEAE       ----------------------------------
IF3_NEIMA       ----------------------------------
IF3_XYLFA       ----------------------------------
IF3_RHOS4       ----------------------------------
IF3_RICPR       ----------------------------------
IF3_AQUAE       ----------------------------------
IF3_CHLMU       ----------------------------------
IF3_CHLTR       ----------------------------------
IF3_CHLPN       ----------------------------------
IF3_MYCLE       DTDGSPH---------------------------
IF3_MYCTU       DSKAAPN---------------------------
IF3_STRCO       DAEAEAPAEAPAEA--------------------
IF3_DEIRA       ESAPSA----------------------------
IF3_THEMA       ----------------------------------
IF3_GEOSE       ----------------------------------
IF3_BACSU       ----------------------------------
IF3_LISMO       ----------------------------------
IF3_BACHD       ----------------------------------
IF3_LACLA       ----------------------------------
IF3_STRP1       ----------------------------------
IF3_MYXXA       ASSGAEEKAEETAEEKKEAQAAPAAAEAQSPTAS
IF3_BORBU       ----------------------------------
IF3_TREPA       ----------------------------------
IF3_SYNY3       ----------------------------------
IF3_MYCFE       ----------------------------------
IF3_MYCGE       ----------------------------------
IF3_MYCPN       ----------------------------------
IF3_UREPA       ----------------------------------